P2X purinoceptor

Overview
NameP2X purinoceptor
Smed IDSMED30029013
Length (bp)967
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of P2X purinoceptor (SMED30029013) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for P2X purinoceptor (SMED30029013) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of P2X purinoceptor vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 206.068 bits (523), Expect = 1.335e-63
Identity = 107/313 (34.19%), Postives = 173/313 (55.27%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAK--CKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKF--GNYSRGWNFRYANY 967
            L + + EY+T ++ +I++ K+  + R +Q +IL YV  +   +++GYQ++  + SS+  K+KG  + +   +   IWDVAD V+P QEE +LF+ TNVI T NQTQG CPE                 +P+A   CK D+ C   +A    NG+ TG+C      +KTCE+  WCP+E+++    +   +K   N+T+L+KN I + + N  K N+           CI++ K     +CPIF++  ++        +++ + GGI+ I + W+CNLD +   C P Y+F RL T+    N S G+NFR+A Y
Sbjct:    8 LAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPE-----------------IPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVP-QPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGHS-FQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKY 299          
BLAST of P2X purinoceptor vs. Ensembl Human
Match: P2RX5 (purinergic receptor P2X 5 [Source:HGNC Symbol;Acc:HGNC:8536])

HSP 1 Score: 207.994 bits (528), Expect = 2.204e-63
Identity = 111/308 (36.04%), Postives = 167/308 (54.22%), Query Frame = 2
Query:   53 VLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQD-SYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIK-TCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFG-NYSRGWNFRYANY 967
            + +Y+T K  + +N K+  ++R LQ  IL Y+ ++    K+GYQD    L S+++ K+KG    +  ++ + IWDVAD V+P Q E   F+ TN+I T NQ Q  C E                 +P+  C +DSDC    A+  GNG+ TG+C       + TCEI  WCPLE +S     EP +K+  ++T+ IKN I F + N  KSN+    +      C F  K+    YCPIF++ S+I   +  D +++ + GG++ I I WNC+LD +   C P Y+F RL  K   + S G+NFR+A Y
Sbjct:   13 LFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAE--------------NEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSR--PEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKN---HYCPIFRLGSVI-RWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARY 300          
BLAST of P2X purinoceptor vs. Ensembl Human
Match: P2RX5-TAX1BP3 (P2RX5-TAX1BP3 readthrough (NMD candidate) [Source:HGNC Symbol;Acc:HGNC:49191])

HSP 1 Score: 207.608 bits (527), Expect = 3.649e-63
Identity = 111/308 (36.04%), Postives = 167/308 (54.22%), Query Frame = 2
Query:   53 VLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQD-SYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIK-TCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFG-NYSRGWNFRYANY 967
            + +Y+T K  + +N K+  ++R LQ  IL Y+ ++    K+GYQD    L S+++ K+KG    +  ++ + IWDVAD V+P Q E   F+ TN+I T NQ Q  C E                 +P+  C +DSDC    A+  GNG+ TG+C       + TCEI  WCPLE +S     EP +K+  ++T+ IKN I F + N  KSN+    +      C F  K+    YCPIF++ S+I   +  D +++ + GG++ I I WNC+LD +   C P Y+F RL  K   + S G+NFR+A Y
Sbjct:   13 LFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAE--------------NEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSR--PEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKN---HYCPIFRLGSVI-RWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARY 300          
BLAST of P2X purinoceptor vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 206.068 bits (523), Expect = 5.344e-63
Identity = 107/313 (34.19%), Postives = 173/313 (55.27%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAK--CKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKF--GNYSRGWNFRYANY 967
            L + + EY+T ++ +I++ K+  + R +Q +IL YV  +   +++GYQ++  + SS+  K+KG  + +   +   IWDVAD V+P QEE +LF+ TNVI T NQTQG CPE                 +P+A   CK D+ C   +A    NG+ TG+C      +KTCE+  WCP+E+++    +   +K   N+T+L+KN I + + N  K N+           CI++ K     +CPIF++  ++        +++ + GGI+ I + W+CNLD +   C P Y+F RL T+    N S G+NFR+A Y
Sbjct:    8 LAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPE-----------------IPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVP-QPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGHS-FQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKY 299          
BLAST of P2X purinoceptor vs. Ensembl Human
Match: P2RX5 (purinergic receptor P2X 5 [Source:HGNC Symbol;Acc:HGNC:8536])

HSP 1 Score: 200.29 bits (508), Expect = 2.239e-60
Identity = 109/308 (35.39%), Postives = 167/308 (54.22%), Query Frame = 2
Query:   53 VLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQD-SYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIK-TCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFG-NYSRGWNFRYANY 967
            + +Y+T K  + +N K+  ++R LQ  IL Y+ ++    K+GYQD    L S+++ K+KG    +  ++ + IWDVAD V+P Q E   F+ TN+I T NQ Q  C E                 +P+  C +DSDC    A+  GNG+ TG+C       + TCEI  WCPLE +S     EP +K+  ++T+ IKN I F + N   + +     + + S C F  K+    YCPIF++ S+I   +  D +++ + GG++ I I WNC+LD +   C P Y+F RL  K   + S G+NFR+A Y
Sbjct:   13 LFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAE--------------NEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSR--PEEPFLKEAEDFTIFIKNHIRFPKFNFSNNVMDVKDRSFLKS-CHFGPKN---HYCPIFRLGSVI-RWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARY 299          
BLAST of P2X purinoceptor vs. Ensembl Zebrafish
Match: p2rx4b (purinergic receptor P2X, ligand-gated ion channel, 4b [Source:ZFIN;Acc:ZDB-GENE-030319-4])

HSP 1 Score: 210.69 bits (535), Expect = 5.244e-65
Identity = 111/307 (36.16%), Postives = 173/307 (56.35%), Query Frame = 2
Query:   53 VLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTK--FGNYSRGWNFRYANY 967
            + ++ T  + V+ + K+ ++FR LQ  I++YV +Y  WYKR YQ+   + SS+  K+KG  L +   +   +WD ++ V+PPQ E + F+ TN I T  QTQG CPE+              PS     C+ DSDC++      GNG+ TGKC   ++ IKTCE+ +WCPLEN+++   +  L+    ++TVLIKN I + +   +K N+     +     C FN  HK   +CP+F++  ++   S +D   + + GGI+ I I W+C+LD +   C P+Y+F RL  K    N + G+NFRYA Y
Sbjct:   11 LFDHGTPVILVVSSKKVGFIFRLLQLCIIVYVAVYVCWYKRAYQERDSVISSVSTKVKGNILTNSSALGTHVWDTSEYVIPPQGENSFFVLTNAIVTQGQTQGSCPEI--------------PS-EFTNCQSDSDCKEGLKEIRGNGVQTGKCVQYSETIKTCEVLSWCPLENDTVIP-KPALLSAAEDFTVLIKNNIQYPKFKFRKRNILRHINSTYLKNCTFN--HKTDPHCPVFRLGDIVTE-SGEDFSIMALKGGIIGIFIDWSCDLDFNERFCVPKYSFRRLDNKNPENNVAPGYNFRYAKY 298          
BLAST of P2X purinoceptor vs. Ensembl Zebrafish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 202.986 bits (515), Expect = 4.461e-62
Identity = 107/306 (34.97%), Postives = 171/306 (55.88%), Query Frame = 2
Query:   56 LEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTK--FGNYSRGWNFRYANY 967
             +Y T+K+ +I++ K+  + R  Q +++ YV  Y   Y +GYQD+  + SS+  K+KG  L +   +   IWDVAD ++PPQE+ + F+ TN+I T NQTQ KC E               P+ P + C    DC++      G+G+ TG+C   +  +KTCE+ +WCPLE   +     PL+    N+TVLIKN I + + N  K N+     +   + C+F+   K    CPIF++  ++G  +E+D + + ++GG++ + I W+C+LD+    C P YTF RL  K    N + G+NFR+A Y
Sbjct:   16 FDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAE--------------NPT-PASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLE-KIVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFS--RKTDPDCPIFRLGDIVGE-AEEDFQIMAVHGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKY 302          
BLAST of P2X purinoceptor vs. Ensembl Zebrafish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 195.667 bits (496), Expect = 3.966e-59
Identity = 107/315 (33.97%), Postives = 171/315 (54.29%), Query Frame = 2
Query:   56 LEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQ---------EETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTK--FGNYSRGWNFRYANY 967
             +Y T+K+ +I++ K+  + R  Q +++ YV  Y   Y +GYQD+  + SS+  K+KG  L +   +   IWDVAD ++PPQ         E+ + F+ TN+I T NQTQ KC E               P+ P + C    DC++      G+G+ TG+C   +  +KTCE+ +WCPLE   +     PL+    N+TVLIKN I + + N  K N+     +   + C+F+   K    CPIF++  ++G  +E+D + + ++GG++ + I W+C+LD+    C P YTF RL  K    N + G+NFR+A Y
Sbjct:   16 FDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQVVRRLDEEEEDGSFFVLTNMIITTNQTQSKCAE--------------NPT-PASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLE-KIVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFS--RKTDPDCPIFRLGDIVGE-AEEDFQIMAVHGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKY 311          
BLAST of P2X purinoceptor vs. Ensembl Zebrafish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 195.667 bits (496), Expect = 4.366e-59
Identity = 107/315 (33.97%), Postives = 171/315 (54.29%), Query Frame = 2
Query:   56 LEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQ---------EETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTK--FGNYSRGWNFRYANY 967
             +Y T+K+ +I++ K+  + R  Q +++ YV  Y   Y +GYQD+  + SS+  K+KG  L +   +   IWDVAD ++PPQ         E+ + F+ TN+I T NQTQ KC E               P+ P + C    DC++      G+G+ TG+C   +  +KTCE+ +WCPLE   +     PL+    N+TVLIKN I + + N  K N+     +   + C+F+   K    CPIF++  ++G  +E+D + + ++GG++ + I W+C+LD+    C P YTF RL  K    N + G+NFR+A Y
Sbjct:   16 FDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQVVRRLDEEEEDGSFFVLTNMIITTNQTQSKCAE--------------NPT-PASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLE-KIVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFS--RKTDPDCPIFRLGDIVGE-AEEDFQIMAVHGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKY 311          
BLAST of P2X purinoceptor vs. Ensembl Zebrafish
Match: p2rx1 (purinergic receptor P2X, ligand-gated ion channel, 1 [Source:ZFIN;Acc:ZDB-GENE-030319-1])

