LITAF domain-containing protein

Overview
NameLITAF domain-containing protein
Smed IDSMED30029006
Uniprot Best hitLITAF domain-containing protein OS=Homo sapiens OX=9606 GN=LITAFD PE=5 SV=1 (E=1.25066e-10)
Length (bp)598
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LITAF domain-containing protein (SMED30029006) t-SNE clustered cells

Violin plots show distribution of expression levels for LITAF domain-containing protein (SMED30029006) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LITAF domain-containing protein (SMED30029006) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LITAF domain-containing protein (SMED30029006) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029006

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30029006SMESG000020865.1 dd_Smed_v4_3956_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029006SMESG000020865.1 dd_Smed_v4_3956_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30029006SMESG000020865.1 dd_Smed_v4_3956_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029006SMESG000020865.1 DN306897ncbi_smed_estsPMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30029006SMESG000020865.1 DN306897ncbi_smed_estsPMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LITAF domain-containing protein vs. Ensembl Human
Match: LITAFD (LITAF domain containing [Source:HGNC Symbol;Acc:HGNC:53927])

HSP 1 Score: 58.5362 bits (140), Expect = 2.604e-11
Identity = 24/65 (36.92%), Postives = 35/65 (53.85%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFA-PIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C N +    ++  G  TWL+C  +FLF   +GCC + FCI    D K+ CP+C  +L+   R
Sbjct:    7 CPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFYYHR 71          
BLAST of LITAF domain-containing protein vs. Ensembl Human
Match: LITAFD (LITAF domain containing [Source:HGNC Symbol;Acc:HGNC:53927])

HSP 1 Score: 58.5362 bits (140), Expect = 2.604e-11
Identity = 24/65 (36.92%), Postives = 35/65 (53.85%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFA-PIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C N +    ++  G  TWL+C  +FLF   +GCC + FCI    D K+ CP+C  +L+   R
Sbjct:    7 CPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFYYHR 71          
BLAST of LITAF domain-containing protein vs. Ensembl Human
Match: LITAF (lipopolysaccharide induced TNF factor [Source:HGNC Symbol;Acc:HGNC:16841])

HSP 1 Score: 53.1434 bits (126), Expect = 1.511e-8
Identity = 24/65 (36.92%), Postives = 33/65 (50.77%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFAPI-GCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C   +   +SY +G  TWL C  + L   I GCC IPFC++  +D  + CP C   L   +R
Sbjct:   96 CPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160          
BLAST of LITAF domain-containing protein vs. Ensembl Human
Match: LITAF (lipopolysaccharide induced TNF factor [Source:HGNC Symbol;Acc:HGNC:16841])

HSP 1 Score: 53.1434 bits (126), Expect = 1.511e-8
Identity = 24/65 (36.92%), Postives = 33/65 (50.77%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFAPI-GCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C   +   +SY +G  TWL C  + L   I GCC IPFC++  +D  + CP C   L   +R
Sbjct:   96 CPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160          
BLAST of LITAF domain-containing protein vs. Ensembl Human
Match: LITAF (lipopolysaccharide induced TNF factor [Source:HGNC Symbol;Acc:HGNC:16841])

HSP 1 Score: 53.1434 bits (126), Expect = 1.511e-8
Identity = 24/65 (36.92%), Postives = 33/65 (50.77%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFAPI-GCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C   +   +SY +G  TWL C  + L   I GCC IPFC++  +D  + CP C   L   +R
Sbjct:   96 CPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160          
BLAST of LITAF domain-containing protein vs. Ensembl Celegans
Match: F36G3.3 (pep chromosome:WBcel235:X:9798839:9801038:1 gene:WBGene00009484.1 transcript:F36G3.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F36G3.3)

HSP 1 Score: 48.9062 bits (115), Expect = 2.144e-7
Identity = 23/85 (27.06%), Postives = 39/85 (45.88%), Query Frame = 1
Query:  262 QNPAPSVVHVTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
              P P+   + ++   ++K++C  C  ++        G  TW+    +FLF    CC +PFC+   KD  + CP C   +   RR
Sbjct:   63 SGPMPTSTIIIRLEPHATKLQCPYCRMDIVTRTKSVYGLLTWIFFAALFLFGCWCCCFLPFCLRSCKDIIHTCPNCRAMIGVHRR 147          
BLAST of LITAF domain-containing protein vs. Ensembl Celegans
Match: Y37D8A.6 (pep chromosome:WBcel235:III:12856833:12857911:-1 gene:WBGene00012548.1 transcript:Y37D8A.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y37D8A.6)

HSP 1 Score: 47.3654 bits (111), Expect = 4.497e-7
Identity = 28/88 (31.82%), Postives = 44/88 (50.00%), Query Frame = 1
Query:  262 QNPAPSVVHVTKI--NYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFI-IFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            Q P   ++  TK+  ++      C +C   V   +    G  +W M F+ +F+F P+ CC   FC++GFKD ++ CP C   L   RR
Sbjct:   48 QQPQEIIIVGTKMAPSFEPYTEFCPRCNTNVCTRVERTMGFCSWTMLFLGLFVFFPLLCC---FCLDGFKDSRHSCPNCGTILSYKRR 132          
BLAST of LITAF domain-containing protein vs. Ensembl Fly
Match: CG32280 (gene:FBgn0052280 transcript:FBtr0073031)

