Zinc finger protein ZPR1

Overview
NameZinc finger protein ZPR1
Smed IDSMED30029018
Length (bp)1660
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger protein ZPR1 (SMED30029018) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger protein ZPR1 (SMED30029018) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger protein ZPR1 (SMED30029018) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger protein ZPR1 (SMED30029018) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029018

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029018h1SMcG0003456 Contig7555uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029018h1SMcG0003456 Contig7555newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
posterior sideSMED30029018h1SMcG0003456 dd_Smed_v4_4302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30029018h1SMcG0003456 dd_Smed_v4_4302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger protein ZPR1 vs. Ensembl Human
Match: ZPR1 (ZPR1 zinc finger [Source:HGNC Symbol;Acc:HGNC:13051])

HSP 1 Score: 332.798 bits (852), Expect = 3.771e-108
Identity = 190/437 (43.48%), Postives = 270/437 (61.78%), Query Frame = 1
Query:   85 DILFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            D LF+ + A+D      E+ESLCMNC+ NG+T+L LT+IPFFR++++SSF C HC + N  I   G IQD+GV++ L+V    D+NR +VK+ SA   IP LD   P      + TT+EG I+  I  L   Q  RR      A +IDEFI+KLK+L ++ + F+L + DP+GNS +EN  AP+ D  L + HY R++++ E L +           Q+    E  EE + + EVL F+  CPEC++P +  MK++ IPHFKEVI+MA+ CE+CG + NEVK G  +   G RITL I    D+ RD LKS+T +++IP+LE E     LGG+FTT+EG+L  + + L   NPF  GDS    +TE  L    Q +  +  G       I++DPAG SY+Q++Y PE DP + VE Y+R++++NE LGLNDM T+ Y
Sbjct:   29 DHLFRPISAEDEEQQPTEIESLCMNCYCNGMTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHAPQKDDALVITHYNRTRQQEEMLGL-----------QEEAPAEKPEEEDLRNEVLQFSTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKDIRE-LVTKNPFTLGDSSNPGQTE-RLQEFSQKMDQIIEG-NMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGY 451          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Human
Match: ZPR1 (ZPR1 zinc finger [Source:HGNC Symbol;Acc:HGNC:13051])

HSP 1 Score: 315.849 bits (808), Expect = 5.494e-102
Identity = 182/437 (41.65%), Postives = 260/437 (59.50%), Query Frame = 1
Query:   85 DILFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            D LF+ + A+D      E+ESLCMNC+ NG+T+L LT+IPFFR++++SSF C HC + N  I   G IQD+GV++ L+V    D+NR +VK+ SA   IP LD   P      + TT+EG I+  I  L   Q  RR      A +IDEFI+KLK+L ++ + F+L + DP+GNS +EN  AP+ D  L + HY R++++ E L +           Q+    E  EE + + EVL F+  CPEC++P +  MK++ IPHFKEVI+MA+ CE+CG + NEVK G  +   G RITL I    D+ RD LKS+T +++IP+LE E     LGG+FTT+EG+L  + +                    II GN+                 I++DPAG SY+Q++Y PE DP + VE Y+R++++NE LGLNDM T+ Y
Sbjct:   29 DHLFRPISAEDEEQQPTEIESLCMNCYCNGMTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHAPQKDDALVITHYNRTRQQEEMLGL-----------QEEAPAEKPEEEDLRNEVLQFSTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKDIREL-------------------IIEGNM-------------KAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGY 422          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Human
Match: ZPR1 (ZPR1 zinc finger [Source:HGNC Symbol;Acc:HGNC:13051])

HSP 1 Score: 246.899 bits (629), Expect = 7.067e-76
Identity = 147/358 (41.06%), Postives = 208/358 (58.10%), Query Frame = 1
Query:  319 CKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            C  ND+NR +VK+ SA   IP LD   P      + TT+EG I+  I  L   Q  RR      A +IDEFI+KLK+L ++ + F+L + DP+GNS +EN  AP+ D  L + HY R++++ E L +                           +VL F+  CPEC++P +  MK++ IPHFKEVI+MA+ CE+CG + NEVK G  +   G RITL I    D+ RD LKS+T +++IP+LE E     LGG+FTT+EG+L  + + L   NPF  GDS    +TE  L    Q +  +  G       I++DPAG SY+Q++Y PE DP + VE Y+R++++NE LGLNDM T+ Y
Sbjct:   51 CYCNDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHAPQKDDALVITHYNRTRQQEEMLGL---------------------------QVLQFSTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKDIRE-LVTKNPFTLGDSSNPGQTE-RLQEFSQKMDQIIEG-NMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGY 378          

HSP 2 Score: 106.686 bits (265), Expect = 2.100e-24
Identity = 58/197 (29.44%), Postives = 107/197 (54.31%), Query Frame = 1
Query:  127 VMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDIS--FTTIEGAISSIIE----NLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINE 699
            V++  + C  C+    T + L +IP F++V+I +  C +C  + N +   G ++  G +  L++   +D+ R ++KS++    IP L+    +  +   FTT+EG +  I E    N  +L D    + P    ++ EF  K+  +IE N +    + DP GNS ++N  AP+ DP+++VE Y+R+ ++NE L +N+
Sbjct:  179 VLQFSTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKDIRELVTKNPFTLGD---SSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLND 372          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Human
Match: ZPR1 (ZPR1 zinc finger [Source:HGNC Symbol;Acc:HGNC:13051])

HSP 1 Score: 64.6994 bits (156), Expect = 2.805e-12
Identity = 38/106 (35.85%), Postives = 63/106 (59.43%), Query Frame = 1
Query:  526 ILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVL 843
            I+KLK+L ++ + F+L + DP+GNS +EN  AP+ D  L + HY R++++ E L +           Q+    E  EE + + EVL F+  CPEC++P +  MK++
Sbjct:    1 IVKLKELKQVASPFTLIIDDPSGNSFVENPHAPQKDDALVITHYNRTRQQEEMLGL-----------QEEAPAEKPEEEDLRNEVLQFSTNCPECNAPAQTNMKLM 95          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Celegans
Match: W03F9.1 (Zinc finger protein ZPR1 homolog [Source:UniProtKB/Swiss-Prot;Acc:O16999])

HSP 1 Score: 293.123 bits (749), Expect = 2.923e-93
Identity = 167/435 (38.39%), Postives = 250/435 (57.47%), Query Frame = 1
Query:   91 LFKELHADDLPDV-MEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDI--SFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +++ L ADD     + V+S+C  C E+G T++  T IP++R V++ SFEC HC  KNN I     +Q+ G    L V K  DL R++VKS+ A   +P L    P        TT+EG +  +   LS  Q++RR   PE A QID ++ K+   +EL   ++L L DPTGN  I+N      DP+  + HY R+ +E + L + + +  +++        E +   + K EVL F   CP C  P E +MK  DIP F+ VI+M+  C+ CG+K NEVK G  I ++G R+++++E   DL RD LK+DT A+ IP++++E    +L GRFTT+EG+L    ++L+  + F  GDS    E   +    ++ L D+   LR   T+I++DP G SY+Q L  P  DPRLT E Y R+YE+N+ LG+NDM  +NY
Sbjct:    8 IYRNLSADDYEAAPIVVDSVCPVCEEDGETRIMCTSIPYYRAVILMSFECPHCGHKNNEIQSGEAVQEHGTLIVLRVQKPEDLRRQLVKSEYASIEVPELQLEIPHKSQPGEVTTVEGVLERVHRGLSQDQEKRRLLDPEGASQIDAYLQKITSCMELGETWTLRLRDPTGNCYIQNPDVRHVDPRCIISHYHRNLDERKLLALADDNEEEEEVEPSAAAPEFKSYEDAKQEVLHFATDCPNCHGPTEVKMKPTDIPFFQTVIIMSLACDRCGYKSNEVKSGGAIRDQGCRMSVKLEKDLDLARDVLKTDTCALSIPEIDLEVGGNALCGRFTTIEGLLTATKEQLDAQSSFFMGDSAQTGEKSAVT-TFLEKLDDI-IALRLPATIILDDPTGCSYVQSLTAPMDDPRLTKEFYTRTYEQNDELGINDMKVENY 440          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Celegans
Match: W03F9.1 (Zinc finger protein ZPR1 homolog [Source:UniProtKB/Swiss-Prot;Acc:O16999])

HSP 1 Score: 49.6766 bits (117), Expect = 1.431e-7
Identity = 36/81 (44.44%), Postives = 49/81 (60.49%), Query Frame = 1
Query: 1144 GDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            GDS    E   +    ++ L D+   LR   T+I++DP G SY+Q L  P  DPRLT E Y R+YE+N+ LG+NDM  +NY
Sbjct:    2 GDSAQTGEKSAVT-TFLEKLDDI-IALRLPATIILDDPTGCSYVQSLTAPMDDPRLTKEFYTRTYEQNDELGINDMKVENY 80          

HSP 2 Score: 49.6766 bits (117), Expect = 1.899e-7
Identity = 25/59 (42.37%), Postives = 37/59 (62.71%), Query Frame = 1
Query:  523 FILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINE 699
            F+ KL D+I L    ++ L DPTG S +++  AP  DP+L  E Y R+ E+N+ L IN+
Sbjct:   16 FLEKLDDIIALRLPATIILDDPTGCSYVQSLTAPMDDPRLTKEFYTRTYEQNDELGIND 74          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Fly
Match: Zpr1 (gene:FBgn0030096 transcript:FBtr0071342)