HSP 1 Score: 185.267 bits (469), Expect = 4.035e-55
Identity = 112/326 (34.36%), Postives = 168/326 (51.53%), Query Frame = 2
Query:    5 QMKKKSFKYFRNLKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGN-----YSRGWNFRYANY 967
            +MK    K F N      EYET +  +++N ++  V R +Q  +L Y+  +   Y++GYQ       S+  K+KG    +     R IWDVAD V P Q +++  + TN I T  Q QGKCPE  + + KN             KC  DSDC  +     GNG MTG+C     + +TCEI +WCP+E++       P++    NYT+ IKN+I F + +V +SNL    +    + C+++ K   L  CPIF++  ++   S     E+   GG + ++I W+CNLDLS   C+P+Y F  L+    N      S G+NFR+A Y
Sbjct:    3 RMKSAIKKTFSNF---FFEYETPREVLVKNRRVAIVCRIIQLGVLAYIIGWVFMYEKGYQTVDNAIGSVFTKMKGVSFTNISGQER-IWDVADYVFPEQGDSSFVVMTNFIPTIGQVQGKCPE--LPDGKN-------------KCTNDSDCDDSKYKRTGNGHMTGRC---MNKTQTCEIYSWCPVEDDRKIP-DPPILLTAENYTLFIKNSITFPQFDVVRSNLVEGIDQNYINNCVYHPKTAPL--CPIFRLGDIV-ERSGFSFSEIARVGGAIGVLIDWDCNLDLSIRFCKPKYEFYGLYGTGKNDQVDKASLGYNFRFAKY 302          
BLAST of P2X purinoceptor vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 199.904 bits (507), Expect = 1.290e-60
Identity = 110/310 (35.48%), Postives = 163/310 (52.58%), Query Frame = 2
Query:   56 LEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDS-YGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKC--TPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFN-DKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFG--NYSRGWNFRYANY 967
             +Y+T K  + +N K+  +FR +Q  IL Y+  +    K+GYQ++   + SSI+ KLKG    +   +   +WDV D V+PPQ E   F+ TN+I T NQ Q  CPE +               +P+A+C ++SDC +   +  GNG+ TG+C  T       TCEI  WCP+E         PL+ K  N+TV IKN+I F + +  K+N+           C ++ D H    YCPIF +  ++   +  + + + I GG++ I I WNCNLD     C P Y+F RL  KF   + S G+NFR+A Y
Sbjct:   14 FDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESF--------------GIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKPK--TPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH----YCPIFHLGKIV-SWAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKY 302          
BLAST of P2X purinoceptor vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 199.904 bits (507), Expect = 1.811e-60
Identity = 110/310 (35.48%), Postives = 163/310 (52.58%), Query Frame = 2
Query:   56 LEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDS-YGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKC--TPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFN-DKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFG--NYSRGWNFRYANY 967
             +Y+T K  + +N K+  +FR +Q  IL Y+  +    K+GYQ++   + SSI+ KLKG    +   +   +WDV D V+PPQ E   F+ TN+I T NQ Q  CPE +               +P+A+C ++SDC +   +  GNG+ TG+C  T       TCEI  WCP+E         PL+ K  N+TV IKN+I F + +  K+N+           C ++ D H    YCPIF +  ++   +  + + + I GG++ I I WNCNLD     C P Y+F RL  KF   + S G+NFR+A Y
Sbjct:   14 FDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESF--------------GIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKPK--TPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH----YCPIFHLGKIV-SWAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKY 302          
BLAST of P2X purinoceptor vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 199.519 bits (506), Expect = 2.477e-60
Identity = 110/310 (35.48%), Postives = 163/310 (52.58%), Query Frame = 2
Query:   56 LEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDS-YGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKC--TPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFN-DKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFG--NYSRGWNFRYANY 967
             +Y+T K  + +N K+  +FR +Q  IL Y+  +    K+GYQ++   + SSI+ KLKG    +   +   +WDV D V+PPQ E   F+ TN+I T NQ Q  CPE +               +P+A+C ++SDC +   +  GNG+ TG+C  T       TCEI  WCP+E         PL+ K  N+TV IKN+I F + +  K+N+           C ++ D H    YCPIF +  ++   +  + + + I GG++ I I WNCNLD     C P Y+F RL  KF   + S G+NFR+A Y
Sbjct:   14 FDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESF--------------GIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKPK--TPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH----YCPIFHLGKIVS-WAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKY 302          
BLAST of P2X purinoceptor vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 199.134 bits (505), Expect = 2.530e-60
Identity = 110/310 (35.48%), Postives = 163/310 (52.58%), Query Frame = 2
Query:   56 LEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDS-YGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKC--TPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFN-DKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFG--NYSRGWNFRYANY 967
             +Y+T K  + +N K+  +FR +Q  IL Y+  +    K+GYQ++   + SSI+ KLKG    +   +   +WDV D V+PPQ E   F+ TN+I T NQ Q  CPE +               +P+A+C ++SDC +   +  GNG+ TG+C  T       TCEI  WCP+E         PL+ K  N+TV IKN+I F + +  K+N+           C ++ D H    YCPIF +  ++   +  + + + I GG++ I I WNCNLD     C P Y+F RL  KF   + S G+NFR+A Y
Sbjct:   14 FDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESF--------------GIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKPK--TPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH----YCPIFHLGKIV-SWAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKY 302          
BLAST of P2X purinoceptor vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 198.749 bits (504), Expect = 3.658e-60
Identity = 110/310 (35.48%), Postives = 163/310 (52.58%), Query Frame = 2
Query:   56 LEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDS-YGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKC--TPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFN-DKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFG--NYSRGWNFRYANY 967
             +Y+T K  + +N K+  +FR +Q  IL Y+  +    K+GYQ++   + SSI+ KLKG    +   +   +WDV D V+PPQ E   F+ TN+I T NQ Q  CPE +               +P+A+C ++SDC +   +  GNG+ TG+C  T       TCEI  WCP+E         PL+ K  N+TV IKN+I F + +  K+N+           C ++ D H    YCPIF +  ++   +  + + + I GG++ I I WNCNLD     C P Y+F RL  KF   + S G+NFR+A Y
Sbjct:   14 FDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESF--------------GIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKPK--TPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH----YCPIFHLGKIV-SWAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKY 302          
BLAST of P2X purinoceptor vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 208.379 bits (529), Expect = 2.125e-64
Identity = 110/311 (35.37%), Postives = 173/311 (55.63%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKF--GNYSRGWNFRYANY 967
            L++ + EY+T ++ +I++ K+  + R +Q +IL YV  +   +++GYQ++  + SS+  K KG  + +   +   IWDVAD VVP QEE +LFI TN+I T NQTQG CPE+             K S+    C  D++C   ++    +GI TG+C P    +KTCE+  WCP+EN++        +K   N+T+L+KN I + + N  K N+           CI+N +     +CPIF++  ++        +E+ + GGI+ I I W+CNLD +   C P Y+F RL T+    N S G+NFR+A Y
Sbjct:    8 LRAFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEI-----------PDKTSI----CDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVP-TPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTD--PFCPIFRLGQIVADAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKY 299          
BLAST of P2X purinoceptor vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 208.379 bits (529), Expect = 3.784e-64
Identity = 110/311 (35.37%), Postives = 173/311 (55.63%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKF--GNYSRGWNFRYANY 967
            L++ + EY+T ++ +I++ K+  + R +Q +IL YV  +   +++GYQ++  + SS+  K KG  + +   +   IWDVAD VVP QEE +LFI TN+I T NQTQG CPE+             K S+    C  D++C   ++    +GI TG+C P    +KTCE+  WCP+EN++        +K   N+T+L+KN I + + N  K N+           CI+N +     +CPIF++  ++        +E+ + GGI+ I I W+CNLD +   C P Y+F RL T+    N S G+NFR+A Y
Sbjct:    8 LRAFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEI-----------PDKTSI----CDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVP-TPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTD--PFCPIFRLGQIVADAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKY 299          
BLAST of P2X purinoceptor vs. Ensembl Mouse
Match: P2rx1 (purinergic receptor P2X, ligand-gated ion channel, 1 [Source:MGI Symbol;Acc:MGI:1098235])