HSP 1 Score: 45.4394 bits (106), Expect = 2.799e-6
Identity = 26/74 (35.14%), Postives = 37/74 (50.00%), Query Frame = 1
Query:  298 INYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAP-IGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            I+ +S+ + C  C  E+      + G   +L  F+I LF   +GCCLIP CI+   D  + CP C   L   RR
Sbjct:   57 ISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130          
BLAST of LITAF domain-containing protein vs. Ensembl Fly
Match: CG32280 (gene:FBgn0052280 transcript:FBtr0073030)

HSP 1 Score: 45.4394 bits (106), Expect = 2.799e-6
Identity = 26/74 (35.14%), Postives = 37/74 (50.00%), Query Frame = 1
Query:  298 INYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAP-IGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            I+ +S+ + C  C  E+      + G   +L  F+I LF   +GCCLIP CI+   D  + CP C   L   RR
Sbjct:   57 ISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130          
BLAST of LITAF domain-containing protein vs. Ensembl Fly
Match: CG32280 (gene:FBgn0052280 transcript:FBtr0344220)

HSP 1 Score: 45.4394 bits (106), Expect = 2.799e-6
Identity = 26/74 (35.14%), Postives = 37/74 (50.00%), Query Frame = 1
Query:  298 INYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAP-IGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            I+ +S+ + C  C  E+      + G   +L  F+I LF   +GCCLIP CI+   D  + CP C   L   RR
Sbjct:   57 ISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130          
BLAST of LITAF domain-containing protein vs. Ensembl Fly
Match: CG32280 (gene:FBgn0052280 transcript:FBtr0073032)

HSP 1 Score: 45.4394 bits (106), Expect = 2.799e-6
Identity = 26/74 (35.14%), Postives = 37/74 (50.00%), Query Frame = 1
Query:  298 INYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAP-IGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            I+ +S+ + C  C  E+      + G   +L  F+I LF   +GCCLIP CI+   D  + CP C   L   RR
Sbjct:   57 ISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130          
BLAST of LITAF domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-157c3.4 (si:ch211-157c3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-8454])

HSP 1 Score: 61.2326 bits (147), Expect = 8.585e-12
Identity = 29/67 (43.28%), Postives = 41/67 (61.19%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFA-PIGCCLIPFCINGFKDEKYKCPICDHKLY-ELRRC 519
            C  C+ +V   ++YK G + WLMC +IF     +GCCLIPF +  FKD  + CP C+  L+ E +RC
Sbjct:   81 CTSCQQQVLTNVTYKVGVYAWLMCILIFFCGFVLGCCLIPFFMKFFKDAYHSCPRCNKILHVEKKRC 147          
BLAST of LITAF domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-157c3.4 (si:ch211-157c3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-8454])

HSP 1 Score: 61.2326 bits (147), Expect = 8.585e-12
Identity = 29/67 (43.28%), Postives = 41/67 (61.19%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFA-PIGCCLIPFCINGFKDEKYKCPICDHKLY-ELRRC 519
            C  C+ +V   ++YK G + WLMC +IF     +GCCLIPF +  FKD  + CP C+  L+ E +RC
Sbjct:   81 CTSCQQQVLTNVTYKVGVYAWLMCILIFFCGFVLGCCLIPFFMKFFKDAYHSCPRCNKILHVEKKRC 147          
BLAST of LITAF domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-157c3.4 (si:ch211-157c3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-8454])

HSP 1 Score: 61.2326 bits (147), Expect = 8.585e-12
Identity = 29/67 (43.28%), Postives = 41/67 (61.19%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFA-PIGCCLIPFCINGFKDEKYKCPICDHKLY-ELRRC 519
            C  C+ +V   ++YK G + WLMC +IF     +GCCLIPF +  FKD  + CP C+  L+ E +RC
Sbjct:   81 CTSCQQQVLTNVTYKVGVYAWLMCILIFFCGFVLGCCLIPFFMKFFKDAYHSCPRCNKILHVEKKRC 147          
BLAST of LITAF domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-202h22.8 (si:ch211-202h22.8 [Source:ZFIN;Acc:ZDB-GENE-090313-78])

HSP 1 Score: 60.4622 bits (145), Expect = 1.524e-11
Identity = 32/96 (33.33%), Postives = 51/96 (53.12%), Query Frame = 1
Query:  244 YHPHQHQNPAPSVV-HVTKINYSSSKV----RCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            + P    +PAP VV  V  +  S S V    +C  C+ ++     Y +G  TWL+C  + +     CCLIPFC++  KD +++CP C H ++  +R
Sbjct:   41 FAPAVQSSPAPVVVTQVVMMPPSLSDVPGQTKCPHCQQQIITETRYVNGLLTWLICGGLGILLIWPCCLIPFCVSACKDVEHRCPNCKHVVFLYKR 136          
BLAST of LITAF domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-202h22.8 (si:ch211-202h22.8 [Source:ZFIN;Acc:ZDB-GENE-090313-78])