HSP 1 Score: 324.324 bits (830), Expect = 2.939e-105
Identity = 188/437 (43.02%), Postives = 274/437 (62.70%), Query Frame = 1
Query:   91 LFKELHADDLPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDIS--FTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQ-KNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDP--RLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +F+E++A+   +++EVES CMNC E G+T+L  T+IPFFR+VV+ SF+C HC   NN +     IQ  G++  L V    DLNRR+V+S ++  +IP ++   P+       TT+EG I   I  LS  Q++RR   PE A  I+++I +L  L E+ T F + L D +GNS IEN +AP +DPQL+  ++ RSQ++NE L + E +   ++ H  K   E++    N   EVL F   CP C +P E  MK+ +IPHFKEV++MA+ C +CG K NEVK G G+  +G R  ++I + EDL RD LKS+T +M IP+L++E    +L GRFTTVEG+L  M D+L+ T      D  T+ +    +   + +  DV N L+  +TL++EDPAG +Y+Q L   + +P  +LTVE Y+RSYE+NE LGLNDM T+ Y
Sbjct:   24 IFREINAEQTDEIVEVESACMNCFETGVTRLLPTKIPFFREVVLMSFKCDHCGHINNEMQSASEIQKSGIRIELRVQSVADLNRRVVRSDNSSISIPEIELEIPVQSQKGEVTTVEGIIERTIAGLSQDQEKRRIDHPETAASIEKYIERLHRLKEVTTPFQVLLEDISGNSFIENPLAPAADPQLKTSYFTRSQQQNEQLGLYEQN--HEEQHLLKPIAEDSWPIENLHGEVLQFPTNCPSCQAPCETNMKLTNIPHFKEVVIMATVCGACGHKTNEVKSGGGVEAQGVRFRVQIASREDLTRDVLKSETCSMSIPELDLEVGPHALCGRFTTVEGLLVAMRDQLDGTLFHDSADDATKQQ----MQRFLDTFEDVMN-LKRVITLVLEDPAGNTYVQSLSDDDSEPDDKLTVERYDRSYEDNEDLGLNDMKTEGY 453          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Zebrafish
Match: zpr1 (ZPR1 zinc finger [Source:ZFIN;Acc:ZDB-GENE-040426-2110])

HSP 1 Score: 346.28 bits (887), Expect = 7.936e-114
Identity = 195/446 (43.72%), Postives = 277/446 (62.11%), Query Frame = 1
Query:   91 LFKELHADD---LPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNP-------KTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQT--RTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +FK+++A+D    P V  +ESLCMNC+ENG T+L LT+IPFF++++ISSF C HCN+ N  I   G IQ++GV++ L V  K D+NR +VKS SA   IP LD   P      S +TIEG +   +  L   Q  R+   P +A +I+EFI +LK L E+  EF+L + DP+GNS IEN  AP+ D  L V +Y+R+ ++N +L I               VEE Q + +P       + EVL+FN  CPEC++P    MK++ IPHFKEVI+MA+ C+SCG + NEVK G    E G RITL +    D+ RD LKS+T ++ IP+LE E    +LGG+FTTVEG+L  + + +   NPF+ GDS    R E   + G   Q +  +  G    V ++++DPAG SY+Q++Y P+ DP + +E+Y R++E+NE LGLNDM T+ Y
Sbjct:   13 VFKDINAEDEDQQPTV--IESLCMNCYENGSTRLLLTKIPFFKEIIISSFACPHCNWSNTEIQSAGRIQEQGVQYTLQVKTKRDMNREVVKSDSASTRIPQLDFEIPAFTQKGSLSTIEGLLDRAVAGLEQDQPIRKATDPTVADKIEEFIQRLKKLKEVEDEFTLIIDDPSGNSFIENPFAPQKDAALSVTYYKRTPQQNASLGIE--------------VEEEQADESPGNDLDTLRNEVLVFNTNCPECNAPANTNMKLVQIPHFKEVIIMATNCDSCGHRTNEVKSGGATEELGTRITLHLTDPSDMSRDLLKSETCSVLIPELEFELGMAALGGKFTTVEGLLKDIKELIVSKNPFMCGDSSASDRVEKLQLFG---QKIDKIMAG-EMDVHIVLDDPAGNSYLQNVYAPDPDPEMKIEKYTRTFEQNEDLGLNDMKTEGY 438          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Zebrafish
Match: zpr1 (ZPR1 zinc finger [Source:ZFIN;Acc:ZDB-GENE-040426-2110])

HSP 1 Score: 346.28 bits (887), Expect = 7.936e-114
Identity = 195/446 (43.72%), Postives = 277/446 (62.11%), Query Frame = 1
Query:   91 LFKELHADD---LPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNP-------KTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQT--RTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +FK+++A+D    P V  +ESLCMNC+ENG T+L LT+IPFF++++ISSF C HCN+ N  I   G IQ++GV++ L V  K D+NR +VKS SA   IP LD   P      S +TIEG +   +  L   Q  R+   P +A +I+EFI +LK L E+  EF+L + DP+GNS IEN  AP+ D  L V +Y+R+ ++N +L I               VEE Q + +P       + EVL+FN  CPEC++P    MK++ IPHFKEVI+MA+ C+SCG + NEVK G    E G RITL +    D+ RD LKS+T ++ IP+LE E    +LGG+FTTVEG+L  + + +   NPF+ GDS    R E   + G   Q +  +  G    V ++++DPAG SY+Q++Y P+ DP + +E+Y R++E+NE LGLNDM T+ Y
Sbjct:   13 VFKDINAEDEDQQPTV--IESLCMNCYENGSTRLLLTKIPFFKEIIISSFACPHCNWSNTEIQSAGRIQEQGVQYTLQVKTKRDMNREVVKSDSASTRIPQLDFEIPAFTQKGSLSTIEGLLDRAVAGLEQDQPIRKATDPTVADKIEEFIQRLKKLKEVEDEFTLIIDDPSGNSFIENPFAPQKDAALSVTYYKRTPQQNASLGIE--------------VEEEQADESPGNDLDTLRNEVLVFNTNCPECNAPANTNMKLVQIPHFKEVIIMATNCDSCGHRTNEVKSGGATEELGTRITLHLTDPSDMSRDLLKSETCSVLIPELEFELGMAALGGKFTTVEGLLKDIKELIVSKNPFMCGDSSASDRVEKLQLFG---QKIDKIMAG-EMDVHIVLDDPAGNSYLQNVYAPDPDPEMKIEKYTRTFEQNEDLGLNDMKTEGY 438          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Zebrafish
Match: zpr1 (ZPR1 zinc finger [Source:ZFIN;Acc:ZDB-GENE-040426-2110])

HSP 1 Score: 128.642 bits (322), Expect = 3.236e-34
Identity = 64/134 (47.76%), Postives = 88/134 (65.67%), Query Frame = 1
Query:  733 NYVEEAQEEFNP-------KTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMAD 1113
            + VEE Q + +P       + EVL+FN  CPEC++P    MK++ IPHFKEVI+MA+ C+SCG + NEVK G    E G RITL +    D+ RD LKS+T ++ IP+LE E    +LGG+FTTVEG+L  + +
Sbjct:   50 SIVEEEQADESPGNDLDTLRNEVLVFNTNCPECNAPANTNMKLVQIPHFKEVIIMATNCDSCGHRTNEVKSGGATEELGTRITLHLTDPSDMSRDLLKSETCSVLIPELEFELGMAALGGKFTTVEGLLKDIKE 183          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Zebrafish
Match: zpr1 (ZPR1 zinc finger [Source:ZFIN;Acc:ZDB-GENE-040426-2110])

HSP 1 Score: 123.635 bits (309), Expect = 1.035e-32
Identity = 64/140 (45.71%), Postives = 88/140 (62.86%), Query Frame = 1
Query:   91 LFKELHADD---LPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKAT 495
            +FK+++A+D    P V  +ESLCMNC+ENG T+L LT+IPFF++++ISSF C HCN+ N  I   G IQ++GV++ L V  K D+NR +VKS SA   IP LD   P      S +TIEG +   +  L   Q  R+  T
Sbjct:   13 VFKDINAEDEDQQPTV--IESLCMNCYENGSTRLLLTKIPFFKEIIISSFACPHCNWSNTEIQSAGRIQEQGVQYTLQVKTKRDMNREVVKSDSASTRIPQLDFEIPAFTQKGSLSTIEGLLDRAVAGLEQDQPIRKVCT 150          

HSP 2 Score: 80.1073 bits (196), Expect = 2.315e-17
Identity = 38/120 (31.67%), Postives = 66/120 (55.00%), Query Frame = 1
Query:  784 IFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLK 1143
            +   LC  C      R+ +  IP FKE+I+ +  C  C +   E++    I E+G + TL+++T  D+ R+ +KSD+A+ +IP L+ E  + +  G  +T+EG+L +    LE+  P  K
Sbjct:   28 VIESLCMNCYENGSTRLLLTKIPFFKEIIISSFACPHCNWSNTEIQSAGRIQEQGVQYTLQVKTKRDMNREVVKSDSASTRIPQLDFEIPAFTQKGSLSTIEGLLDRAVAGLEQDQPIRK 147          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Xenopus
Match: zpr1 (ZPR1 zinc finger [Source:NCBI gene;Acc:549888])