HSP 1 Score: 192.971 bits (489), Expect = 4.887e-58
Identity = 104/310 (33.55%), Postives = 158/310 (50.97%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLK-YCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGNYSRGWNFRYANY 967
            L +   EY+T +M +++N K+  +FR +Q ++L+YV  +   Y++GYQ S GL SS+ +KLKG  +   Q +   +WDVAD V P   +++  + TN I T  Q QG C E                +     C+ DS C    A     GI TG C P    +KTCEI  WCP+E +        L+ +  N+T+ IKN+I F    V + NL          +C++   HK+L   CP+F +  ++   S +D + L   GG++ I I W C+LD     C+P Y F  L+ +  N S G+NFR+A +
Sbjct:    9 LSAFFFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFVYEKGYQTSSGLISSVSVKLKGLAVTQLQGLGPQVWDVADYVFPAHGDSSFVVMTNFIMTPQQAQGHCAE----------------NPEGGICQDDSGCTPGKAERKAQGIRTGNCVPFNGTVKTCEIFGWCPVEVDDKIP-SPALLHEAENFTLFIKNSISFPRFKVNRRNLVEEVNGTYMKKCLY---HKILHPLCPVFSLGYVVRE-SGQDFRSLAEKGGVVGITIDWECDLDWHVRHCKPIYQFHGLYGE-KNLSPGFNFRFARH 296          
BLAST of P2X purinoceptor vs. Ensembl Mouse
Match: P2rx6 (purinergic receptor P2X, ligand-gated ion channel, 6 [Source:MGI Symbol;Acc:MGI:1337113])

HSP 1 Score: 191.43 bits (485), Expect = 1.478e-57
Identity = 102/305 (33.44%), Postives = 163/305 (53.44%), Query Frame = 2
Query:   56 LEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQD-SYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGNYSRGWNFRYANY 967
            L+Y+T K  + +N ++    R LQ  +++YV  ++L  K+GYQ+      +S++ KLKG  +   + +   +WDVAD V P Q E   F+ TN + T  Q QG+CPE               PSVP A C  D DC +       +GI TG+C       +TCEI +WCP+E+ ++   R+PL+ +  N+T+ IKNT+ F + N  +SN     +N     C+++       YCP+F++  L+  ++  D ++L + GG + I I W+CNLD     C P+Y+F+          +G+NFR AN+
Sbjct:   25 LDYKTEKYVLTRNCRVGVSQRLLQLAVVVYVIGWALLAKKGYQERDLAPQTSVITKLKGVSVTQVKELENRLWDVADFVKPSQGENVFFLVTNFLVTPAQVQGRCPE--------------HPSVPLANCWADEDCPEGETGTYSHGIKTGQCVVFNGTHRTCEIWSWCPVESGAV--PRKPLLAQAKNFTLFIKNTVTFSKFNFSRSNALLTWDNTYFKHCLYDPLSS--PYCPVFRIGDLVA-MAGGDFEDLALLGGAVGISIHWDCNLDTKGSDCCPQYSFQL-------QQKGYNFRTANH 303          
BLAST of P2X purinoceptor vs. Ensembl Mouse
Match: P2rx2 (purinergic receptor P2X, ligand-gated ion channel, 2 [Source:MGI Symbol;Acc:MGI:2665170])

HSP 1 Score: 188.734 bits (478), Expect = 3.051e-56
Identity = 110/313 (35.14%), Postives = 166/313 (53.04%), Query Frame = 2
Query:   35 RNLKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDS-YGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPV-TKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGNYSRGWNFRYANY 967
            R   S   +YET K+ V++N ++ +V R +Q +ILLY   Y    ++ YQDS  G  SSI+ K+KG  +++ +     +WDV + V PP+  + + I T +  T +QT G CPE   V +              + C  D DC        GNGI TG+C P    + KTCE+  WCP+E+ +  S    L K   N+T+LIKN+I + +    K N+ +   + +   C F+       YCPIF++  ++    E +  EL   GG++ +II WNC+LDLS   C P+Y+F RL  K+   S G+NFR+A Y
Sbjct:   20 RGCWSAFWDYETPKVIVVRNRRLGFVHRMVQLLILLYFVWYVFIVQKSYQDSETGPESSIITKVKGITMSEHK-----VWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHS--------------STCHLDDDCVAGQLDMQGNGIRTGRCVPYYHGDSKTCEVSAWCPVEDGT--SENHFLGKMAPNFTILIKNSIHYPKFKFSKGNIASQKSDYL-KHCTFDQDSD--PYCPIFRLGFIVEQAGE-NFTELAHKGGVIGVIINWNCDLDLSESECNPKYSFRRLDPKYDPASSGYNFRFAKY 307          
BLAST of P2X purinoceptor vs. UniProt/SwissProt
Match: sp|Q9JJX6|P2RX4_MOUSE (P2X purinoceptor 4 OS=Mus musculus OX=10090 GN=P2rx4 PE=1 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 2.884e-63
Identity = 111/311 (35.69%), Postives = 172/311 (55.31%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKF--GNYSRGWNFRYANY 967
            L S + EY+T ++ +I++ K+  + R +Q +IL YV  +   +++GYQ++  + SS+  K KG  + +   +   IWDVAD VVP QEE +LFI TN+I T NQTQG CPE+             K S+    C  D++C   ++    +GI TG+C P    +KTCE+  WCP+EN++        +K   N+T+L+KN I + + N  K N+           CI+N +     +CPIF++  ++        +E+ + GGI+ I I W+CNLD +   C P Y+F RL T+    N S G+NFR+A Y
Sbjct:    8 LGSFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEI-----------PDKTSI----CDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVP-TPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTD--PFCPIFRLGQIVADAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKY 299          
BLAST of P2X purinoceptor vs. UniProt/SwissProt
Match: sp|Q93086|P2RX5_HUMAN (P2X purinoceptor 5 OS=Homo sapiens OX=9606 GN=P2RX5 PE=2 SV=4)

HSP 1 Score: 207.994 bits (528), Expect = 1.059e-62
Identity = 111/308 (36.04%), Postives = 167/308 (54.22%), Query Frame = 2
Query:   53 VLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQD-SYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIK-TCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFG-NYSRGWNFRYANY 967
            + +Y+T K  + +N K+  ++R LQ  IL Y+ ++    K+GYQD    L S+++ K+KG    +  ++ + IWDVAD V+P Q E   F+ TN+I T NQ Q  C E                 +P+  C +DSDC    A+  GNG+ TG+C       + TCEI  WCPLE +S     EP +K+  ++T+ IKN I F + N  KSN+    +      C F  K+    YCPIF++ S+I   +  D +++ + GG++ I I WNC+LD +   C P Y+F RL  K   + S G+NFR+A Y
Sbjct:   13 LFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAE--------------NEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSR--PEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKN---HYCPIFRLGSVI-RWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARY 300          
BLAST of P2X purinoceptor vs. UniProt/SwissProt
Match: sp|Q99571|P2RX4_HUMAN (P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX4 PE=1 SV=2)