HSP 1 Score: 60.4622 bits (145), Expect = 1.524e-11
Identity = 32/96 (33.33%), Postives = 51/96 (53.12%), Query Frame = 1
Query:  244 YHPHQHQNPAPSVV-HVTKINYSSSKV----RCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            + P    +PAP VV  V  +  S S V    +C  C+ ++     Y +G  TWL+C  + +     CCLIPFC++  KD +++CP C H ++  +R
Sbjct:   41 FAPAVQSSPAPVVVTQVVMMPPSLSDVPGQTKCPHCQQQIITETRYVNGLLTWLICGGLGILLIWPCCLIPFCVSACKDVEHRCPNCKHVVFLYKR 136          
BLAST of LITAF domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000031517.1 (LITAF domain containing [Source:NCBI gene;Acc:100498168])

HSP 1 Score: 62.003 bits (149), Expect = 5.359e-12
Identity = 28/71 (39.44%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  307 SSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFA-PIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            + +   C  C   +   I Y  G  TWL+  I+F+F   +GCCLIPFC++  KD  + CP C+H LY+ +R
Sbjct:   70 TPASTTCPSCRQNIITNIHYNIGLLTWLLFGILFIFGCWLGCCLIPFCVDSCKDVDHYCPNCNHHLYKYKR 140          
BLAST of LITAF domain-containing protein vs. Ensembl Xenopus
Match: aff2 (AF4/FMR2 family member 2 [Source:Xenbase;Acc:XB-GENE-952102])

HSP 1 Score: 54.299 bits (129), Expect = 9.392e-9
Identity = 26/65 (40.00%), Postives = 33/65 (50.77%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIG-CCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C + +   + Y SG   WL C  + L   IG CCLIPFCI+  KD  + CP C   L   +R
Sbjct:  123 CRSCNSMITTRLEYSSGALAWLSCGGLCLLGCIGGCCLIPFCIDSLKDVDHYCPNCHALLGSYKR 187          
BLAST of LITAF domain-containing protein vs. Ensembl Xenopus
Match: pfkfb4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 [Source:Xenbase;Acc:XB-GENE-1001570])

HSP 1 Score: 50.447 bits (119), Expect = 1.660e-7
Identity = 22/69 (31.88%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  316 KVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAP--IGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
               C  C   +   + Y  G F+W++ F +F+F    +GCC+IPF ++  KD  + CP C++ L++ +R
Sbjct:  104 TATCPNCNQRIITRLQYSVGLFSWIL-FAVFMFFGCWLGCCIIPFVMDRCKDVDHYCPSCNYLLHKYKR 171          
BLAST of LITAF domain-containing protein vs. Ensembl Xenopus
Match: pfkfb4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 [Source:Xenbase;Acc:XB-GENE-1001570])

HSP 1 Score: 50.447 bits (119), Expect = 1.853e-7
Identity = 22/69 (31.88%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  316 KVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAP--IGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
               C  C   +   + Y  G F+W++ F +F+F    +GCC+IPF ++  KD  + CP C++ L++ +R
Sbjct:  104 TATCPNCNQRIITRLQYSVGLFSWIL-FAVFMFFGCWLGCCIIPFVMDRCKDVDHYCPSCNYLLHKYKR 171          
BLAST of LITAF domain-containing protein vs. Ensembl Xenopus
Match: pfkfb4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 [Source:Xenbase;Acc:XB-GENE-1001570])

HSP 1 Score: 50.447 bits (119), Expect = 1.870e-7
Identity = 22/69 (31.88%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  316 KVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAP--IGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
               C  C   +   + Y  G F+W++ F +F+F    +GCC+IPF ++  KD  + CP C++ L++ +R
Sbjct:  115 TATCPNCNQRIITRLQYSVGLFSWIL-FAVFMFFGCWLGCCIIPFVMDRCKDVDHYCPSCNYLLHKYKR 182          
BLAST of LITAF domain-containing protein vs. Ensembl Mouse
Match: Gm5767 (predicted gene 5767 [Source:MGI Symbol;Acc:MGI:3643507])

HSP 1 Score: 62.3882 bits (150), Expect = 7.917e-13
Identity = 27/65 (41.54%), Postives = 37/65 (56.92%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFAP-IGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C N +    +Y  G  TWL+C  +F+F   +GCCLIPFCI    D  + CP+C H++Y   R
Sbjct:   11 CPYCGNRIMTVTTYTPGLLTWLLCSGLFVFGCFLGCCLIPFCIRSTMDVTHSCPMCHHQIYYFHR 75          
BLAST of LITAF domain-containing protein vs. Ensembl Mouse
Match: Litaf (LPS-induced TN factor [Source:MGI Symbol;Acc:MGI:1929512])

HSP 1 Score: 53.5286 bits (127), Expect = 9.762e-9
Identity = 23/65 (35.38%), Postives = 33/65 (50.77%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFAPI-GCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C   +   +SY +G  TWL C  + L   + GCC IPFC++  +D  + CP C   L   +R
Sbjct:   96 CPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKR 160          
BLAST of LITAF domain-containing protein vs. Ensembl Mouse
Match: Litaf (LPS-induced TN factor [Source:MGI Symbol;Acc:MGI:1929512])