HSP 1 Score: 329.331 bits (843), Expect = 5.086e-107
Identity = 188/447 (42.06%), Postives = 267/447 (59.73%), Query Frame = 1
Query:   73 MSHTDILFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDI--SFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGL------RTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +  +  LF+++ A+D      E+ESLCMNC+ NG+T+L LTR+PFF+++++SSF C  C + N  I   G IQ++GV++ L+V  K D+NR ++K+  A   IP LD   P      + TTIEG I   I  L   Q  RR     IA ++DEFI+KL+ L +   +F+  + DP+GNS +EN  AP+ D  L V  Y+R+ E++  L +  S   Q    Q+       EE   + EVL F   CPEC+ P +  MK++ IPHFKEVI+MA+ C+SCG + NEVK G  I   G RITL I  + DL RD LKS+T  + +P+LE E   G+LGG+FTT+EG+L  + D + + NPF  GDS +    E         L D G  +            I++DPAG SY+Q++Y PE+DP + VE+YER++E+NE LGLNDM T+ Y
Sbjct:    9 VRESSALFRDISAEDEEQQPAEIESLCMNCYHNGLTRLLLTRVPFFKEIIVSSFTCDSCGWSNTEIQSAGRIQEQGVQYSLSVRNKQDVNREVIKTDYAKVQIPELDFEIPACSQKGALTTIEGIIERTIVGLQQEQSLRRAENESIAAKVDEFIIKLQRLKDGEDQFTFIIDDPSGNSFVENPFAPQKDEALLVTRYKRTPEQDVLLGLESSSASQ---KQEEKPMPTSEEL--RDEVLQFPTNCPECNVPAKTNMKLVQIPHFKEVIIMATNCDSCGHRTNEVKSGGAIEPLGTRITLHITDLSDLTRDVLKSETCGISVPELEFELGMGALGGKFTTLEGLLKDIKDLVVDKNPFTLGDSSSSDRRE--------KLEDFGRKIDQILEGHLKAHFILDDPAGNSYLQNVYAPEEDPEMKVEKYERTFEQNEDLGLNDMKTEGY 442          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Xenopus
Match: zpr1 (ZPR1 zinc finger [Source:NCBI gene;Acc:549888])

HSP 1 Score: 322.013 bits (824), Expect = 1.969e-104
Identity = 185/447 (41.39%), Postives = 264/447 (59.06%), Query Frame = 1
Query:   73 MSHTDILFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDI--SFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGL------RTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +  +  LF+++ A+D      E+ESLCMNC+ NG+T+L LTR+PFF+++++SSF C  C + N  I   G IQ++GV++ L+V  K D+NR ++K+  A   IP LD   P      + TTIEG I   I  L   Q  RR     IA ++DEFI+KL+ L +   +F+  + DP+GNS +EN  AP+ D  L V  Y+R+ E++  L + E               E++E       VL F   CPEC+ P +  MK++ IPHFKEVI+MA+ C+SCG + NEVK G  I   G RITL I  + DL RD LKS+T  + +P+LE E   G+LGG+FTT+EG+L  + D + + NPF  GDS +    E         L D G  +            I++DPAG SY+Q++Y PE+DP + VE+YER++E+NE LGLNDM T+ Y
Sbjct:    9 VRESSALFRDISAEDEEQQPAEIESLCMNCYHNGLTRLLLTRVPFFKEIIVSSFTCDSCGWSNTEIQSAGRIQEQGVQYSLSVRNKQDVNREVIKTDYAKVQIPELDFEIPACSQKGALTTIEGIIERTIVGLQQEQSLRRAENESIAAKVDEFIIKLQRLKDGEDQFTFIIDDPSGNSFVENPFAPQKDEALLVTRYKRTPEQDVLLGLEERG-------------ESRE-----LRVLQFPTNCPECNVPAKTNMKLVQIPHFKEVIIMATNCDSCGHRTNEVKSGGAIEPLGTRITLHITDLSDLTRDVLKSETCGISVPELEFELGMGALGGKFTTLEGLLKDIKDLVVDKNPFTLGDSSSSDRRE--------KLEDFGRKIDQILEGHLKAHFILDDPAGNSYLQNVYAPEEDPEMKVEKYERTFEQNEDLGLNDMKTEGY 429          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Xenopus
Match: zpr1 (ZPR1 zinc finger [Source:NCBI gene;Acc:549888])

HSP 1 Score: 285.034 bits (728), Expect = 1.808e-90
Identity = 176/449 (39.20%), Postives = 246/449 (54.79%), Query Frame = 1
Query:   73 MSHTDILFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDI--SFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINES--DFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGL------RTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +  +  LF+++ A+D      E+ESLCMNC+ NG+T+L LTR+PFF+++++SSF C  C + N  I   G IQ++GV++ L+V  K D+NR ++K+  A   IP LD   P      + TTIEG I   I  L   Q  RR         ID                     DP+GNS +EN  AP+ D  L V  Y+R+ E++  L +  S   F                      +VL F   CPEC+ P +  MK++ IPHFKEVI+MA+ C+SCG + NEVK G  I   G RITL I  + DL RD LKS+T  + +P+LE E   G+LGG+FTT+EG+L  + D + + NPF  GDS +    E         L D G  +            I++DPAG SY+Q++Y PE+DP + VE+YER++E+NE LGLNDM T+ Y
Sbjct:    9 VRESSALFRDISAEDEEQQPAEIESLCMNCYHNGLTRLLLTRVPFFKEIIVSSFTCDSCGWSNTEIQSAGRIQEQGVQYSLSVRNKQDVNREVIKTDYAKVQIPELDFEIPACSQKGALTTIEGIIERTIVGLQQEQSLRRI--------ID---------------------DPSGNSFVENPFAPQKDEALLVTRYKRTPEQDVLLGLEVSICGF--------------------LLQVLQFPTNCPECNVPAKTNMKLVQIPHFKEVIIMATNCDSCGHRTNEVKSGGAIEPLGTRITLHITDLSDLTRDVLKSETCGISVPELEFELGMGALGGKFTTLEGLLKDIKDLVVDKNPFTLGDSSSSDRRE--------KLEDFGRKIDQILEGHLKAHFILDDPAGNSYLQNVYAPEEDPEMKVEKYERTFEQNEDLGLNDMKTEGY 400          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Mouse
Match: Zpr1 (ZPR1 zinc finger [Source:MGI Symbol;Acc:MGI:1330262])

HSP 1 Score: 336.65 bits (862), Expect = 8.809e-110
Identity = 195/438 (44.52%), Postives = 268/438 (61.19%), Query Frame = 1
Query:   82 TDILFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            T  LF+ L A+D      E+ESLCMNC+ NG T+L LT+IPFFR++++SSF C HC + N  I   G IQD+GV++ L V  + D+NR +VK+ SA   IP LD   P      + TT+EG IS  I  L   Q  RR     IA +IDEFI KLKDL ++ + F+L + DP+GNS +EN  AP+ D  L + +Y R+ ++ E L +           Q    EE  EE + + EVL FN  CPEC++P +  MK++ IPHFKEVI+MA+ CE+CG + NEVK G  +   G RITL I    D+ RD LKS+T +++IP+LE E     LGG+FTT+EG+L  + + L   NPF  GDS    ++E  L    Q L  +  G +     I+ DPAG SY+Q++Y PE DP + VE Y+R++++NE LGLNDM T+ Y
Sbjct:   28 TGPLFRPLSAEDEEQQPTEIESLCMNCYRNGTTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLTVRSQEDMNREVVKTDSATTRIPELDFEIPAFSQKGALTTVEGLISRAISGLEQDQPTRRAVEGAIAERIDEFIGKLKDLKQMASPFTLVIDDPSGNSFVENPHAPQKDNALVITYYDRTPQQAEMLGL-----------QAEAPEEKAEEEDLRNEVLQFNTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDPSDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKDIRE-LVTKNPFTLGDSSNPDQSE-KLQEFSQKLGQIIEG-KMKAHFIMNDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGY 451          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Mouse
Match: Zpr1 (ZPR1 zinc finger [Source:MGI Symbol;Acc:MGI:1330262])