HSP 1 Score: 206.068 bits (523), Expect = 2.566e-62
Identity = 107/313 (34.19%), Postives = 173/313 (55.27%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAK--CKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKF--GNYSRGWNFRYANY 967
            L + + EY+T ++ +I++ K+  + R +Q +IL YV  +   +++GYQ++  + SS+  K+KG  + +   +   IWDVAD V+P QEE +LF+ TNVI T NQTQG CPE                 +P+A   CK D+ C   +A    NG+ TG+C      +KTCE+  WCP+E+++    +   +K   N+T+L+KN I + + N  K N+           CI++ K     +CPIF++  ++        +++ + GGI+ I + W+CNLD +   C P Y+F RL T+    N S G+NFR+A Y
Sbjct:    8 LAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPE-----------------IPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVP-QPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGHS-FQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKY 299          
BLAST of P2X purinoceptor vs. UniProt/SwissProt
Match: sp|P51577|P2RX4_RAT (P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2rx4 PE=1 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 7.490e-62
Identity = 109/311 (35.05%), Postives = 171/311 (54.98%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKF--GNYSRGWNFRYANY 967
            L S + EY+T ++ +I++ K+  + R +Q +IL YV  +   +++GYQ++  + SS+  K KG  + +   +   IWDVAD V+P QEE +LFI TN+I T NQTQ  CPE+             K S+    C  D+DC   +     +G+ TG+C P  + +KTCE+  WCP+EN+         +K   N+T+L+KN I + + N  K N+           CI+N +     +CPIF++ +++        +E+ + GGI+ I I W+CNLD +   C P Y+F RL T+    N S G+NFR+A Y
Sbjct:    8 LGSFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVIPAQEENSLFIMTNMIVTVNQTQSTCPEI-----------PDKTSI----CNSDADCTPGSVDTHSSGVATGRCVPFNESVKTCEVAAWCPVENDVGVP-TPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNAQTD--PFCPIFRLGTIVEDAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASLCLPRYSFRRLDTRDLEHNVSPGYNFRFAKY 299          
BLAST of P2X purinoceptor vs. UniProt/SwissProt
Match: sp|Q5E9U1|P2RX4_BOVIN (P2X purinoceptor 4 OS=Bos taurus OX=9913 GN=P2RX4 PE=2 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 1.076e-60
Identity = 107/311 (34.41%), Postives = 176/311 (56.59%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTK--FGNYSRGWNFRYANY 967
            L + + EY+T ++ +I++ K+  + RT+Q +IL YV  +   +++GYQ++  + SS+ +K KG  + +   +   IWDVAD V+P QEE ++FI TN++ T NQTQG CPE+             K +V    C+ D++C   +A    +G+ TG+C      +KTCE+  WCP+E+++    +   +K   N+T+L+KN I + + N  K N+           CI++ K     +CPIF++  ++   +    +++ I GGI+ I I WNCNLD +   C P Y+F RL T+    N S G+NFR+A Y
Sbjct:    8 LGAFLFEYDTPRIVLIRSRKVGLMNRTVQLLILAYVIGWVFVWEKGYQETDSVVSSVTVKAKGVTMTNTSKLGFRIWDVADYVIPAQEENSVFIMTNMVITMNQTQGLCPEI-----------PGKTTV----CETDANCTAGSAGTHSSGVATGRCVSFNGTLKTCEVAAWCPVEDDTEVP-KPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTAYLKTCIYDAKTD--PFCPIFRLGKIVES-AGHSFQDIAIEGGIMGIQIKWNCNLDRAASFCLPRYSFRRLDTRDLAHNVSPGYNFRFAKY 299          
BLAST of P2X purinoceptor vs. TrEMBL
Match: A0A4W3HBT2 (P2X purinoceptor OS=Callorhinchus milii OX=7868 GN=p2rx4 PE=3 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.261e-64
Identity = 113/308 (36.69%), Postives = 175/308 (56.82%), Query Frame = 2
Query:   50 LVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGN--YSRGWNFRYANY 967
             +LEY+T ++ +I+N K+  + R +Q +IL Y+  + L +++GYQD   + SS+++K+KG    +       +WD AD ++PP++E++ F+ TN+I T NQTQG CPE+     KN              C  DS+C         +G++TGKC    + +KTCE+  WCPLE+ ++F     L+    N+TVLIKN I F + N  K N+           C+FN   +   YCPIF++  ++    +K  +EL + GG++ I+I WNCNLD S   C P+YTF+RL  +  +   S G+NFRYA Y
Sbjct:   13 FILEYDTPRIVLIKNKKVGLINRLVQLVILSYIIGWVLIWRKGYQDFDSIVSSVIIKVKGVAFVNSSGFGERLWDSADYIIPPEQESSFFVMTNLIRTENQTQGHCPEL----PKNGF-----------NCTSDSNCTAGLIDPHSSGVLTGKCVTFNEGVKTCEVLAWCPLESQTVFP-NPALLGGAENFTVLIKNNIRFPQFNFSKRNILPNISASYLKTCVFNRTKE--PYCPIFRLGDIVRETGDK-FQELALQGGVIGILIKWNCNLDRSASECVPQYTFQRLDNRNVDETVSPGYNFRYAKY 301          
BLAST of P2X purinoceptor vs. TrEMBL
Match: A0A4W3HW34 (P2X purinoceptor OS=Callorhinchus milii OX=7868 GN=p2rx4 PE=3 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.437e-64
Identity = 113/308 (36.69%), Postives = 175/308 (56.82%), Query Frame = 2
Query:   50 LVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGN--YSRGWNFRYANY 967
             +LEY+T ++ +I+N K+  + R +Q +IL Y+  + L +++GYQD   + SS+++K+KG    +       +WD AD ++PP++E++ F+ TN+I T NQTQG CPE+     KN              C  DS+C         +G++TGKC    + +KTCE+  WCPLE+ ++F     L+    N+TVLIKN I F + N  K N+           C+FN   +   YCPIF++  ++    +K  +EL + GG++ I+I WNCNLD S   C P+YTF+RL  +  +   S G+NFRYA Y
Sbjct:   13 FILEYDTPRIVLIKNKKVGLINRLVQLVILSYIIGWVLIWRKGYQDFDSIVSSVIIKVKGVAFVNSSGFGERLWDSADYIIPPEQESSFFVMTNLIRTENQTQGHCPEL----PKNGF-----------NCTSDSNCTAGLIDPHSSGVLTGKCVTFNEGVKTCEVLAWCPLESQTVFP-NPALLGGAENFTVLIKNNIRFPQFNFSKRNILPNISASYLKTCVFNRTKE--PYCPIFRLGDIVRETGDK-FQELALQGGVIGILIKWNCNLDRSASECVPQYTFQRLDNRNVDETVSPGYNFRYAKY 301          
BLAST of P2X purinoceptor vs. TrEMBL
Match: A0A4W3H8T7 (P2X purinoceptor OS=Callorhinchus milii OX=7868 GN=p2rx4 PE=3 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.571e-64
Identity = 113/309 (36.57%), Postives = 175/309 (56.63%), Query Frame = 2
Query:   47 SLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGN--YSRGWNFRYANY 967
              +LEY+T ++ +I+N K+  + R +Q +IL Y+  + L +++GYQD   + SS+++K+KG    +       +WD AD ++PP++E++ F+ TN+I T NQTQG CPE+     KN              C  DS+C         +G++TGKC    + +KTCE+  WCPLE+ ++F     L+    N+TVLIKN I F + N  K N+           C+FN   +   YCPIF++  ++    +K  +EL + GG++ I+I WNCNLD S   C P+YTF+RL  +  +   S G+NFRYA Y
Sbjct:   12 DFILEYDTPRIVLIKNKKVGLINRLVQLVILSYIIGWVLIWRKGYQDFDSIVSSVIIKVKGVAFVNSSGFGERLWDSADYIIPPEQESSFFVMTNLIRTENQTQGHCPEL----PKNGF-----------NCTSDSNCTAGLIDPHSSGVLTGKCVTFNEGVKTCEVLAWCPLESQTVFP-NPALLGGAENFTVLIKNNIRFPQFNFSKRNILPNISASYLKTCVFNRTKE--PYCPIFRLGDIVRETGDK-FQELALQGGVIGILIKWNCNLDRSASECVPQYTFQRLDNRNVDETVSPGYNFRYAKY 301          
BLAST of P2X purinoceptor vs. TrEMBL
Match: R7VDE3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_169132 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.756e-64
Identity = 114/314 (36.31%), Postives = 173/314 (55.10%), Query Frame = 2
Query:   47 SLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQ-------NVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGNYSRGWNFRYANY 967
             +  EY+T K+  I++ K+  + R +Q +IL Y+  Y++ Y++GYQD   + S+  +K+KG    D +        V   IWD AD VVPPQE  A F+TTNV+ T  Q QG C E               P++P+  C    DC    ++  GNG+ TG+CT   + +KTCEI  WCP+EN+++    + L++    +TVLIKN I F +  VQ+ N+    +      C +N K +  + CPIF++  ++    +    ++ + GG+  I I W C+LD S DRC P+YTF RL  +    ++GWNFRYANY
Sbjct:   17 GVFFEYDTPKIVHIRSKKVGVINRLIQIVILTYIIGYAIVYQKGYQDFENVESAATIKVKGVLYPDSKKLNVSIPGVTDRIWDAADYVVPPQENDAFFVTTNVVFT-RQEQGSCSE--------------DPTMPDVICNSTKDCPAGESVVNGNGVRTGQCTNFNETLKTCEIYAWCPVENDTLPLKDKALLEDSKKFTVLIKNNIEFPKFKVQRRNILDDQDPEYLQSCRYNSKSETDRLCPIFELGVIVSEAGQH-YSKVAVKGGVFAININWKCDLDHSIDRCLPQYTFSRLDREEAKIAKGWNFRYANY 314          
BLAST of P2X purinoceptor vs. TrEMBL
Match: V9KH44 (P2X purinoceptor OS=Callorhinchus milii OX=7868 GN=p2rx4 PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.858e-64
Identity = 113/309 (36.57%), Postives = 175/309 (56.63%), Query Frame = 2
Query:   47 SLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGN--YSRGWNFRYANY 967
              +LEY+T ++ +I+N K+  + R +Q +IL Y+  + L +++GYQD   + SS+++K+KG    +       +WD AD ++PP++E++ F+ TN+I T NQTQG CPE+     KN              C  DS+C         +G++TGKC    + +KTCE+  WCPLE+ ++F     L+    N+TVLIKN I F + N  K N+           C+FN   +   YCPIF++  ++    +K  +EL + GG++ I+I WNCNLD S   C P+YTF+RL  +  +   S G+NFRYA Y
Sbjct:   12 DFILEYDTPRIVLIKNKKVGLINRLVQLVILSYIIGWVLIWRKGYQDFDSIVSSVIIKVKGVAFVNSSGFGERLWDSADYIIPPEQESSFFVMTNLIRTENQTQGHCPEL----PKNGF-----------NCTSDSNCTAGLIDPHSSGVLTGKCVTFNEGVKTCEVLAWCPLESQTVFP-NPALLGGAENFTVLIKNNIRFPQFNFSKRNILPNISASYLKTCVFNRTKE--PYCPIFRLGDIVRETGDK-FQELALQGGVIGILIKWNCNLDRSASECVPQYTFQRLDNRNVDETVSPGYNFRYAKY 301          
BLAST of P2X purinoceptor vs. Ensembl Cavefish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 200.675 bits (509), Expect = 1.740e-60
Identity = 105/312 (33.65%), Postives = 169/312 (54.17%), Query Frame = 2
Query:   38 NLKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKF--GNYSRGWNFRYANY 967
            +L     +Y T K  VI++  +  + R  Q +++ Y+  Y   +K+GYQD+  + SS+  K+KG  L +  ++   IWDVAD ++PPQEE + F+ TN+  T NQTQ  CPE               P  P + C  D DC+K       +G+ TG+C   ++ IKTCE+  WCPLE         P++ +  N+TVLIKN++ + + N  + N+     +   S+C+F+        CPIF++  ++    E D + + ++GG++ + I W+C+LD+  + C P YTF RL  K    N + G+NFR+A Y
Sbjct:   74 SLTRCFFDYSTPKTLVIRSKTVGAINRLCQALVIAYIIGYVCVWKKGYQDTDTVISSVTTKVKGIALTNTSDLGTRIWDVADYIIPPQEENSFFVLTNLNITPNQTQSHCPE--------------NPG-PESSCSSDQDCKKGFRNGRLSGVRTGRCVHFSERIKTCEVLAWCPLEKYDE-PPDPPMLAEAENFTVLIKNSVRYPKFNFSRRNILPHINSTYLSKCVFSRDTD--PDCPIFRLRDIVAEAGE-DFQAMAVHGGVMGVQIRWDCDLDMPANWCVPRYTFRRLDNKDPENNVAPGYNFRFAKY 366          
BLAST of P2X purinoceptor vs. Ensembl Cavefish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 200.675 bits (509), Expect = 6.020e-60
Identity = 105/312 (33.65%), Postives = 169/312 (54.17%), Query Frame = 2
Query:   38 NLKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKF--GNYSRGWNFRYANY 967
            +L     +Y T K  VI++  +  + R  Q +++ Y+  Y   +K+GYQD+  + SS+  K+KG  L +  ++   IWDVAD ++PPQEE + F+ TN+  T NQTQ  CPE               P  P + C  D DC+K       +G+ TG+C   ++ IKTCE+  WCPLE         P++ +  N+TVLIKN++ + + N  + N+     +   S+C+F+        CPIF++  ++    E D + + ++GG++ + I W+C+LD+  + C P YTF RL  K    N + G+NFR+A Y
Sbjct:   74 SLTRCFFDYSTPKTLVIRSKTVGAINRLCQALVIAYIIGYVCVWKKGYQDTDTVISSVTTKVKGIALTNTSDLGTRIWDVADYIIPPQEENSFFVLTNLNITPNQTQSHCPE--------------NPG-PESSCSSDQDCKKGFRNGRLSGVRTGRCVHFSERIKTCEVLAWCPLEKYDE-PPDPPMLAEAENFTVLIKNSVRYPKFNFSRRNILPHINSTYLSKCVFSRDTD--PDCPIFRLRDIVAEAGE-DFQAMAVHGGVMGVQIRWDCDLDMPANWCVPRYTFRRLDNKDPENNVAPGYNFRFAKY 366          
BLAST of P2X purinoceptor vs. Ensembl Cavefish
Match: p2rx8 (purinergic receptor P2X, ligand-gated ion channel, 8 [Source:ZFIN;Acc:ZDB-GENE-030319-7])