HSP 1 Score: 53.5286 bits (127), Expect = 9.762e-9
Identity = 23/65 (35.38%), Postives = 33/65 (50.77%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFAPI-GCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C   +   +SY +G  TWL C  + L   + GCC IPFC++  +D  + CP C   L   +R
Sbjct:   96 CPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKR 160          
BLAST of LITAF domain-containing protein vs. UniProt
Match: sp|A0A1B0GVX0|LITAD_HUMAN (LITAF domain-containing protein OS=Homo sapiens OX=9606 GN=LITAFD PE=5 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.251e-10
Identity = 24/65 (36.92%), Postives = 35/65 (53.85%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFA-PIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C N +    ++  G  TWL+C  +FLF   +GCC + FCI    D K+ CP+C  +L+   R
Sbjct:    7 CPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFYYHR 71          
BLAST of LITAF domain-containing protein vs. UniProt
Match: sp|Q8QGW7|LITAF_CHICK (Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Gallus gallus OX=9031 GN=LITAF PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 3.596e-10
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 1
Query:  316 KVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPI-GCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            ++ C  C   +   + Y+SG  TWL C  +FL   I GCCLIPFC++  KD ++ CP C+  +   +R
Sbjct:   80 QMSCPSCNQMIVTRLCYESGALTWLSCGGLFLLGCIAGCCLIPFCVDALKDVEHFCPNCNAHVGSYKR 147          
BLAST of LITAF domain-containing protein vs. UniProt
Match: sp|Q54HX8|CDIP1_DICDI (Cell death-inducing p53-target protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=litaf PE=3 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.863e-10
Identity = 27/65 (41.54%), Postives = 37/65 (56.92%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFA-PIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C+  +    SYKSG   WL+C ++ +F   +GCCLIPF I+  KD ++KC  C   LY   R
Sbjct:  113 CQHCQTRMSTKTSYKSGSMVWLVCVLLIIFGCWLGCCLIPFGIDSLKDVQHKCSHCKKVLYRFDR 177          
BLAST of LITAF domain-containing protein vs. UniProt
Match: sp|Q6GMG8|LITAF_DANRE (Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Danio rerio OX=7955 GN=litaf PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 2.868e-8
Identity = 27/68 (39.71%), Postives = 33/68 (48.53%), Query Frame = 1
Query:  316 KVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPI-GCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            +  C  C   V   + Y SG   WL C  + +F  I GCCLIPFCI   KD  + CP C   L   +R
Sbjct:   95 QAHCPVCSQSVITRLEYSSGPLVWLSCAGLAVFGCIYGCCLIPFCIEDLKDVTHHCPNCSSVLGVHKR 162          
BLAST of LITAF domain-containing protein vs. UniProt
Match: sp|Q6P828|LITAF_XENTR (Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Xenopus tropicalis OX=8364 GN=litaf PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.085e-8
Identity = 26/65 (40.00%), Postives = 33/65 (50.77%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIG-CCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C + +   + Y SG   WL C  + L   IG CCLIPFCI+  KD  + CP C   L   +R
Sbjct:   83 CRSCNSMITTRLEYSSGALAWLSCGGLCLLGCIGGCCLIPFCIDSLKDVDHYCPNCHALLGSYKR 147          
BLAST of LITAF domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|172931101 (tr|A0A444UBB6|A0A444UBB6_ACIRT Protein disulfide-isomerase OS=Acipenser ruthenus OX=7906 GN=EOD39_0209 PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.562e-15
Identity = 36/82 (43.90%), Postives = 47/82 (57.32%), Query Frame = 1
Query:  274 PSVVHVTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPI-GCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            P V+  T +  S    RC  C+ +V   + YK+GGF WLMCF+   F  I GCCLIPF  +GFKD  + CP C   L+  +R
Sbjct: 1012 PYVIINTNLGDSPCMTRCSNCQQQVQTKVEYKAGGFAWLMCFVFIFFGCILGCCLIPFFADGFKDAHHSCPNCHQNLHVHKR 1093          
BLAST of LITAF domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20711112 (tr|A0A504Z3M8|A0A504Z3M8_FASGI Lipopolysaccharide induced TNF alpha factor OS=Fasciola gigantica OX=46835 GN=FGIG_09588 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 7.363e-13
Identity = 35/86 (40.70%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  265 NPAPSV-VHVTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLF-APIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            N  PS  V +     S S V C  C  +V   +SY+ G  TWLMC +IF+    +GCCLIPFC +  +D  +KCP C   L   +R
Sbjct:    9 NQQPSAQVQMVSFGSSPSLVSCANCRRQVLTEVSYEKGALTWLMCVLIFVLGGALGCCLIPFCCSSCQDVNHKCPQCKFTLGTYKR 94          
BLAST of LITAF domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|175559252 (tr|A0A3B4YWR5|A0A3B4YWR5_SERLL Si:ch211-202h22.8 OS=Seriola lalandi dorsalis OX=1841481 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.311e-11
Identity = 27/70 (38.57%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  307 SSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            +  ++ C +C+N V   + YK+G  TWL+C ++ +F    CCLIPFC+N  KD  + CP+C++ L+  +R
Sbjct:   70 APGQMLCPRCQNTVLTKVEYKNGLLTWLICGLLGVFVIWPCCLIPFCVNSCKDVHHSCPVCNNVLHVHKR 139          
BLAST of LITAF domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|172259084 (tr|Q4RZX8|Q4RZX8_TETNG Chromosome 18 SCAF14786, whole genome shotgun sequence OS=Tetraodon nigroviridis OX=99883 GN=GSTENG00026286001 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.731e-11
Identity = 33/93 (35.48%), Postives = 52/93 (55.91%), Query Frame = 1
Query:  241 VYHPHQHQNPAPSVVH-VTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            +Y   QHQ   P ++  + ++  +  +V C +C+  V  AI YK G  TW +C  + +F    CCLIPFC+N  KD ++ CP+C   L+  +R
Sbjct:   75 MYAAQQHQVVQPVIITGMPQLRDTPGRVTCPQCQQSVVTAIEYKIGLLTWTICGAMAIFLIWPCCLIPFCVNPCKDVEHSCPVCKTVLHLYKR 167          
BLAST of LITAF domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|172264873 (tr|H3D994|H3D994_TETNG Si:ch211-202h22.8 OS=Tetraodon nigroviridis OX=99883 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.865e-11
Identity = 33/93 (35.48%), Postives = 52/93 (55.91%), Query Frame = 1
Query:  241 VYHPHQHQNPAPSVVH-VTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            +Y   QHQ   P ++  + ++  +  +V C +C+  V  AI YK G  TW +C  + +F    CCLIPFC+N  KD ++ CP+C   L+  +R
Sbjct:   71 MYAAQQHQVVQPVIITGMPQLRDTPGRVTCPQCQQSVVTAIEYKIGLLTWTICGAMAIFLIWPCCLIPFCVNPCKDVEHSCPVCKTVLHLYKR 163          
BLAST of LITAF domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-157c3.4 (lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog [Source:NCBI gene;Acc:103024010])