HSP 1 Score: 249.21 bits (635), Expect = 5.149e-77
Identity = 150/358 (41.90%), Postives = 208/358 (58.10%), Query Frame = 1
Query:  319 CKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            C +ND+NR +VK+ SA   IP LD   P      + TT+EG IS  I  L   Q  RR     IA +IDEFI KLKDL ++ + F+L + DP+GNS +EN  AP+ D  L + +Y R+ ++ E L +                           +VL FN  CPEC++P +  MK++ IPHFKEVI+MA+ CE+CG + NEVK G  +   G RITL I    D+ RD LKS+T +++IP+LE E     LGG+FTT+EG+L  + + L   NPF  GDS    ++E  L    Q L  +  G +     I+ DPAG SY+Q++Y PE DP + VE Y+R++++NE LGLNDM T+ Y
Sbjct:   51 CYRNDMNREVVKTDSATTRIPELDFEIPAFSQKGALTTVEGLISRAISGLEQDQPTRRAVEGAIAERIDEFIGKLKDLKQMASPFTLVIDDPSGNSFVENPHAPQKDNALVITYYDRTPQQAEMLGL---------------------------QVLQFNTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDPSDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKDIRE-LVTKNPFTLGDSSNPDQSE-KLQEFSQKLGQIIEG-KMKAHFIMNDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGY 378          
BLAST of Zinc finger protein ZPR1 vs. UniProt/SwissProt
Match: sp|Q62384|ZPR1_MOUSE (Zinc finger protein ZPR1 OS=Mus musculus OX=10090 GN=Zpr1 PE=1 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 6.162e-109
Identity = 195/438 (44.52%), Postives = 268/438 (61.19%), Query Frame = 1
Query:   82 TDILFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            T  LF+ L A+D      E+ESLCMNC+ NG T+L LT+IPFFR++++SSF C HC + N  I   G IQD+GV++ L V  + D+NR +VK+ SA   IP LD   P      + TT+EG IS  I  L   Q  RR     IA +IDEFI KLKDL ++ + F+L + DP+GNS +EN  AP+ D  L + +Y R+ ++ E L +           Q    EE  EE + + EVL FN  CPEC++P +  MK++ IPHFKEVI+MA+ CE+CG + NEVK G  +   G RITL I    D+ RD LKS+T +++IP+LE E     LGG+FTT+EG+L  + + L   NPF  GDS    ++E  L    Q L  +  G +     I+ DPAG SY+Q++Y PE DP + VE Y+R++++NE LGLNDM T+ Y
Sbjct:   28 TGPLFRPLSAEDEEQQPTEIESLCMNCYRNGTTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLTVRSQEDMNREVVKTDSATTRIPELDFEIPAFSQKGALTTVEGLISRAISGLEQDQPTRRAVEGAIAERIDEFIGKLKDLKQMASPFTLVIDDPSGNSFVENPHAPQKDNALVITYYDRTPQQAEMLGL-----------QAEAPEEKAEEEDLRNEVLQFNTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDPSDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKDIRE-LVTKNPFTLGDSSNPDQSE-KLQEFSQKLGQIIEG-KMKAHFIMNDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGY 451          
BLAST of Zinc finger protein ZPR1 vs. UniProt/SwissProt
Match: sp|Q2TBX0|ZPR1_BOVIN (Zinc finger protein ZPR1 OS=Bos taurus OX=9913 GN=ZNF259 PE=2 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 5.084e-108
Identity = 191/435 (43.91%), Postives = 269/435 (61.84%), Query Frame = 1
Query:   91 LFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            LF+ + A+D      E+ESLCMNC+ NG+T+L LT+IPFFR++++SSF C HC + N  I   G IQD+GV++ L V  + D++R +VK+ SA   IP LD   P      + TT+EG IS  I  L   Q  RR     +A +IDEFI KLK+L ++ + F+L + DP+GNS +EN  AP+ D  L + HY R+ ++ E L +           Q    EE  EE + + EVL FN  CPEC++P +  MK++ IPHFKEVI+MA+ CE+CG + NEVK G  +   G RIT  I    D+ RD LKS+T +++IP+LE E     LGG+FTT+EG+L  + + L   NPF  GDS +  +TE  L    Q L  +  G+      I++DPAG SY+Q++Y PE DP + VE Y+R++++NE LGLNDM T+ Y
Sbjct:   31 LFRPISAEDEEQQPTEIESLCMNCYRNGMTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLTVRAQEDMDREVVKTDSATTRIPELDFEIPAFSQKGALTTVEGLISRAISGLEQDQPTRRANEEAVAERIDEFIAKLKELKQVASPFTLIIDDPSGNSFVENPHAPRKDDALVITHYNRTLQQEEMLGL-----------QAEAPEEKPEEEDIRNEVLQFNTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITFHITDPSDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGMLKDIRE-LVTKNPFTLGDSSSPGQTE-KLQEFSQKLDQILEGI-LKAHFIMDDPAGNSYLQNVYAPEDDPEMKVEHYKRTFDQNEELGLNDMKTEGY 451          
BLAST of Zinc finger protein ZPR1 vs. UniProt/SwissProt
Match: sp|O75312|ZPR1_HUMAN (Zinc finger protein ZPR1 OS=Homo sapiens OX=9606 GN=ZPR1 PE=1 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 1.811e-107
Identity = 190/437 (43.48%), Postives = 270/437 (61.78%), Query Frame = 1
Query:   85 DILFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            D LF+ + A+D      E+ESLCMNC+ NG+T+L LT+IPFFR++++SSF C HC + N  I   G IQD+GV++ L+V    D+NR +VK+ SA   IP LD   P      + TT+EG I+  I  L   Q  RR      A +IDEFI+KLK+L ++ + F+L + DP+GNS +EN  AP+ D  L + HY R++++ E L +           Q+    E  EE + + EVL F+  CPEC++P +  MK++ IPHFKEVI+MA+ CE+CG + NEVK G  +   G RITL I    D+ RD LKS+T +++IP+LE E     LGG+FTT+EG+L  + + L   NPF  GDS    +TE  L    Q +  +  G       I++DPAG SY+Q++Y PE DP + VE Y+R++++NE LGLNDM T+ Y
Sbjct:   29 DHLFRPISAEDEEQQPTEIESLCMNCYCNGMTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHAPQKDDALVITHYNRTRQQEEMLGL-----------QEEAPAEKPEEEDLRNEVLQFSTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKDIRE-LVTKNPFTLGDSSNPGQTE-RLQEFSQKMDQIIEG-NMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGY 451          
BLAST of Zinc finger protein ZPR1 vs. UniProt/SwissProt
Match: sp|A9CB27|ZPR1_PAPAN (Zinc finger protein ZPR1 OS=Papio anubis OX=9555 GN=ZNF259 PE=3 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 2.061e-107
Identity = 190/437 (43.48%), Postives = 267/437 (61.10%), Query Frame = 1
Query:   85 DILFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            D LF+ + A+D      E+ESLCMNC+ NG+T+L LT+IPFFR++++SSF C HC + N  I   G +QD+GV++ L V    D+NR +VK+ SA   IP LD   P      + TT+EG I+  I  L   Q  RR      A +IDEFI+KLK+L ++ + F+L + DP+GNS +EN  AP+ D  L + HY R+Q + E L +           Q+    E  EE + + EVL FN  CPEC++P +  MK++ IPHFKEVI+MA+ CE+CG + NEVK G  +   G RITL I    D+ RD LKS+T +++IP+LE E     LGG+FTT+EG+L  + + L   NPF  GDS    + E  L    Q +  +  G       I++DPAG SY+Q++Y PE DP + VE Y+R++++NE LGLNDM T+ Y
Sbjct:   29 DHLFRPISAEDEEQQPTEIESLCMNCYCNGMTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRVQDQGVRYTLTVRAPEDMNREVVKTDSATTRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHAPQKDDSLVITHYNRTQHQKEMLGL-----------QEEAPAEKPEEEDLRNEVLQFNTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDPSDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKDIRE-LVTKNPFTLGDSSNPCQKE-RLQEFSQKMDQIIEG-NMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGY 451          
BLAST of Zinc finger protein ZPR1 vs. UniProt/SwissProt
Match: sp|O13724|ZPR1_SCHPO (Zinc finger protein zpr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zpr1 PE=3 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 4.164e-102
Identity = 189/429 (44.06%), Postives = 266/429 (62.00%), Query Frame = 1
Query:  127 VMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQE------EFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGV---TLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            V EVESLCM C +NG TKL LT IP+FR+VV+ SFEC HC FKN  +     IQ +G K   +V  K DLNR +VKS+ A+ +IP +    P      TTIEG +S+++++LS  Q+ R+++ P++  QI+ FI K+  L   +  F++ + D TGNS IE       D   QV  Y+R+ E+N  L + ++D P+D   Q N      +      E +P  EV  F+  CP CS   +  MK+LDIPHFKEVI+M++ C+ CG++ NEVK G  I  KGR+ITL++   EDL RD LKS+TA++KIP+L ++   G+LGGRFTT+EG+L Q+ D+L       + DS T  +    + N  Q L ++    R G    TLI++DP   SY+Q+ Y P+ DP +T+EEYERS++ NE LGLNDM T+NY
Sbjct:   31 VQEVESLCMECGKNGTTKLLLTVIPYFREVVLMSFECPHCGFKNAQVQHAETIQPEGSKITFHVEDKEDLNRTVVKSQEAIVSIPEIQLEIPGRLGQLTTIEGILSNVVDDLSKEQESRKESAPQLYDQINAFIEKVNSLRSGSVPFTITVDDITGNSWIEMKPGRDGDRWSQVS-YKRTLEQNTKLGLVDTDQPEDVKTQTNNASNTLKHDATAVEVDPN-EVHTFHATCPSCSHQCDTHMKLLDIPHFKEVIIMSTVCDRCGYRSNEVKTGGEIPPKGRKITLKVMDAEDLSRDILKSETASLKIPELGLDLFPGTLGGRFTTIEGLLAQVYDELYGRVFSQETDSMTPEQ----VANWQQFLCNL-TAAREGATQFTLILDDPLSQSYLQNYYAPDPDPNMTIEEYERSFQVNEELGLNDMKTENY 452          