HSP 1 Score: 187.963 bits (476), Expect = 1.851e-56
Identity = 108/317 (34.07%), Postives = 170/317 (53.63%), Query Frame = 2
Query:   38 NLKSLVL---EYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSY-GLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTK-EIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERL-FTKFGN-YSRGWNFRYANY 967
            +L++++L   +Y+T K  + +N K+  ++R +Q  +L Y+  +    K+GYQ++   + SS++ K+KG  L +       +W   D V+P Q E  LFITTN IET NQ  G C E +               V + +C+++ DC +  A+  GNG+ TG+C    +    TCEI  WCP+E +       PL+ K  N+T+ IKN I F +    KSN+   A +     C+++       YCPIF++  ++   S  D +++ + GG + I+I W+C+LD  Y  C P YTF RL F    N  S G+NFRYA+Y
Sbjct:    4 DLRAVLLSAFDYKTEKYVIAKNKKVGILYRVIQLSLLGYIIGWVFLTKKGYQETEESIQSSVITKVKGVLLTNSSGTGPRLWGPEDYVIPQQGEDVLFITTNFIETPNQKLGYCAESF--------------KVLDGRCRKNEDCPEGEAVVAGNGVRTGRCLKKDRNSTGTCEIYGWCPIEKSQRLIV--PLLGKTENFTIYIKNFIRFPKFGFSKSNVLDTAGDSYLKTCLYDAIAH--PYCPIFRLGDIV-LRSGHDFQDMALLGGSIGILIEWHCDLDKGYSHCHPRYTFTRLDFNSTANSVSSGYNFRYAHY 301          
BLAST of P2X purinoceptor vs. Ensembl Cavefish
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:103022360])

HSP 1 Score: 178.718 bits (452), Expect = 1.001e-52
Identity = 107/312 (34.29%), Postives = 156/312 (50.00%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAK--CKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLF-TKFGNYSRGWNFRYANY 967
            +     EYET +  +++N ++  V R +Q  +L+Y+  +   Y++GYQ       S+  K+KG    +    ++ +WDV+D V P Q   +  + TN I T  QTQ  CPE                 +P+ K  C  D DC+K      GNG MTGKC   T    TCEI +WCP+E++       PL+    NYT+ IKN+I F E NV +SNL    +      C+F+ +   L  CPIFK+   I   S  +  ++   GG + I+I W CNLDL   +C P+Y F  L+ +     S G+NFR A Y
Sbjct:    9 ISDFFFEYETPRQVLVRNRRVGVVCRLIQLGVLVYIIGWVFIYEKGYQTEDTAIGSVFTKMKGVAYTNISGEQK-VWDVSDYVYPDQGAESFVVMTNFIITVGQTQSTCPE-----------------LPDGKNTCHSDEDCKKGEFKRTGNGEMTGKCVNTT---NTCEIMSWCPVEDDRQIP-DPPLLLAAENYTLFIKNSITFPEFNVVRSNLVEGVDQNYIKTCMFHPEKDPL--CPIFKLGD-IAQYSGFNFTQIAQGGGAIGILIDWECNLDLRIQKCIPKYRFHGLYGSSSEGASVGYNFRKAKY 295          
BLAST of P2X purinoceptor vs. Ensembl Cavefish
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:103022360])