HSP 1 Score: 64.6994 bits (156), Expect = 3.864e-13
Identity = 32/82 (39.02%), Postives = 45/82 (54.88%), Query Frame = 1
Query:  280 VVHVTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFA-PIGCCLIPFCINGFKDEKYKCPICDHKLY-ELRRC 519
            V + +++  S     C  C  +V   ++YK G F WLMC +  L    IGCCLIPF +  FKD  + CP C+  L+ E +RC
Sbjct:   61 VSYDSELGRSPGTTTCTSCREQVLTNVTYKVGAFAWLMCILFILCGLVIGCCLIPFFVKYFKDAYHTCPRCNRILHVEKKRC 142          
BLAST of LITAF domain-containing protein vs. Ensembl Cavefish
Match: litaf (lipopolysaccharide-induced TNF factor [Source:NCBI gene;Acc:431731])

HSP 1 Score: 63.1586 bits (152), Expect = 1.670e-12
Identity = 29/73 (39.73%), Postives = 39/73 (53.42%), Query Frame = 1
Query:  301 NYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPI-GCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
             ++  +V C  C   V   + Y SG  TWL C  +F+F  I GCCLIPFC++  KD  + CP C   L   +R
Sbjct:   79 GHTPVQVHCPNCAQTVVTRLDYSSGTMTWLTCAGLFIFGCIYGCCLIPFCVDSLKDVTHHCPNCSSVLGVFKR 151          
BLAST of LITAF domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000041239.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:195968:202131:-1 gene:ENSAMXG00000040302.1 transcript:ENSAMXT00000041239.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 4.962e-7
Identity = 24/70 (34.29%), Postives = 35/70 (50.00%), Query Frame = 1
Query:  307 SSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            S  +V C  C +     + Y  G  T+L C  +  F  +GCCLIPFC++  +D K+ C  C   L   +R
Sbjct:   53 SPVQVTCPTCRHTAVTQVQYTPGLLTYLFCGGLLCF--LGCCLIPFCVDRLRDAKHVCSNCKAVLGVYKR 120          
BLAST of LITAF domain-containing protein vs. Ensembl Nematostella
Match: EDO33373 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF9])

HSP 1 Score: 60.4622 bits (145), Expect = 1.825e-12
Identity = 29/86 (33.72%), Postives = 42/86 (48.84%), Query Frame = 1
Query:  262 QNPAPSVVHVTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCF-IIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            Q PA  VV+      +   + C  C   +  A  Y +G  TWL CF +  +   +GCC IPFC++  KD  + CP C  ++   RR
Sbjct:   17 QQPATVVVNPIGFYETPVSMNCPTCHATIVTATDYVTGTLTWLACFGLCIIGCDLGCCFIPFCVDSMKDVVHTCPNCRSQVGVFRR 102          
BLAST of LITAF domain-containing protein vs. Ensembl Nematostella
Match: EDO37753 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SES1])

HSP 1 Score: 56.6102 bits (135), Expect = 2.532e-11
Identity = 27/65 (41.54%), Postives = 37/65 (56.92%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCF-IIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C+  +  A +Y+ G  TWL+   I  L   +GCCLIPFC++G KD  + CP C  +L   RR
Sbjct:    3 CSFCQTHIVTATTYRYGALTWLLSGGICLLGGWLGCCLIPFCLDGCKDVIHTCPNCQAQLGVYRR 67          
BLAST of LITAF domain-containing protein vs. Ensembl Nematostella
Match: EDO42963 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S062])

HSP 1 Score: 53.9138 bits (128), Expect = 6.298e-10
Identity = 30/94 (31.91%), Postives = 42/94 (44.68%), Query Frame = 1
Query:  250 PHQH-----QNPAPSVVHVTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            P QH     Q P   V        S + + C  C+  +  A SY  G   WL+C +IF F    CC +PF ++G KD  + CP C  ++    R
Sbjct:   12 PQQHTTVIQQQPTVVVTGGVSFGESPTSMVCPYCQATIVTATSYVPGTCAWLICLVIFCFF-WPCCFLPFVLDGCKDVVHSCPNCQRQVGVFTR 104          
BLAST of LITAF domain-containing protein vs. Ensembl Nematostella
Match: EDO37779 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW4])