HSP 2 Score: 110.923 bits (276), Expect = 8.572e-25
Identity = 69/199 (34.67%), Postives = 100/199 (50.25%), Query Frame = 1
Query:  115 DLPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDAS-FPLT-DISFTTIEGAISSIIENLSS--LQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINE 699
            D  +V    + C +C     T + L  IP F++V+I S  C  C +++N +   G I  KG K  L V    DL+R ++KS++A   IP L    FP T    FTTIEG ++ + + L       E    TPE      +F+  L    E  T+F+L L DP   S ++NY AP  DP + +E Y RS + NE L +N+
Sbjct:  248 DPNEVHTFHATCPSCSHQCDTHMKLLDIPHFKEVIIMSTVCDRCGYRSNEVKTGGEIPPKGRKITLKVMDAEDLSRDILKSETASLKIPELGLDLFPGTLGGRFTTIEGLLAQVYDELYGRVFSQETDSMTPEQVANWQQFLCNLTAAREGATQFTLILDDPLSQSYLQNYYAPDPDPNMTIEEYERSFQVNEELGLND 446          
BLAST of Zinc finger protein ZPR1 vs. TrEMBL
Match: A0A5J4P3Q4 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0007585 PE=4 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 5.684e-128
Identity = 207/442 (46.83%), Postives = 277/442 (62.67%), Query Frame = 1
Query:   91 LFKELHADDLPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESD----FPQDDDHQKNYVEEAQ------EEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +  EL+ADD P+V EVES+C NC++NGIT++ LTRI FFR++++SSF C HC F+N   D    IQDKG++  L V    DLNRR+V+   +   IP LDASFP +D   TTIEG I  I +N+  LQ ER+K  P +A  +D F+ KL+ L+ L   F+L L DP+GN  IEN  AP  DPQL+   Y RS E+   +     D     P +         E Q       E     EVL F + CP+C++P    MK++DIPHFK+V++MA+ C SCG K++EVK G G A KGRR  LR+  V DL RD L S+TAA+++P+L++E+  G+LGGRFTT+EG L  + D+L   NPFL GDS +  E    L  +I+ L  +  G R GV   ++DPAG SY+Q+LY P+ DP L V +YERS  EN+ LGLNDM T +Y
Sbjct:    5 VMAELNADDQPEVTEVESVCFNCYKNGITRILLTRIAFFREIIVSSFSCPHCGFENRTFDPASRIQDKGLRVTLKVQNACDLNRRIVRPAGSTVLIPELDASFPTSDGDLTTIEGVILRIADNIEHLQPERKKVQPGLASDLDVFLGKLRGLLSLKQPFTLVLDDPSGNGCIENIKAPDPDPQLETLLYERSAEQCAAIGFRADDDDGNLPANSSAAPTQSSEGQPSGGSTHEKIGTDEVLTFKVNCPDCNAPCATNMKLIDIPHFKQVVIMATVCSSCGHKDSEVKSGGGFAAKGRRYRLRLTHVSDLSRDILISETAAVRLPELDLESMGGTLGGRFTTLEGFLLAVRDQLISANPFLLGDSSSAEEKTGKLATVIEQLKQIAAGERLGVIFELKDPAGNSYLQNLYAPDPDPELEVIDYERSETENDELGLNDMNTTDY 446          
BLAST of Zinc finger protein ZPR1 vs. TrEMBL
Match: A0A1S8WLH7 (ZPR1 zinc finger domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_08881 PE=4 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 8.421e-127
Identity = 208/438 (47.49%), Postives = 285/438 (65.07%), Query Frame = 1
Query:   94 FKELHADDLPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDF-----PQDDDHQ--KNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
             ++L ADD P++ E+ESLC+NCHENG T+L LTRI +FR+VVISSF C HC F+N  ID    IQDKG    L V    DLNRR+V+   +  +IP LDASFP ++   +TIEG +S I EN+   Q ER+KA PEIA ++D F+ +L+ L  +   F+  L DP+GN  IEN++AP+SDPQL++  Y R++E++  +     D      PQDD      N VE          EV+ F   CP+C++P +  MK++DIPHFK++++MA+ C +CG K++EVK G GI+  GRR  LR+    DL RD L S+TA ++IP+L++E+  G+LGGRFTT+EG+L  + D+L   NPF+ GDS +  E    L  +I  L  + NG   GVT  + DPAG SY+Q+LY P+ DP LTVE+YERS  ENE LGL DM T +Y
Sbjct:    6 IQDLKADDQPEITELESLCLNCHENGTTRLLLTRIAYFREVVISSFSCPHCGFENRTIDPASRIQDKGQLITLKVRTTADLNRRVVRPSGSTVSIPELDASFPTSEGDLSTIEGVLSKIAENIERWQPERKKAEPEIADKLDAFVGQLRGLFLVERPFTFVLDDPSGNGCIENFLAPESDPQLEICSYTRTKEQDTAMGFRSDDTDDDAKPQDDAQATGSNPVESVNGRLG-VDEVVTFKTNCPDCNAPSDTNMKLVDIPHFKQIVLMATVCPACGRKDSEVKSGGGISALGRRYRLRLTHPSDLSRDVLVSETAGVRIPELDLESMGGTLGGRFTTLEGLLLAIRDQLIGANPFVLGDSASVDEKGGKLSIIIDGLKKIANGEHLGVTFEMRDPAGNSYLQNLYAPDPDPELTVEDYERSPAENEDLGLTDMNTTDY 442          
BLAST of Zinc finger protein ZPR1 vs. TrEMBL
Match: A0A4S2LIY3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006921 PE=4 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 3.200e-125
Identity = 205/437 (46.91%), Postives = 284/437 (64.99%), Query Frame = 1
Query:  100 ELHADDLPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDF-----PQDDDHQKNYVEEAQEEFNPKT---EVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +L AD+ P++ E+ESLC NC ENG T+L LTRI +FR+VVISSF C HC F+N  ID    IQDKG    L V    DLNRR+V+   +  +IP LDASFP ++   +TIEG +S I EN+   Q ER+KA PEIA ++D F+ +L+ L+ +   F+  L DP+GN  IEN++AP+SDPQL++  Y R++E++ T+     D      PQDD    +      E  N +    EV+ F   CP+C++  +  MK++DIPHFK++++MA+ C +CG K++EVK G GI+  GRR  LR+    DL RD L S+TA ++IP+LE+E+  G+LGGRFTT+EG+L  + D+L   NPF+ GDS +  E    L  +I  L  + NG   G+T  + DPAG SY+Q+LY P+ DP LTVE+YERS  ENE LGL DM T +Y
Sbjct:    8 DLKADEQPEITELESLCFNCRENGTTRLLLTRIAYFREVVISSFSCPHCGFENRTIDPASRIQDKGQLTTLKVQTTVDLNRRVVRPSGSTVSIPELDASFPTSEGDLSTIEGVLSKIAENIERWQPERKKAQPEIADKLDAFVGRLRGLLLVERPFTFVLDDPSGNGCIENFLAPESDPQLEICSYTRTKEQDITMGFRSDDGDDDAKPQDDTQATD--SNPMESVNGRLGVDEVVTFKTNCPDCNAQSDTNMKLVDIPHFKQIVLMATVCPACGRKDSEVKSGGGISALGRRYRLRLTHPSDLSRDVLVSETAGVRIPELELESMGGTLGGRFTTLEGLLLAIRDQLIGANPFVLGDSASVDEKGGKLSTIIDGLKKIANGEHLGITFEMRDPAGNSYLQNLYAPDPDPELTVEDYERSPTENEDLGLTDMNTTDY 442          
BLAST of Zinc finger protein ZPR1 vs. TrEMBL
Match: A0A2C9JPF3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106062175 PE=4 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 5.279e-124
Identity = 200/438 (45.66%), Postives = 291/438 (66.44%), Query Frame = 1
Query:   82 TDILFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYV--EEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            T  LF+E+ A+D  P++ E+ESLCMNC + G+T++FLT+IPFFR+V++SSF C +C  KN  +   G IQD+GV + LNV K  DLNR++VK++ AV  IP LD          TTIEG I++ IE L   Q++R+   P++A++I+EF+ KL++L  +   F   L DP+GNS +EN  AP  DP+L V HY R+++++  L I E    + +    N V  ++  E FN + EVL F   CP C SP +  MKV++IPHFKEV++MA+ C+ CG ++NEVK   GI E G+R+ L I T EDL RD LKS+ A + IP+L+ E E G+LGG+FTT+EG+L  + ++L++ NPFL+GDS T  +    L N  Q++ D+ +  R G   +++DP+G S+IQ L  P+ DP+L +  Y R++E+NE LGLNDM T+NY
Sbjct:   17 TKPLFREITAEDYDPEITEMESLCMNCEKQGMTRIFLTKIPFFREVIVSSFACDYCGNKNAELQPGGTIQDRGVAYKLNVKKTKDLNRQVVKTEHAVVKIPKLDFEISAGKSCITTIEGVINNAIEGLEQQQEQRKMEHPDVALRIEEFVKKLQELKLVQEPFQFILDDPSGNSFLENPHAPNKDPELVVAHYARTRQQDLELGIPE----ETESAPNNQVIGQDDGEGFNSQNEVLNFQTNCPRCGSPCDTHMKVVNIPHFKEVVIMATNCDKCGHRDNEVKSAGGIEELGQRMELIINTQEDLSRDVLKSELATLSIPELDFEMEMGTLGGKFTTIEGLLMDVKNQLKDLNPFLQGDS-TEAQVNEKLKNFCQNVEDILSCKRQGTRFVLDDPSGNSFIQSLCAPDPDPQLNITRYTRTWEQNEALGLNDMKTENY 449          