HSP 1 Score: 178.333 bits (451), Expect = 1.393e-52
Identity = 107/312 (34.29%), Postives = 156/312 (50.00%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAK--CKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLF-TKFGNYSRGWNFRYANY 967
            +     EYET +  +++N ++  V R +Q  +L+Y+  +   Y++GYQ       S+  K+KG    +    ++ +WDV+D V P Q   +  + TN I T  QTQ  CPE                 +P+ K  C  D DC+K      GNG MTGKC   T    TCEI +WCP+E++       PL+    NYT+ IKN+I F E NV +SNL    +      C+F+ +   L  CPIFK+   I   S  +  ++   GG + I+I W CNLDL   +C P+Y F  L+ +     S G+NFR A Y
Sbjct:    9 ISDFFFEYETPRQVLVRNRRVGVVCRLIQLGVLVYIIGWVFIYEKGYQTEDTAIGSVFTKMKGVAYTNISGEQK-VWDVSDYVYPDQGAESFVVMTNFIITVGQTQSTCPE-----------------LPDGKNTCHSDEDCKKGEFKRTGNGEMTGKCVNTT---NTCEIMSWCPVEDDRQIP-DPPLLLAAENYTLFIKNSITFPEFNVVRSNLVEGVDQNYIKTCMFHPEKDPL--CPIFKLGD-IAQYSGFNFTQIAQGGGAIGILIDWECNLDLRIQKCIPKYRFHGLYGSSSEGASVGYNFRKAKY 295          
BLAST of P2X purinoceptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008095.1 (pep scaffold:Pmarinus_7.0:GL481209:13988:23244:1 gene:ENSPMAG00000007268.1 transcript:ENSPMAT00000008095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.282 bits (495), Expect = 1.270e-59
Identity = 95/307 (30.94%), Postives = 162/307 (52.77%), Query Frame = 2
Query:   53 VLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDS-YGLSSSIVLKLKGFGLADR-QNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGNYSRGWNFRYANY 967
              EY+T K+ + ++  +  V+R +Q +IL Y+  +    K+GYQ++     +S++ K+KG  L +  +   + +WD AD V+PPQ E+  F+ TN++ T  Q QG C E               P+VP A+C++D DC        GNGI TG+C P     + CE+  WCP+EN+   + RE ++++  N+TV IK ++ F   NV + N+    ++     C F+ +   L  CP+F++  L    +     ++   GG++ + + W+C+LD     C  +Y F RL ++    + G NFR+A Y
Sbjct:   13 AFEYKTEKLMIARDRSVGVVYRLMQLVILAYIIGWVFVVKKGYQETDPDPETSVITKVKGVALTNSTEGPGQRLWDTADYVIPPQGESRFFVVTNLVSTPRQRQGLCAE--------------NPNVPGARCQEDGDCPAGRTFNTGNGICTGRCVPTNGTARVCEVHAWCPVENSP--TPREAVLREAENFTVFIKVSVNFTRFNVHRRNVLEEGDSSYLKSCEFHPERSPL--CPVFRLGEL-AVRAGASFSDMATRGGVIAVHLAWDCDLDRDLSACAAQYRFSRLDSERSRVAAGHNFRFARY 300          
BLAST of P2X purinoceptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008762.1 (pep scaffold:Pmarinus_7.0:GL477338:26903:57888:-1 gene:ENSPMAG00000007911.1 transcript:ENSPMAT00000008762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.436 bits (363), Expect = 4.509e-41
Identity = 92/307 (29.97%), Postives = 148/307 (48.21%), Query Frame = 2
Query:   35 RNLKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGNYSRGWNFR 955
            R L   +  Y    +  I+N     +   ++ +IL Y   Y + ++  Y++   ++S++ +K+KG    D  N     +D AD VVP QE    F+ TN I T NQTQ     V    N   +     P      C+ D DC ++A+ +LG+GI TG+C       K+CE+  WCP+E  +    + PL+    N TV I+N + F + N ++ N     E    S C ++ +      CPIF++  +   ++      + + GGI+ I+I+W+C   LS   C P Y+F RL   +    RG+NFR
Sbjct:    7 RGLPCNIFFYPRELVIGIENKYCGPIHMVVRIVILGYGARYVVGFEHAYREYEDVTSAVRVKVKGTAKVDIPNEGVRTFDSADYVVPDQEPNTFFVMTNFIVTKNQTQ-----VTTCCNPEAMKFSVSP------CQNDGDCTRDASKHLGSGIQTGRCIRYDATCKSCEVMGWCPVERRTS-PPQPPLLPATENATVYIQNHVYFIKNNKERENFPLNLEGKDLSSCRYHPRDD--PSCPIFRLGDITA-MAGHSFSSMSVQGGIIAIVISWDCK--LSEVECFPAYSFHRLDRNY-TTKRGYNFR 295          
BLAST of P2X purinoceptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007719.1 (pep scaffold:Pmarinus_7.0:GL477301:21784:46999:1 gene:ENSPMAG00000006964.1 transcript:ENSPMAT00000007719.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.28 bits (360), Expect = 1.743e-40
Identity = 92/283 (32.51%), Postives = 127/283 (44.88%), Query Frame = 2
Query:  131 IILLYVFIYSLW--YKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGN--YSRGWNFRYANY 967
            + ++ V  Y+ W  Y  GYQ+  G+ SS   K+KG        V   + D AD V+ P+E  + F+ TN IET NQ QG C E               P V  A C  D+DC+       G G+ TG C P+    K+CE+  WCPL  +S                            N  K N+     + + S C ++ +      CPIF +  ++    E D KEL I GG+  I+I WNCNLDL+   C+P Y F RL  +  N   S G+NFR+  Y
Sbjct:   36 VFVMLVISYTGWVIYTHGYQEFDGVVSSSTAKVKG-----ATEVTGMVMDAADYVISPEEPNSFFVMTNFIETPNQKQGACAE--------------DPDV--APCSSDTDCRAGVTDPEGEGVFTGLCVPINNTTKSCEVNAWCPLPKDS----------------------------NPPKHNILGSNASYLKS-CRYHRQSD--PECPIFILGDIVSEAGE-DFKELAIEGGVFSIMIEWNCNLDLNEQACKPNYKFRRLDKENRNKTISPGYNFRFPKY 265          
BLAST of P2X purinoceptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000196.1 (pep scaffold:Pmarinus_7.0:GL482356:953:3300:-1 gene:ENSPMAG00000000176.1 transcript:ENSPMAT00000000196.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 5.777e-16
Identity = 40/113 (35.40%), Postives = 58/113 (51.33%), Query Frame = 2
Query:  491 GIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGG 829
            G  TG+C P  K + TCE+  WCP+E     + +  L++   N+T+LIKN I F + NV K NL    +      C  + KH  L  CPIF +  ++    + D K + I GG
Sbjct:    1 GEKTGRCVPFDKNVSTCEVNAWCPVEVEGKNTGKR-LLRSAENFTILIKNNIRFPKFNVSKGNLPENMDKNFLKSCHHHPKHNNL--CPIFSLRDILRSAGQ-DFKSIGINGG 109          
BLAST of P2X purinoceptor vs. Ensembl Nematostella
Match: EDO41363 (P2X purinoceptor [Source:UniProtKB/TrEMBL;Acc:A7S4Q4])

HSP 1 Score: 179.874 bits (455), Expect = 1.829e-53
Identity = 110/314 (35.03%), Postives = 164/314 (52.23%), Query Frame = 2
Query:   53 VLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRT-------IWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKE--IKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGNYSRGWNFRYANY 967
            +LEY T+K+  I++ K+  + R +Q  I+ Y+  Y + YK+GYQ+     SS+  KLKG    +              +WD AD V+PP+E  A F+ TN++ T +Q QG CPE               P + N KC +D +C +      G+G  TGKC P  +E  IK CE+  WCP+E +     + P +K   N+TVLIKNT+ F    V K N+   A+      C ++     L  CPIF++ ++     + D  +L   GG++ IIITWNC+ D     C+P Y+F RL       ++G+NFR+ANY
Sbjct:   12 LLEYNTSKIVHIKSKKVGLINRLIQLAIIGYIIGYVIIYKKGYQEVEKPYSSVTTKLKGTSFTNLTGNESFPLYGGPFVWDQADYVIPPEENDAFFVATNMVITPDQRQGTCPE--------------SPDIANVKCTRDENCTRMEETSYGHGFQTGKCVPSDQEKGIKVCEVFAWCPVELDITPMPQFPSLK---NFTVLIKNTVQFPSFGVSKRNIAPDADTSTLKSCQYDKDTSPL--CPIFRLETITKEAGQ-DFNKLAYKGGVIGIIITWNCDFDSLLYSCKPVYSFRRLDNANAPIAKGYNFRHANY 305          
BLAST of P2X purinoceptor vs. Ensembl Medaka
Match: p2rx4b (purinergic receptor P2X 4 [Source:NCBI gene;Acc:101168548])

HSP 1 Score: 185.652 bits (470), Expect = 1.185e-54
Identity = 109/313 (34.82%), Postives = 172/313 (54.95%), Query Frame = 2
Query:   35 RNLKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLF--TKFGNYSRGWNFRYANY 967
            R     V +YET K  VI +  +  VFR  Q +++LYV  Y    ++GYQ++  + S++  K+KGF   +  ++   +WDVAD V+PPQ +++ FI TN++ T  QTQ  CPE+              P+ P+  CK D DC +       NGI TG C   +  +KTCE+ +WCPLE ++    ++ L+    N+TVLIKN+I + + N    N+     +   + C FN        CPIF++  +I   +E D +E+ + GGIL I+I W+C+LD    +C P+Y+F RL    +  + + G+NFR+A +
Sbjct:    8 RGFLHHVFDYETAKTLVIPHFGVGIVFRFTQLLVVLYVVGYVCVVQKGYQETDSVISTVTTKVKGFAYTNTSDMDPRMWDVADYVIPPQGDSSFFILTNLVVTPEQTQSHCPEL--------------PN-PSTVCKDDCDCIEGYNDPRRNGIRTGLCENFSTTVKTCEVFSWCPLEVDTRLP-KKALLAAAENFTVLIKNSITYPKFNFHGRNILPHVNSSYLAHCEFNRLTD--PDCPIFRLKRIISE-AEADFQEMAVKGGILGILIDWSCDLDWWAGKCLPKYSFHRLDNQNQGNDVAPGYNFRFAKF 301          
BLAST of P2X purinoceptor vs. Ensembl Medaka
Match: p2rx5 (P2X purinoceptor 5 [Source:NCBI gene;Acc:101173001])

HSP 1 Score: 184.496 bits (467), Expect = 2.481e-54
Identity = 103/307 (33.55%), Postives = 159/307 (51.79%), Query Frame = 2
Query:   53 VLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQD-SYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKF-GNYSRGWNFRYANY 967
            +L Y+T K  + +N +I  +FR  Q  +L Y+  +    K+GYQ+    + +S++ K+KG  L +       +W   D V+PP  E   FI TN IET NQ  G C E               P VPN  C+ D DC +  ++  G+GIMTG C   T    TCEI  WCP+E++   +  E L+ +  N+T+ IKN I F +    KSN+   +++    +C ++ ++    YCPIF++  L+      D +++   GG + I+I WNC+LD     C P Y+F RL      + + G+NFR+A Y
Sbjct:   11 LLNYKTEKYVIAENRRIGILFRLYQLAVLGYIIGWVFVVKKGYQEKEEAVQTSVITKVKGVSLINSSQTGPYLWSAEDYVIPPNGEQVFFIVTNYIETPNQRLGFCAE--------------SPKVPNGMCQSDEDCLEGESIAAGHGIMTGLCLNST---GTCEIYAWCPVEHSKRPT--EALLSEAENFTIYIKNFIRFPKFEFSKSNVLETSDDSYLKKCSYDRENH--PYCPIFRLRDLVRNTG-NDFQDMAAKGGSVGILIEWNCDLDKDSSECNPRYSFTRLDMNLNSSITSGYNFRHARY 295          
BLAST of P2X purinoceptor vs. Ensembl Medaka
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:101169631])