HSP 1 Score: 48.1358 bits (113), Expect = 2.953e-7
Identity = 21/65 (32.31%), Postives = 34/65 (52.31%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFAPI-GCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C N +   + ++ G  T  +  ++F+   + GCCL+PF I G +D  + CP C   L + RR
Sbjct:   91 CGSCMNHMMTVVRFRIGRMTVAVSALVFMLGCVAGCCLVPFIIKGLRDVIHSCPNCQITLGKYRR 155          
BLAST of LITAF domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033265.1 (pep primary_assembly:ASM223467v1:8:8133676:8134078:-1 gene:ENSORLG00000030072.1 transcript:ENSORLT00000033265.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 2.773e-11
Identity = 31/84 (36.90%), Postives = 45/84 (53.57%), Query Frame = 1
Query:  271 APSVVHVT-KINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPI-GCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            APSV+  T K+    S+ +C +C+  V    S      TWL+C +  L   + GCCLIPFC N FK   ++CP C   +  L++
Sbjct:   18 APSVILDTDKLPPEPSRTQCPQCQQFVVTETSTSISSVTWLVCVMTALLGCVAGCCLIPFCSNKFKSITHRCPKCRTSIATLKK 101          
BLAST of LITAF domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000037533.1 (pep primary_assembly:ASM223467v1:1:23682164:23683902:-1 gene:ENSORLG00000026577.1 transcript:ENSORLT00000037533.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 3.086e-10
Identity = 27/80 (33.75%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  280 VVHVTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFA-PIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            +V V  +  +  ++ C KC   V   + + +G  T+L+C  +F     +GCCLIPFC++  KD K+ CP C   L   +R
Sbjct:   26 LVAVRPLGANPVQIACPKCHRTVLSKVDHSAGLLTYLLCGGLFFCGFVLGCCLIPFCVDRVKDAKHSCPSCKTILGVYKR 105          
BLAST of LITAF domain-containing protein vs. Ensembl Medaka
Match: si:ch211-202h22.9 (si:ch211-202h22.9 [Source:ZFIN;Acc:ZDB-GENE-030131-1143])

HSP 1 Score: 57.3806 bits (137), Expect = 3.882e-10
Identity = 25/68 (36.76%), Postives = 39/68 (57.35%), Query Frame = 1
Query:  313 SKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
             ++ C  C+N V     +K G  TWL+  ++ +     CCLIPFC+N  KD ++ CP C++ L+  RR
Sbjct:  120 GQMLCPHCQNTVVTKTEHKVGMQTWLIFGVLGIIGCWPCCLIPFCVNSCKDVQHSCPSCNNVLHVHRR 187          
BLAST of LITAF domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000034967.1 (pep primary_assembly:ASM223467v1:8:13374012:13375390:1 gene:ENSORLG00000029819.1 transcript:ENSORLT00000034967.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 7.307e-7
Identity = 22/64 (34.38%), Postives = 34/64 (53.12%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            C  C+  V    S++ G   W+ C  I L     C L+PFC++  KD K+ CP C++ L+  R+
Sbjct:   49 CVYCQKNVLTRTSFEIGAMAWVFCGGITLLGCWPCMLLPFCLDSCKDVKHYCPSCNNLLHFYRK 112          
BLAST of LITAF domain-containing protein vs. Ensembl Medaka
Match: si:ch211-157c3.4 (lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog [Source:NCBI gene;Acc:101165558])

HSP 1 Score: 46.595 bits (109), Expect = 1.688e-6
Identity = 28/74 (37.84%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  298 INYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFII-FLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRR 516
            +  S     C KCE +V   + YK+G + WLMC +       + CCLIPF +N FKD  + CP C HK+  + +
Sbjct:   77 LGRSPGMTNCPKCERQVETVVDYKAGTYAWLMCLLFICCGLILLCCLIPFFMNSFKDVYHSCPNC-HKILHIEK 149          
BLAST of LITAF domain-containing protein vs. Planmine SMEST
Match: SMESG000020865.1 (SMESG000020865.1)

HSP 1 Score: 228.409 bits (581), Expect = 2.532e-77
Identity = 137/139 (98.56%), Postives = 137/139 (98.56%), Query Frame = 1
Query:  103 MDKQIHDNXXXXXXXXXXXXGFVVNQQYPAHQVTXXXXXXXXXXXXVYHPHQHQNPAPSVVHVTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRRC 519
            MDKQIHDNPPPPAYNQPPPPGFVVNQQY AHQVTAQPYPPYPANPQVYHPHQHQNPAPSVVHVTKINY SSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRRC
Sbjct:    1 MDKQIHDNPPPPAYNQPPPPGFVVNQQYLAHQVTAQPYPPYPANPQVYHPHQHQNPAPSVVHVTKINYGSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRRC 139          
BLAST of LITAF domain-containing protein vs. Planmine SMEST
Match: SMESG000020869.1 (SMESG000020869.1)