HSP 2 Score: 97.0561 bits (240), Expect = 9.145e-18
Identity = 61/208 (29.33%), Postives = 107/208 (51.44%), Query Frame = 1
Query:  124 DVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDIS--FTTIEGAISSIIENLSSLQDERRKATPEIAI--QIDEFILKLKDLIEL---NTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDH 726
            +V+  ++ C  C     T + +  IP F++VVI +  C  C  ++N +   G I++ G +  L +  + DL+R ++KS+ A  +IP LD    +  +   FTTIEG +  +   L  L    +  + E  +  ++  F   ++D++      T F L+  DP+GNS I++  AP  DPQL +  Y R+ E+NE L +N+      ++H
Sbjct:  247 EVLNFQTNCPRCGSPCDTHMKVVNIPHFKEVVIMATNCDKCGHRDNEVKSAGGIEELGQRMELIINTQEDLSRDVLKSELATLSIPELDFEMEMGTLGGKFTTIEGLLMDVKNQLKDLNPFLQGDSTEAQVNEKLKNFCQNVEDILSCKRQGTRFVLD--DPSGNSFIQSLCAPDPDPQLNITRYTRTWEQNEALGLNDMKTENYEEH 452          
BLAST of Zinc finger protein ZPR1 vs. TrEMBL
Match: A0A4Z2DIC5 (Zinc finger protein isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_000892 PE=4 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 1.176e-123
Identity = 198/436 (45.41%), Postives = 289/436 (66.28%), Query Frame = 1
Query:   91 LFKELHADDLPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDD-HQKNYVEEAQEEFNPKTE---VLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +  EL AD   + + VESLC NC +NG T L LT+I +F++V+ISSF C HC ++N ++     +QDKG +  L V    D+NRR+V    +  NIP  D+SFP +D   +T+EG I+++ +NLS LQ ER++  P++A++I++FI +L  L+++   FSL + DP+GN +IENY+AP  DPQ+ +E Y R+ E+NE L +      Q D+    N +++  E    K E   V+  ++ CP C +  E +MKV+DIPHFKEVI+MA  C  CGF++ EV+ G G++ +GRR  L+I+ + DL RD L S+TAA+KIP+L+ E+  G+LGGRFTTVEG+L  + D+L   NPF+ GDS +  ET   LG++I  L +V +G +  +   + DPAG SYIQ+LY P+ DP+L + EYER+ EENE LGL DM T+NY
Sbjct:    1 MITELDADGESEPLRVESLCTNCFKNGTTLLMLTKISYFKEVIISSFSCPHCGYENRSLIPASQVQDKGQRITLKVNNVKDMNRRVVIPVGSTVNIPEYDSSFPFSDGVVSTVEGIITALTDNLSKLQPERKQNQPDLALKIEKFIDQLHTLLKVEKPFSLVIDDPSGNGLIENYLAPDDDPQINIETYVRTPEQNELLGLQPRPAKQLDNLSDSNTIQKEPENKASKVEKDEVMSIDVNCPSCGTLTENKMKVVDIPHFKEVILMAINCPVCGFRDCEVRSGAGVSPRGRRYKLQIKNIYDLSRDILVSETAAIKIPELDFESVGGTLGGRFTTVEGLLVAITDQLISANPFVVGDSASTEETSSRLGSMISHLKEVTSGTKLNLLFELNDPAGNSYIQNLYSPDPDPQLEIIEYERNDEENEQLGLTDMKTENY 436          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Cavefish
Match: zpr1 (ZPR1 zinc finger [Source:NCBI gene;Acc:103043675])

HSP 1 Score: 348.977 bits (894), Expect = 6.891e-115
Identity = 191/435 (43.91%), Postives = 281/435 (64.60%), Query Frame = 1
Query:   91 LFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +F+E+ A+D      E++SLCMNC+E+G T+L LT+IPFFR+++ISSF C HC++ N  I   G IQ++GV + L +  K D+NR +VK+ SA   IP LD   P      S +TIEG +   +  L   Q  RR   PE+A +ID+FI +LK L  +  EF+L + DP+GNS IEN  AP+ D  L V +Y+R+ E+N +L IN+++ P+ +D   N ++        + EVL+FN  CPEC++P    MK++ IPHFKEVI+MA+ C+SCG + NEVK G    E G +ITL +    D+ RD LKS+T ++ IP++E E   G+LGG+FTT+EG+L  + + +   NPF+ GDS T TET   L    + +  +  G    V +I++DPAG SY+Q++Y P+ DP + +E+Y R++E+NE LGLNDM T++Y
Sbjct:   13 VFREISAEDEETQPTEIQSLCMNCYEDGNTRLLLTKIPFFREIIISSFTCPHCHWTNTEIQSAGRIQEQGVSYNLKIKCKEDMNREVVKTDSATTRIPELDFEIPAFTQKGSLSTIEGLLDRAVAGLEQEQPIRRATDPEVANKIDQFIQRLKKLKVMEEEFTLIIDDPSGNSFIENPCAPQKDQALSVSYYKRTPEQNASLGINDAE-PEPEDKPANDLDTM------RNEVLVFNTNCPECNAPASTNMKLVQIPHFKEVIIMATNCDSCGHRTNEVKSGGATEELGTKITLHLTDSSDMSRDLLKSETCSVLIPEIEFELGMGALGGKFTTLEGLLKDIKELVVMKNPFICGDSST-TETAEKLEQFGKKIDQIIAG-EMDVHIILDDPAGNSYLQNVYAPDPDPEMKIEKYTRTFEQNEDLGLNDMKTEDY 438          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003989.1 (pep scaffold:Pmarinus_7.0:GL483043:285:1373:-1 gene:ENSPMAG00000003653.1 transcript:ENSPMAT00000003989.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 3.669e-22
Identity = 42/78 (53.85%), Postives = 57/78 (73.08%), Query Frame = 1
Query:   91 LFKELHADDLPD--VMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNV 318
            +F +L A D PD    E+ESLCM C+ENG+T+L  TRIPFFR+VV+SSF C HC F N+ +   G +Q+KGV++ L+V
Sbjct:   18 VFSDLDAGD-PDQETTEMESLCMRCYENGVTRLLFTRIPFFREVVLSSFSCEHCGFANSEVLSAGRVQEKGVRYELSV 94          

HSP 2 Score: 45.0542 bits (105), Expect = 2.474e-6
Identity = 23/71 (32.39%), Postives = 34/71 (47.89%), Query Frame = 1
Query:  763 NPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIET 975
            +P  E      LC  C      R+    IP F+EV++ + +CE CGF  +EV     + EKG R  L + +
Sbjct:   26 DPDQETTEMESLCMRCYENGVTRLLFTRIPFFREVVLSSFSCEHCGFANSEVLSAGRVQEKGVRYELSVRS 96          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Yeast
Match: ZPR1 (Essential protein with two zinc fingers; present in nucleus of growing cells, relocates to cytoplasm in starved cells via a process mediated by Cpr1p; binds translation elongation factor eEF-1 (Tef1p); relative distribution to nucleus increases upon DNA replication stress; human ZPR1 gene can complement yeast by allowing growth during down-regulation of yeast zpr1 [Source:SGD;Acc:S000003443])

HSP 1 Score: 288.115 bits (736), Expect = 1.158e-91
Identity = 175/442 (39.59%), Postives = 256/442 (57.92%), Query Frame = 1
Query:  127 VMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLI--ELNT-EFSLELIDPTGNSIIENYMAPKSDPQLQVEH--YRRSQEENETLCI---------NESDFPQDDDHQKN-------------YVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDM 1371
            V E+ESLCMNC +NG T+L LT IP+FR+++I SF+C HC FKN  I     IQ+KG ++ L V  + D NR+++KS++A      LD   P      TT+EG +S +I++LS  Q+ R+     +  +ID+FI K+K  I  E NT   +  L DP GNS IE       +PQ +  H  Y R+ E+N  + I          +    Q  + ++N             ++ +A +  N   EV  F   CP C+   E  MK ++IPHFKEVI+M++ C+ CG+K NEVK G  I +KGRRITL  +   DL RD LKS+T +M IP+L ++ + G+LGGRFTT+EG+L Q+ ++L E+  F +        T+         L +   G +   T+I+EDP  GSYIQ++Y P+ DP +T+E+YER+ E+NE LGL+D+
Sbjct:   47 VQEIESLCMNCGKNGTTRLLLTSIPYFREIIIMSFDCPHCGFKNCEIQPASQIQEKGSRYVLKVECREDFNRQVIKSETATCKFVELDIEIPAKRGQLTTVEGLLSEMIDDLSQDQEMRKSIDEALYKKIDDFIQKVKSYINCEPNTIPITFILDDPAGNSWIE---YKPGEPQHKWSHTQYVRTDEQNVQVGIITRDQLEQRRQEQLKQLANRERNPSESVKVGSANPQFLSDATDIENFNNEVQTFRASCPSCTQECETHMKPVNIPHFKEVIIMSTVCDHCGYKSNEVKTGGAIPDKGRRITLYCDDAADLSRDILKSETCSMVIPELHLDIQEGTLGGRFTTLEGLLRQVYEEL-ESRIFTQTSDSMDEATKARWVEFFAKLKEAIAG-KVKFTVIMEDPLAGSYIQNVYAPDPDPNMTIEDYERTKEQNEDLGLSDI 483          