HSP 1 Score: 178.718 bits (452), Expect = 9.000e-53
Identity = 103/314 (32.80%), Postives = 159/314 (50.64%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFT-----KFGNYSRGWNFRYANY 967
            L     EYET +  +++N ++  V R +Q  +L Y+  +   Y++GYQ +    SS+  K+KG G  +   V R +WD +D V PPQ +++  + TN I T NQT GKCPE+       R +           CK D+DC+        +G +TG C    KE KTCE+  WCPLE++       PL+    N+T+ IKN++ F    + +SNL    +      C+F+  +  L  CPIFK+  ++  +S    + +   GG + ++I W CN D    +C+P+Y F  L+           S G+NFRYA Y
Sbjct:    9 LSDFFFEYETPRQVLVRNKRVGVVCRLIQLGVLAYIIGWVFIYEKGYQITETAVSSVFTKVKGVGSTNISGVER-VWDPSDYVFPPQGDSSFVVMTNYILTENQTMGKCPEL-----PGRYI-----------CKSDTDCKGGTYNRTVDGKLTGVC---VKETKTCELLAWCPLEDDRNIP-NPPLLMSAENFTLFIKNSVTFPLFGITRSNLVEEIDGKTIKNCLFDPDNSPL--CPIFKLGDIV-KLSGFTFETMAKQGGAIGLVIDWTCNFDYDVKKCKPKYEFHGLYGNPRVKDTSKASVGYNFRYAKY 298          
BLAST of P2X purinoceptor vs. Ensembl Medaka
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:101169631])

HSP 1 Score: 179.104 bits (453), Expect = 1.475e-52
Identity = 103/314 (32.80%), Postives = 159/314 (50.64%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFT-----KFGNYSRGWNFRYANY 967
            L     EYET +  +++N ++  V R +Q  +L Y+  +   Y++GYQ +    SS+  K+KG G  +   V R +WD +D V PPQ +++  + TN I T NQT GKCPE+       R +           CK D+DC+        +G +TG C    KE KTCE+  WCPLE++       PL+    N+T+ IKN++ F    + +SNL    +      C+F+  +  L  CPIFK+  ++  +S    + +   GG + ++I W CN D    +C+P+Y F  L+           S G+NFRYA Y
Sbjct:    9 LSDFFFEYETPRQVLVRNKRVGVVCRLIQLGVLAYIIGWVFIYEKGYQITETAVSSVFTKVKGVGSTNISGVER-VWDPSDYVFPPQGDSSFVVMTNYILTENQTMGKCPEL-----PGRYI-----------CKSDTDCKGGTYNRTVDGKLTGVC---VKETKTCELLAWCPLEDDRNIP-NPPLLMSAENFTLFIKNSVTFPLFGITRSNLVEEIDGKTIKNCLFDPDNSPL--CPIFKLGDIV-KLSGFTFETMAKQGGAIGLVIDWTCNFDYDVKKCKPKYEFHGLYGNPRVKDTSKASVGYNFRYAKY 298          
BLAST of P2X purinoceptor vs. Ensembl Medaka
Match: p2rx3a (P2X purinoceptor 3 [Source:NCBI gene;Acc:101165153])

HSP 1 Score: 160.999 bits (406), Expect = 7.810e-46
Identity = 101/305 (33.11%), Postives = 152/305 (49.84%), Query Frame = 2
Query:   62 YETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQD-SYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKF--GNYSRGWNFRYANY 967
            YET K  V+++  +  + R +Q +I+ Y   +   +++ YQ    G+ SS++ K+KGFG  + Q     + DVAD V PPQ      I T +I T +Q QG+C E                S PN  C  D DC  +    L NG++TG C    +    CEI+ WCP EN+ +          V N+T+ IKN+I F   NV + N  +   + +   C+++ +H     CPIF+V  ++   + +DL  L   GG + I I W CN D   + C P+Y+F RL   F     S+G+NFR+A Y
Sbjct:   18 YETTKSVVVKSWSVGIINRIVQLLIITYFVGWVFIHEKAYQVIDTGIESSVMTKVKGFGRLNHQ-----VMDVADYVYPPQGSGIFCIMTRIIVTEDQFQGRCAE----------------SQPNFNCSTDEDCYLHKNTLLSNGVITGVCR--NESGGRCEIEGWCPAENDDV---TNSTTLDVLNFTIFIKNSIRFPLFNVTRGNFPSSMTSEMIKNCVYHPEHN--PSCPIFRVGDVLN-YTGQDLTSLTEKGGEIGINIEWKCNFDRDIELCVPKYSFTRLDAPFMKNQVSKGYNFRFAKY 293          
BLAST of P2X purinoceptor vs. Planmine SMEST
Match: SMESG000046751.1 (SMESG000046751.1)

HSP 1 Score: 411.379 bits (1056), Expect = 2.151e-143
Identity = 198/309 (64.08%), Postives = 233/309 (75.40%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGNYSRGWNFRYANY 967
            L++ VL+Y T K+ VIQNT I+Y FR LQ  ILLYVFIYSLW K+GYQDSYGLSSS+V+K KG G A + N +R +WD+ADSVVPPQE  ALFITTNV+ETYNQTQG CPE               P V N+ CK D+DC     LYLGNG MTGKC   + +IKTCEI+ WCPLEN++       +IK+V NYTVLIKNTIIFDEVNVQ+SNLFA    +IP+ CI+N    LLKYCPIFKVSS IG I++ DL EL +YGGI+R+IITWNCNLD  YD CRPEY+FERLFTK+G +S+GWNFRYANY
Sbjct:   12 LRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLSSSVVVKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPE--------------NPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANY 306          
BLAST of P2X purinoceptor vs. Planmine SMEST
Match: SMESG000046729.1 (SMESG000046729.1)

HSP 1 Score: 357.836 bits (917), Expect = 4.628e-123
Identity = 162/306 (52.94%), Postives = 223/306 (72.88%), Query Frame = 2
Query:   53 VLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEI-KTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGNYSRGWNFRYANY 967
            +  YETNK+++I +  I ++ R  Q +IL+YV +YS+ YKRGYQD YGLSSS+++K+KG G++DR+++ R IWD+ D+VVPPQE  A+FITTN IET NQ+QG CPE                +V +A C++DSDC+K   L+LGNG+MTG+C    +   KTCEI+ WCP+EN+++   +  L+K+V ++TVLI+NTIIFD +NVQ+SNLF+W   +I  +CI+N   +LLKYCPIFKVS+LIG IS  +L E+   GG++R+IITWNCNLD S D C P Y+F RL+   G +S+GWNFRYANY
Sbjct:   15 IFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPE--------------DTTVEDALCQKDSDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISNSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANY 306          
BLAST of P2X purinoceptor vs. Planmine SMEST
Match: SMESG000046729.1 (SMESG000046729.1)

HSP 1 Score: 357.836 bits (917), Expect = 1.302e-122
Identity = 162/306 (52.94%), Postives = 223/306 (72.88%), Query Frame = 2
Query:   53 VLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEI-KTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGNYSRGWNFRYANY 967
            +  YETNK+++I +  I ++ R  Q +IL+YV +YS+ YKRGYQD YGLSSS+++K+KG G++DR+++ R IWD+ D+VVPPQE  A+FITTN IET NQ+QG CPE                +V +A C++DSDC+K   L+LGNG+MTG+C    +   KTCEI+ WCP+EN+++   +  L+K+V ++TVLI+NTIIFD +NVQ+SNLF+W   +I  +CI+N   +LLKYCPIFKVS+LIG IS  +L E+   GG++R+IITWNCNLD S D C P Y+F RL+   G +S+GWNFRYANY
Sbjct:   15 IFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPE--------------DTTVEDALCQKDSDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISNSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANY 306          
BLAST of P2X purinoceptor vs. Planmine SMEST
Match: SMESG000046895.1 (SMESG000046895.1)

HSP 1 Score: 320.087 bits (819), Expect = 1.321e-107
Identity = 155/320 (48.44%), Postives = 216/320 (67.50%), Query Frame = 2
Query:    8 MKKKSFKYFRNLKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGNYSRGWNFRYANY 967
            MK    +    +K    EYETNK+  I + KI ++FR  Q ++++Y+  Y L Y RGYQDSYGLSSS+V+K+KG         RR +WD++D ++PPQE  A F+TTN IET NQTQ  C E Y              +VP A+C  D DC +N A+ LGNG+MTG+C      IKTCEI +WCPLEN++M    + ++K++ ++T+LI+NTI+FDE++V++SNLFAW  N IP  C+FN     LKYCPIFK+SS +G I+  ++K+L  +GGI+++II WNC+LD S ++C+PEY+F RL  K G  S+GWNFR+ANY
Sbjct:    1 MKSTVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQLLLIVYIIGYVLIYMRGYQDSYGLSSSVVVKVKGISSTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDY--------------NVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANY 306          
BLAST of P2X purinoceptor vs. Planmine SMEST
Match: SMESG000010795.1 (SMESG000010795.1)