HSP 1 Score: 71.2478 bits (173), Expect = 6.387e-16
Identity = 53/142 (37.32%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  121 DNXXXXXXXXXXXXGFVVNQQYPAHQVTXXXXXXXXXXXXVYHPHQHQNP---------APSVVHVTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRRC 519
            DN        PPP GF  NQ + + Q           + QV +PH HQ             +   V  I     K +CDKCENEV P + YK G FTW MC ++F         +PF  N +KD  +KCP+CDH LY  RRC
Sbjct:    2 DNKDTSNPPPPPPLGFATNQHFISEQ-----SQYQSHSVQVVYPHVHQQQLILGRNQMIVTNQGVVANIGLVYLKTKCDKCENEVIPKLKYKIGSFTWCMC-VVFFLIFPILFFLPFISNNYKDIYHKCPVCDHTLYVTRRC 137          
BLAST of LITAF domain-containing protein vs. Planmine SMEST
Match: SMESG000033033.1 (SMESG000033033.1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.771e-15
Identity = 31/77 (40.26%), Postives = 41/77 (53.25%), Query Frame = 1
Query:  289 VTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRRC 519
            +         + C KC  E+   + +K G  TWL CF I +F P+GCCLIPFC+   KD  + CP CD  L   +RC
Sbjct:   17 IIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKRC 93          
BLAST of LITAF domain-containing protein vs. Planmine SMEST
Match: SMESG000020864.1 (SMESG000020864.1)

HSP 1 Score: 61.6178 bits (148), Expect = 3.542e-12
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = 1
Query:  325 CDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYE 507
            C  C   +  A+++K G FT L C ++ +  P GCCL PFC+ GFKD  + CP C   ++E
Sbjct:   74 CPNCNEYIMTAVAHKIGRFTCLSCLVLGVLLPYGCCLAPFCLEGFKDAIHSCPKCKKVIFE 134          
BLAST of LITAF domain-containing protein vs. Planmine SMEST
Match: SMESG000020870.1 (SMESG000020870.1)