HSP 2 Score: 105.145 bits (261), Expect = 1.587e-24
Identity = 65/199 (32.66%), Postives = 101/199 (50.75%), Query Frame = 1
Query:  124 DVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIP--HLDASFPLTDISFTTIEGAISSIIENLSS-----LQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINE 699
            +V    + C +C +   T +    IP F++V+I S  C HC +K+N +   G I DKG +  L      DL+R ++KS++    IP  HLD         FTT+EG +  + E L S       D   +AT    +   EF  KLK+ I    +F++ + DP   S I+N  AP  DP + +E Y R++E+NE L +++
Sbjct:  287 EVQTFRASCPSCTQECETHMKPVNIPHFKEVIIMSTVCDHCGYKSNEVKTGGAIPDKGRRITLYCDDAADLSRDILKSETCSMVIPELHLDIQEGTLGGRFTTLEGLLRQVYEELESRIFTQTSDSMDEATKARWV---EFFAKLKEAIAGKVKFTVIMEDPLAGSYIQNVYAPDPDPNMTIEDYERTKEQNEDLGLSD 482          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Nematostella
Match: EDO40634 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6J5])

HSP 1 Score: 355.525 bits (911), Expect = 5.472e-118
Identity = 194/434 (44.70%), Postives = 272/434 (62.67%), Query Frame = 1
Query:   91 LFKELHADDLPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPL--TDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +F++L AD  P+   VESLC+ C E G T+  +TRIPFF+++++SSF+C HC +KNN I   G IQDKG +  L V  K DLNR++VK  SA   +P LD   P+        TIEG +S  ++ L   Q  R+   P+ A +I+EFI K+K+ IE    F+  + DP+GNS IEN +APK+DP L  + Y R+ E+N  L I     P++ +  K   +E + E   K EV IF   C  C +P E RMK + IPHFKEVI+MA+ C++CG + NEVK G G+   G R+TL+I    DL RD LKS+T  + IP+++   E+G+LGGRFTT+EG+L  + D L+  NPF  GDS    +    L + + SL ++ +G R  V +I++DPAG SYIQ++Y P+ DP L VE+YER+ E+NE LGL  M T+ Y
Sbjct:    9 IFRDLEADKGPEATAVESLCVECEEMGTTRFLMTRIPFFKEIILSSFDCPHCGYKNNFIQSAGAIQDKGCEVILKVTSKEDLNRQVVKQDSAAVRVPELDFEVPMFSQKGELNTIEGILSRAVQGLEREQPLRKALDPDTANKIEEFIGKMKECIEGEKSFTFVIDDPSGNSFIENPLAPKADPNLATKEYTRTAEQNLKLNIQ----PENQEQTKKEADEKKPE-ELKDEVQIFQTNCNSCQAPTETRMKFVSIPHFKEVIIMATVCDACGNRTNEVKSGTGVDAMGTRLTLKITDEIDLSRDVLKSETCVVTIPEIDFSVEAGTLGGRFTTLEGLLTNIYDHLKSINPFGLGDSPGLGKEN--LKSFLVSLQEIISGERMNVHIILDDPAGNSYIQNVYAPDPDPELKVEQYERTEEQNEDLGLVGMKTEGY 435          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Nematostella
Match: EDO28330 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6S5])

HSP 1 Score: 94.3597 bits (233), Expect = 1.725e-23
Identity = 41/86 (47.67%), Postives = 59/86 (68.60%), Query Frame = 1
Query:   91 LFKELHADDLPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRM 348
            +F++L AD  P+   VESLC+ C E G T+  +TRIPFF+++++SSF+C HC +KNN I   G IQDKG +  L V  K ++N+ M
Sbjct:    9 IFRDLEADKGPEATAVESLCVECEEMGTTRFLMTRIPFFKEIILSSFDCPHCGYKNNFIQSAGAIQDKGCEVILKVTSK-EVNQVM 93          
BLAST of Zinc finger protein ZPR1 vs. Ensembl Medaka
Match: zpr1 (ZPR1 zinc finger [Source:ZFIN;Acc:ZDB-GENE-040426-2110])

HSP 1 Score: 354.755 bits (909), Expect = 5.572e-117
Identity = 196/437 (44.85%), Postives = 276/437 (63.16%), Query Frame = 1
Query:   91 LFKELHADDL-PDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFP--LTDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQT--RTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNY 1386
            +FK++ ADD      E+ESLCMNCH+NG T+L LTRIPFF+++++SSF C  C++ N  I   G IQ++G+ + L +  K DLNR +VK+ SA   IP LD   P      S +T+EG +   +  L   Q  RR A PE+A +I++FILKLK L ++  EF+L + DP+GNS +EN  AP  D  L V  + R+ +++  L I   D   D++   N VE        K+EVL+FN  CPECS+P    MK++DIPHFKEVI+MA+ C+SCG + NEVK G      G RITL +    D+ RD LKS+T  + IP+LE E   G+LGG+FTT+EG+L  + D +   NPF+ GDS T  R +     G  I  +  V   ++  + +I++DPAG SY+Q++Y PE+DP +TVE+Y R++E+NE LGLNDM T+ Y
Sbjct:   16 VFKDISADDENQQPTEIESLCMNCHQNGTTRLLLTRIPFFKEIIVSSFSCPACSWSNTEIQSAGQIQEQGICYTLRIRTKQDLNREVVKADSATTRIPELDFEIPPFTQKGSLSTVEGLLDRAVSGLEQEQPARRAAEPELAHKIEQFILKLKKLKDVEQEFTLVIEDPSGNSFVENPSAPHRDEALTVTRFNRTAQQDGQLGIRADDDDLDEEPAGNDVETM------KSEVLVFNTNCPECSAPASTNMKLVDIPHFKEVIIMATNCDSCGHRTNEVKSGGATEALGTRITLHVTDPSDMTRDLLKSETCCVLIPELEFELGMGALGGKFTTLEGLLKDIKDLIVVKNPFICGDSSTEDRLQKLTQFGEKIDQI--VAGEMK--IHVILDDPAGNSYLQNVYAPEEDPEMTVEKYTRTFEQNEDLGLNDMKTEGY 442          
BLAST of Zinc finger protein ZPR1 vs. Planmine SMEST
Match: SMESG000080868.1 (SMESG000080868.1)