HSP 1 Score: 233.802 bits (595), Expect = 7.271e-73
Identity = 115/311 (36.98%), Postives = 184/311 (59.16%), Query Frame = 2
Query:   41 LKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVFIYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQEETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQDSDCQKNAALYLGNGIMTGKC--TPVTKEIKTCEIQTWCPLENNSMFSFREPLIKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKYCPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYTFERLFTKFGNYSRGWNFRYANY 967
            + + + EYET+K+  I++ K+  ++R  Q  I+LY+ ++ ++ ++GYQ      + +  KLKG   A+       +WDVAD VVPPQ+ +A F++TN++ T NQT G+CPE                 V    CK DSDC KN  ++ G+G++TG+C  + +  + K CEI  WCP EN+ M    +PL+    N+TVL+KN+I F +  V++ N+  W +    + C ++ KH   K+CPIF++  LI   + K+ K +  +G ++ I I WNCNLD++Y++C PEYTF RL     +  +GWNFRY+ +
Sbjct:   11 IPATIFEYETSKVVQIRSWKVGIIYRLTQLGIILYIALWVMYLEKGYQVFDYPVAGVTAKLKGIAFANLSKTGAIVWDVADFVVPPQQNSAFFVSTNMVITANQTLGRCPE--------------STDVHGVTCKSDSDCIKNRIIHTGSGVITGRCVLSDIKNDTKVCEIYGWCPTENDVMPIPGQPLLSSAPNFTVLLKNSIEFPKFKVKRRNILTWMDKKFLNSCRYDPKHWRNKFCPIFQLKDLINFSNAKN-KNIWTHGALISIHIEWNCNLDINYEKCVPEYTFRRLDDFDFDVGKGWNFRYSEH 306          
The following BLAST results are available for this feature:
BLAST of P2X purinoceptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2RX41.335e-6334.19purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX52.204e-6336.04purinergic receptor P2X 5 [Source:HGNC Symbol;Acc:... [more]
P2RX5-TAX1BP33.649e-6336.04P2RX5-TAX1BP3 readthrough (NMD candidate) [Source:... [more]
P2RX45.344e-6334.19purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX52.239e-6035.39purinergic receptor P2X 5 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of P2X purinoceptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of P2X purinoceptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx4b5.244e-6536.16purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a4.461e-6234.97purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a3.966e-5933.97purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a4.366e-5933.97purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx14.035e-5534.36purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx51.290e-6035.48purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx51.811e-6035.48purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx52.477e-6035.48purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx52.530e-6035.48purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx53.658e-6035.48purinergic receptor P2X, ligand gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2rx42.125e-6435.37purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx43.784e-6435.37purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx14.887e-5833.55purinergic receptor P2X, ligand-gated ion channel,... [more]
P2rx61.478e-5733.44purinergic receptor P2X, ligand-gated ion channel,... [more]
P2rx23.051e-5635.14purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JJX6|P2RX4_MOUSE2.884e-6335.69P2X purinoceptor 4 OS=Mus musculus OX=10090 GN=P2r... [more]
sp|Q93086|P2RX5_HUMAN1.059e-6236.04P2X purinoceptor 5 OS=Homo sapiens OX=9606 GN=P2RX... [more]
sp|Q99571|P2RX4_HUMAN2.566e-6234.19P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX... [more]
sp|P51577|P2RX4_RAT7.490e-6235.05P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 G... [more]
sp|Q5E9U1|P2RX4_BOVIN1.076e-6034.41P2X purinoceptor 4 OS=Bos taurus OX=9913 GN=P2RX4 ... [more]
back to top
BLAST of P2X purinoceptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W3HBT21.261e-6436.69P2X purinoceptor OS=Callorhinchus milii OX=7868 GN... [more]
A0A4W3HW341.437e-6436.69P2X purinoceptor OS=Callorhinchus milii OX=7868 GN... [more]
A0A4W3H8T71.571e-6436.57P2X purinoceptor OS=Callorhinchus milii OX=7868 GN... [more]
R7VDE31.756e-6436.31Uncharacterized protein OS=Capitella teleta OX=283... [more]
V9KH441.858e-6436.57P2X purinoceptor OS=Callorhinchus milii OX=7868 GN... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx4a1.740e-6033.65purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a6.020e-6033.65purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx81.851e-5634.07purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx11.001e-5234.29purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx11.393e-5234.29purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008095.11.270e-5930.94pep scaffold:Pmarinus_7.0:GL481209:13988:23244:1 g... [more]
ENSPMAT00000008762.14.509e-4129.97pep scaffold:Pmarinus_7.0:GL477338:26903:57888:-1 ... [more]
ENSPMAT00000007719.11.743e-4032.51pep scaffold:Pmarinus_7.0:GL477301:21784:46999:1 g... [more]
ENSPMAT00000000196.15.777e-1635.40pep scaffold:Pmarinus_7.0:GL482356:953:3300:-1 gen... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of P2X purinoceptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO413631.829e-5335.03P2X purinoceptor [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx4b1.185e-5434.82purinergic receptor P2X 4 [Source:NCBI gene;Acc:10... [more]
p2rx52.481e-5433.55P2X purinoceptor 5 [Source:NCBI gene;Acc:101173001... [more]
p2rx19.000e-5332.80purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx11.475e-5232.80purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx3a7.810e-4633.11P2X purinoceptor 3 [Source:NCBI gene;Acc:101165153... [more]
back to top
BLAST of P2X purinoceptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046751.12.151e-14364.08SMESG000046751.1[more]
SMESG000046729.14.628e-12352.94SMESG000046729.1[more]
SMESG000046729.11.302e-12252.94SMESG000046729.1[more]
SMESG000046895.11.321e-10748.44SMESG000046895.1[more]
SMESG000010795.17.271e-7336.98SMESG000010795.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029013 ID=SMED30029013|Name=P2X purinoceptor|organism=Schmidtea mediterranea sexual|type=transcript|length=967bp
AAGACAAATGAAAAAGAAGTCATTCAAATATTTCCGGAATCTAAAGTCAC
TTGTTTTGGAATATGAAACAAACAAAATGACTGTTATTCAAAATACAAAA
ATTATTTACGTCTTTCGGACTTTGCAAACAATTATTCTTCTTTACGTATT
TATTTATTCATTGTGGTATAAAAGAGGTTATCAAGATTCTTATGGGTTGT
CAAGCAGTATTGTTTTAAAATTAAAAGGTTTCGGGTTGGCTGATCGTCAA
AATGTCAGGCGAACAATTTGGGATGTTGCTGATTCAGTGGTTCCTCCACA
GGAAGAAACTGCGCTATTTATTACTACAAATGTTATTGAAACATATAACC
AAACACAAGGAAAATGCCCTGAAGTATATATTGTTGAAAATAAAAATAGA
TTACTTTTATTGAAGAAACCAAGTGTACCCAATGCAAAATGCAAGCAAGA
TTCGGATTGTCAAAAGAATGCGGCTCTTTATTTGGGAAACGGCATTATGA
CAGGGAAATGTACTCCAGTAACCAAAGAAATAAAAACCTGTGAGATCCAA
ACTTGGTGTCCTTTAGAGAATAATTCGATGTTTTCATTCCGCGAACCTCT
CATTAAAAAAGTCTCAAACTATACAGTTCTGATCAAAAACACAATTATAT
TTGATGAGGTGAACGTGCAAAAATCTAATTTGTTTGCATGGGCTGAAAAT
TTGATTCCCAGTCGTTGTATTTTTAACGACAAGCACAAATTATTGAAATA
CTGTCCAATTTTTAAAGTGTCTTCTTTAATTGGGCCGATTAGTGAAAAGG
ATCTCAAAGAATTACATATTTATGGAGGAATTCTCCGAATAATAATAACG
TGGAATTGCAATCTTGACTTATCTTATGATCGTTGTCGACCTGAATATAC
ATTTGAAAGATTATTCACAAAATTCGGGAATTACAGTAGAGGATGGAATT
TCAGATATGCAAATTAT
back to top

protein sequence of SMED30029013-orf-1

>SMED30029013-orf-1 ID=SMED30029013-orf-1|Name=SMED30029013-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=322bp
RQMKKKSFKYFRNLKSLVLEYETNKMTVIQNTKIIYVFRTLQTIILLYVF
IYSLWYKRGYQDSYGLSSSIVLKLKGFGLADRQNVRRTIWDVADSVVPPQ
EETALFITTNVIETYNQTQGKCPEVYIVENKNRLLLLKKPSVPNAKCKQD
SDCQKNAALYLGNGIMTGKCTPVTKEIKTCEIQTWCPLENNSMFSFREPL
IKKVSNYTVLIKNTIIFDEVNVQKSNLFAWAENLIPSRCIFNDKHKLLKY
CPIFKVSSLIGPISEKDLKELHIYGGILRIIITWNCNLDLSYDRCRPEYT
FERLFTKFGNYSRGWNFRYANY
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0001614purinergic nucleotide receptor activity
GO:0004931extracellular ATP-gated cation channel activity
GO:0005216ion channel activity
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR027309P2X_extracellular_dom_sf
IPR001429P2X_purnocptor
Vocabulary: biological process
TermDefinition
GO:0033198response to ATP
GO:0098655cation transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0035590purinergic nucleotide receptor signaling pathway
GO:0060079excitatory postsynaptic potential
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0098794postsynapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF00864P2X_receptorcoord: 19..322
e-value: 7.1E-87
score: 291.9
NoneNo IPR availableGENE3DG3DSA:1.10.287.940coord: 42..61
e-value: 6.7E-80
score: 270.5
NoneNo IPR availablePANTHERPTHR10125P2X PURINOCEPTORcoord: 17..322
NoneNo IPR availableTMHMMTMhelixcoord: 34..56
IPR027309P2X purinoreceptor extracellular domain superfamilyGENE3DG3DSA:2.60.490.10coord: 62..322
e-value: 6.7E-80
score: 270.5