HSP 1 Score: 60.077 bits (144), Expect = 1.660e-11
Identity = 33/85 (38.82%), Postives = 50/85 (58.82%), Query Frame = 1
Query:  247 HPHQHQNPAPSVVHVTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKL 501
            +P  +  PA     + +   ++    C +C + V   + Y+ G FT  +CFIIF+FAP+GCCLIPFC+N  K+  Y+CP C H +
Sbjct:   60 YPMAYNPPANHTTVIIQSAAANGSTECQRCHSHVISDVEYRCGCFTVFICFIIFIFAPLGCCLIPFCVNSCKNTHYRCPNCGHTI 144          
The following BLAST results are available for this feature:
BLAST of LITAF domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LITAFD2.604e-1136.92LITAF domain containing [Source:HGNC Symbol;Acc:HG... [more]
LITAFD2.604e-1136.92LITAF domain containing [Source:HGNC Symbol;Acc:HG... [more]
LITAF1.511e-836.92lipopolysaccharide induced TNF factor [Source:HGNC... [more]
LITAF1.511e-836.92lipopolysaccharide induced TNF factor [Source:HGNC... [more]
LITAF1.511e-836.92lipopolysaccharide induced TNF factor [Source:HGNC... [more]
back to top
BLAST of LITAF domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
F36G3.32.144e-727.06pep chromosome:WBcel235:X:9798839:9801038:1 gene:W... [more]
Y37D8A.64.497e-731.82pep chromosome:WBcel235:III:12856833:12857911:-1 g... [more]
back to top
BLAST of LITAF domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG322802.799e-635.14gene:FBgn0052280 transcript:FBtr0073031[more]
CG322802.799e-635.14gene:FBgn0052280 transcript:FBtr0073030[more]
CG322802.799e-635.14gene:FBgn0052280 transcript:FBtr0344220[more]
CG322802.799e-635.14gene:FBgn0052280 transcript:FBtr0073032[more]
back to top
BLAST of LITAF domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-157c3.48.585e-1243.28si:ch211-157c3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
si:ch211-157c3.48.585e-1243.28si:ch211-157c3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
si:ch211-157c3.48.585e-1243.28si:ch211-157c3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
si:ch211-202h22.81.524e-1133.33si:ch211-202h22.8 [Source:ZFIN;Acc:ZDB-GENE-090313... [more]
si:ch211-202h22.81.524e-1133.33si:ch211-202h22.8 [Source:ZFIN;Acc:ZDB-GENE-090313... [more]
back to top
BLAST of LITAF domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000031517.15.359e-1239.44LITAF domain containing [Source:NCBI gene;Acc:1004... [more]
aff29.392e-940.00AF4/FMR2 family member 2 [Source:Xenbase;Acc:XB-GE... [more]
pfkfb41.660e-731.886-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
pfkfb41.853e-731.886-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
pfkfb41.870e-731.886-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
back to top
BLAST of LITAF domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Gm57677.917e-1341.54predicted gene 5767 [Source:MGI Symbol;Acc:MGI:364... [more]
Litaf9.762e-935.38LPS-induced TN factor [Source:MGI Symbol;Acc:MGI:1... [more]
Litaf9.762e-935.38LPS-induced TN factor [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of LITAF domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0A1B0GVX0|LITAD_HUMAN1.251e-1036.92LITAF domain-containing protein OS=Homo sapiens OX... [more]
sp|Q8QGW7|LITAF_CHICK3.596e-1038.24Lipopolysaccharide-induced tumor necrosis factor-a... [more]
sp|Q54HX8|CDIP1_DICDI4.863e-1041.54Cell death-inducing p53-target protein 1 homolog O... [more]
sp|Q6GMG8|LITAF_DANRE2.868e-839.71Lipopolysaccharide-induced tumor necrosis factor-a... [more]
sp|Q6P828|LITAF_XENTR3.085e-840.00Lipopolysaccharide-induced tumor necrosis factor-a... [more]
back to top
BLAST of LITAF domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|1729311012.562e-1543.90tr|A0A444UBB6|A0A444UBB6_ACIRT Protein disulfide-i... [more]
gnl|BL_ORD_ID|207111127.363e-1340.70tr|A0A504Z3M8|A0A504Z3M8_FASGI Lipopolysaccharide ... [more]
gnl|BL_ORD_ID|1755592521.311e-1138.57tr|A0A3B4YWR5|A0A3B4YWR5_SERLL Si:ch211-202h22.8 O... [more]
gnl|BL_ORD_ID|1722590841.731e-1135.48tr|Q4RZX8|Q4RZX8_TETNG Chromosome 18 SCAF14786, wh... [more]
gnl|BL_ORD_ID|1722648731.865e-1135.48tr|H3D994|H3D994_TETNG Si:ch211-202h22.8 OS=Tetrao... [more]
back to top
BLAST of LITAF domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-157c3.43.864e-1339.02lipopolysaccharide-induced tumor necrosis factor-a... [more]
litaf1.670e-1239.73lipopolysaccharide-induced TNF factor [Source:NCBI... [more]
ENSAMXT00000041239.14.962e-734.29pep primary_assembly:Astyanax_mexicanus-2.0:12:195... [more]
back to top
BLAST of LITAF domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LITAF domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LITAF domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO333731.825e-1233.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377532.532e-1141.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429636.298e-1031.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377792.953e-732.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LITAF domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033265.12.773e-1136.90pep primary_assembly:ASM223467v1:8:8133676:8134078... [more]
ENSORLT00000037533.13.086e-1033.75pep primary_assembly:ASM223467v1:1:23682164:236839... [more]
si:ch211-202h22.93.882e-1036.76si:ch211-202h22.9 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
ENSORLT00000034967.17.307e-734.38pep primary_assembly:ASM223467v1:8:13374012:133753... [more]
si:ch211-157c3.41.688e-637.84lipopolysaccharide-induced tumor necrosis factor-a... [more]
back to top
BLAST of LITAF domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020865.12.532e-7798.56SMESG000020865.1[more]
SMESG000020869.16.387e-1637.32SMESG000020869.1[more]
SMESG000033033.16.771e-1540.26SMESG000033033.1[more]
SMESG000020864.13.542e-1240.98SMESG000020864.1[more]
SMESG000020870.11.660e-1138.82SMESG000020870.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029006 ID=SMED30029006|Name=LITAF domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=598bp
CAGTAATTGCATCTTTCACATAGTTTTGCATCTTTTCATAGTGAAATACT
TAAAAATTCATAAATCACTTTTTTCAATTAATCAAATTTTAAATTAGCTG
AAATGGATAAACAGATTCACGATAATCCTCCTCCTCCTGCGTATAATCAA
CCCCCACCTCCCGGATTTGTAGTCAATCAGCAATATCCCGCTCATCAGGT
AACCGCTCAACCATATCCGCCATATCCAGCAAATCCACAAGTTTATCATC
CACATCAACATCAAAATCCAGCACCTTCAGTCGTCCATGTTACGAAGATT
AATTATAGCTCGTCAAAGGTGAGATGCGATAAATGTGAAAACGAAGTTTT
CCCGGCGATTTCGTACAAGTCTGGAGGGTTTACATGGTTGATGTGCTTTA
TTATTTTCTTATTTGCCCCAATTGGATGTTGTTTAATACCATTTTGCATA
AATGGATTCAAAGATGAAAAGTACAAATGCCCGATATGTGACCACAAGCT
CTATGAGTTACGCAGATGTTGATGCTTCATTAAACAAAAACTTATACAAA
CAAAAATTATTCTGAACCGTTTGTTTTAATTCAATTTTTAAATATAAG
back to top

protein sequence of SMED30029006-orf-1

>SMED30029006-orf-1 ID=SMED30029006-orf-1|Name=SMED30029006-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MDKQIHDNPPPPAYNQPPPPGFVVNQQYPAHQVTAQPYPPYPANPQVYHP
HQHQNPAPSVVHVTKINYSSSKVRCDKCENEVFPAISYKSGGFTWLMCFI
IFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRRC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037519LITAF_fam
IPR006629LITAF
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006629LPS-induced tumour necrosis factor alpha factorSMARTSM00714litafcoord: 70..138
e-value: 3.1E-17
score: 73.3
IPR006629LPS-induced tumour necrosis factor alpha factorPFAMPF10601zf-LITAF-likecoord: 70..134
e-value: 8.6E-19
score: 67.6
IPR006629LPS-induced tumour necrosis factor alpha factorPROSITEPS51837LITAFcoord: 55..138
score: 15.496
IPR037519LITAF domain containing proteinPANTHERPTHR23292LIPOPOLYSACCHARIDE-INDUCED TRANSCRIPTION FACTOR REGULATING TUMOR NECROSIS FACTOR ALPHAcoord: 9..138
NoneNo IPR availableTMHMMTMhelixcoord: 93..115