HSP 1 Score: 874.389 bits (2258), Expect = 0.000e+0
Identity = 440/440 (100.00%), Postives = 440/440 (100.00%), Query Frame = 1
Query:   73 MSHTDILFKELHADDLPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVXXXXXXXXXXXMLGLNDMVTDNYIS 1392
            MSHTDILFKELHADDLPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVEEYERSYEENEMLGLNDMVTDNYIS
Sbjct:    1 MSHTDILFKELHADDLPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVISSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVFNIPHLDASFPLTDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDEFILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQEENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPIEGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIETVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLEETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSYIQDLYLPEQDPRLTVEEYERSYEENEMLGLNDMVTDNYIS 440          
The following BLAST results are available for this feature:
BLAST of Zinc finger protein ZPR1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ZPR13.771e-10843.48ZPR1 zinc finger [Source:HGNC Symbol;Acc:HGNC:1305... [more]
ZPR15.494e-10241.65ZPR1 zinc finger [Source:HGNC Symbol;Acc:HGNC:1305... [more]
ZPR17.067e-7641.06ZPR1 zinc finger [Source:HGNC Symbol;Acc:HGNC:1305... [more]
ZPR12.805e-1235.85ZPR1 zinc finger [Source:HGNC Symbol;Acc:HGNC:1305... [more]
back to top
BLAST of Zinc finger protein ZPR1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
W03F9.12.923e-9338.39Zinc finger protein ZPR1 homolog [Source:UniProtK... [more]
W03F9.11.431e-744.44Zinc finger protein ZPR1 homolog [Source:UniProtK... [more]
back to top
BLAST of Zinc finger protein ZPR1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Zpr12.939e-10543.02gene:FBgn0030096 transcript:FBtr0071342[more]
back to top
BLAST of Zinc finger protein ZPR1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zpr17.936e-11443.72ZPR1 zinc finger [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
zpr17.936e-11443.72ZPR1 zinc finger [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
zpr13.236e-3447.76ZPR1 zinc finger [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
zpr11.035e-3245.71ZPR1 zinc finger [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Zinc finger protein ZPR1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zpr15.086e-10742.06ZPR1 zinc finger [Source:NCBI gene;Acc:549888][more]
zpr11.969e-10441.39ZPR1 zinc finger [Source:NCBI gene;Acc:549888][more]
zpr11.808e-9039.20ZPR1 zinc finger [Source:NCBI gene;Acc:549888][more]
back to top
BLAST of Zinc finger protein ZPR1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Zpr18.809e-11044.52ZPR1 zinc finger [Source:MGI Symbol;Acc:MGI:133026... [more]
Zpr15.149e-7741.90ZPR1 zinc finger [Source:MGI Symbol;Acc:MGI:133026... [more]
back to top
BLAST of Zinc finger protein ZPR1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q62384|ZPR1_MOUSE6.162e-10944.52Zinc finger protein ZPR1 OS=Mus musculus OX=10090 ... [more]
sp|Q2TBX0|ZPR1_BOVIN5.084e-10843.91Zinc finger protein ZPR1 OS=Bos taurus OX=9913 GN=... [more]
sp|O75312|ZPR1_HUMAN1.811e-10743.48Zinc finger protein ZPR1 OS=Homo sapiens OX=9606 G... [more]
sp|A9CB27|ZPR1_PAPAN2.061e-10743.48Zinc finger protein ZPR1 OS=Papio anubis OX=9555 G... [more]
sp|O13724|ZPR1_SCHPO4.164e-10244.06Zinc finger protein zpr1 OS=Schizosaccharomyces po... [more]
back to top
BLAST of Zinc finger protein ZPR1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4P3Q45.684e-12846.83Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A1S8WLH78.421e-12747.49ZPR1 zinc finger domain protein OS=Opisthorchis vi... [more]
A0A4S2LIY33.200e-12546.91Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A2C9JPF35.279e-12445.66Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A4Z2DIC51.176e-12345.41Zinc finger protein isoform 3 OS=Schistosoma japon... [more]
back to top
BLAST of Zinc finger protein ZPR1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zpr16.891e-11543.91ZPR1 zinc finger [Source:NCBI gene;Acc:103043675][more]
back to top
BLAST of Zinc finger protein ZPR1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003989.13.669e-2253.85pep scaffold:Pmarinus_7.0:GL483043:285:1373:-1 gen... [more]
back to top
BLAST of Zinc finger protein ZPR1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ZPR11.158e-9139.59Essential protein with two zinc fingers; present i... [more]
back to top
BLAST of Zinc finger protein ZPR1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO406345.472e-11844.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283301.725e-2347.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger protein ZPR1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zpr15.572e-11744.85ZPR1 zinc finger [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Zinc finger protein ZPR1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000080868.10.000e+0100.00SMESG000080868.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029018 ID=SMED30029018|Name=Zinc finger protein ZPR1|organism=Schmidtea mediterranea sexual|type=transcript|length=1660bp
ATTATGAATTAAAAATGTATTTCTAAAAAGGAACTTATTTGTTTTAATAT
TCATTTATTTCTATTGACTTACATGTCTCATACTGATATTTTATTTAAAG
AATTACACGCAGATGATCTTCCAGATGTTATGGAAGTTGAGAGTCTTTGC
ATGAACTGCCATGAAAATGGAATTACCAAATTATTTTTAACCAGGATTCC
TTTTTTTCGTGATGTAGTTATTTCGTCATTTGAATGCAGTCATTGTAATT
TTAAAAATAATAATATTGACGATCGAGGAGTTATTCAGGATAAAGGTGTG
AAATTTTTTTTGAATGTCTGTAAGAAAAATGATTTAAACCGGCGAATGGT
AAAAAGCAAATCAGCAGTTTTTAATATCCCACATTTAGATGCATCATTTC
CTTTAACAGATATATCTTTTACAACAATTGAGGGAGCTATTAGCTCTATT
ATTGAAAATTTATCTTCACTTCAAGATGAACGTAGAAAAGCTACTCCGGA
AATAGCTATACAAATCGATGAATTTATTTTGAAGCTGAAAGATTTGATTG
AATTGAATACTGAATTCTCCTTGGAATTGATTGATCCAACTGGTAACAGC
ATTATTGAAAATTATATGGCTCCTAAATCTGATCCACAATTGCAAGTTGA
ACATTACAGAAGAAGTCAAGAAGAAAACGAAACACTTTGTATTAATGAAA
GTGATTTCCCTCAAGATGATGATCATCAAAAAAACTACGTCGAAGAAGCA
CAAGAAGAGTTCAATCCTAAAACAGAAGTACTCATTTTCAATTTGTTGTG
TCCGGAGTGCAGCTCGCCTATTGAAGGCAGAATGAAAGTATTGGATATTC
CACATTTCAAAGAAGTGATAGTGATGGCCAGCACATGTGAAAGTTGTGGA
TTTAAAGAAAATGAAGTCAAGGGCGGCTGTGGAATTGCCGAGAAAGGCCG
TAGGATAACATTGAGAATTGAAACGGTTGAAGATTTGAAGAGAGACTTTC
TAAAATCTGACACAGCGGCAATGAAAATTCCTGACTTGGAAGTCGAGACT
GAGTCTGGATCATTGGGAGGACGATTTACAACTGTGGAAGGAATTCTTCA
TCAGATGGCAGATAAGCTAGAAGAGACAAATCCATTTCTTAAAGGAGATA
GTCAAACAAGAACAGAAACAGAAATTATTCTTGGAAACCTTATCCAATCG
TTGCACGATGTCGGAAATGGGTTGAGAACCGGAGTGACATTAATTATCGA
AGATCCCGCTGGTGGAAGTTATATTCAGGACTTGTATTTGCCGGAGCAAG
ATCCGCGATTGACTGTCGAGGAGTATGAACGTTCCTATGAAGAAAATGAG
ATGCTTGGTTTGAACGATATGGTCACTGATAACTATATCAGTTAAATATA
ATTGAATTATTTATTTTTTGCTTGGTTTGTATGCTTATTGGTAATTGTTT
GGACATGGCGTATTTTAATTGAATAGTACGGAAATCCTGCTAACGCGTCT
CTATTAAACCTTGGCCTACTTTTTCATATTTCAACTTTAAGATACTATAT
TATGTTTCGATGTATGATTGTATAACGTTTCTTGTGGAGCAAAATAATTT
AGCCTTTGTGGTTATTACTACCTTGTATTAATGGTGAATGTATTGAACTT
TATTGATGGA
back to top

protein sequence of SMED30029018-orf-1

>SMED30029018-orf-1 ID=SMED30029018-orf-1|Name=SMED30029018-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=441bp
MSHTDILFKELHADDLPDVMEVESLCMNCHENGITKLFLTRIPFFRDVVI
SSFECSHCNFKNNNIDDRGVIQDKGVKFFLNVCKKNDLNRRMVKSKSAVF
NIPHLDASFPLTDISFTTIEGAISSIIENLSSLQDERRKATPEIAIQIDE
FILKLKDLIELNTEFSLELIDPTGNSIIENYMAPKSDPQLQVEHYRRSQE
ENETLCINESDFPQDDDHQKNYVEEAQEEFNPKTEVLIFNLLCPECSSPI
EGRMKVLDIPHFKEVIVMASTCESCGFKENEVKGGCGIAEKGRRITLRIE
TVEDLKRDFLKSDTAAMKIPDLEVETESGSLGGRFTTVEGILHQMADKLE
ETNPFLKGDSQTRTETEIILGNLIQSLHDVGNGLRTGVTLIIEDPAGGSY
IQDLYLPEQDPRLTVEEYERSYEENEMLGLNDMVTDNYIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR042452ZPR1_Znf1/2
IPR042451ZPR1_A/B_dom
IPR040141ZPR1
IPR004457Znf_ZPR1
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004457Zinc finger, ZPR1-typeSMARTSM00709zpr1coord: 24..180
e-value: 1.1E-49
score: 181.1
coord: 241..403
e-value: 2.0E-55
score: 200.1
IPR004457Zinc finger, ZPR1-typeTIGRFAMTIGR00310TIGR00310coord: 243..432
e-value: 7.3E-39
score: 131.0
coord: 26..210
e-value: 4.8E-27
score: 92.5
IPR004457Zinc finger, ZPR1-typePFAMPF03367zf-ZPR1coord: 24..179
e-value: 1.8E-44
score: 151.4
coord: 242..402
e-value: 6.4E-48
score: 162.6
IPR042452ZPR1, zinc finger domainGENE3DG3DSA:2.20.25.420coord: 13..69
e-value: 2.4E-22
score: 79.9
IPR042452ZPR1, zinc finger domainGENE3DG3DSA:2.20.25.420coord: 235..285
e-value: 2.4E-21
score: 76.8
IPR042451ZPR1, A/B domainGENE3DG3DSA:2.60.120.1040coord: 287..430
e-value: 2.8E-43
score: 149.2
coord: 70..207
e-value: 1.4E-37
score: 130.6
IPR040141ZPR1 familyPANTHERPTHR10876ZINC FINGER PROTEIN ZPR1coord: 7..438
NoneNo IPR availablePANTHERPTHR10876:SF0ZINC FINGER PROTEIN ZPR1coord: 7..438