Proton myo-inositol cotransporter

Overview
NameProton myo-inositol cotransporter
Smed IDSMED30029002
Length (bp)1705
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Proton myo-inositol cotransporter (SMED30029002) t-SNE clustered cells

Violin plots show distribution of expression levels for Proton myo-inositol cotransporter (SMED30029002) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Proton myo-inositol cotransporter (SMED30029002) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Proton myo-inositol cotransporter (SMED30029002) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029002

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30029002SMESG000056326.1 SMESG000056325.1 SmedASXL_017015SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30029002SMESG000056331.1 dd_Smed_v4_3112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Proton myo-inositol cotransporter vs. Ensembl Human
Match: SLC2A13 (solute carrier family 2 member 13 [Source:HGNC Symbol;Acc:HGNC:15956])

HSP 1 Score: 225.328 bits (573), Expect = 6.355e-65
Identity = 168/552 (30.43%), Postives = 272/552 (49.28%), Query Frame = 1
Query:  124 AVHLNHQQLKNKIEVYFTRQYIHHIIFPMIGGFMFGHVTGSVSIN--------KTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLV-GIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKA--SICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA--------VNLQLVYVRRLKRNQNNNCSNFLSCDDC-LNNICEYC-QIDENS--GYTCVNYGANCTNKGNYS---------------IYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            A     QQ +    VY         +F  +GGF+FG+ TG VS            + L+  L +   +  A  ++L  G+L   FGR+  I+++      GS +  +       +   LV G+GIG+     P+YIAE++P  +RGR++T+  + IT G   AS+V    S  +KD  +  +L    +PA+I   G L + ES RWL+ K +  +A+ ++ +++  Q  +I+E    I       E+E      ++ R+L     R++L+ GC +Q+  Q++GIN I+Y S  + Q         A+W  S+  F NFI + V   L++K+GRRKL   SL G   +L+I+A        V+ ++ +       QN  C+ +  C++C L+  C +C ++++++    +CV      TN+  +                 YNF   C    +W  LLG+ILY++ FA GMGP+PW V SEIYP W RST  A S+G  W+ N + +L F +      +Y  F++Y  F   G+  IY   PET    LE++ 
Sbjct:   67 AARRQFQQDETPAFVYVV------AVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQELLVSSTVGAAAVSALAGGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKD-GWRYMLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQ--TIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKTEDIFWAYNF---CPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIE 606          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Human
Match: SLC2A12 (solute carrier family 2 member 12 [Source:HGNC Symbol;Acc:HGNC:18067])

HSP 1 Score: 129.028 bits (323), Expect = 5.568e-31
Identity = 132/502 (26.29%), Postives = 229/502 (45.62%), Query Frame = 1
Query:  298 LILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGV------ICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICR--KDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLV---IIAVNLQLVYVRRLKRNQNNNCS--------------NFLSCDDCLNNICEYCQ---------ID---ENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPET-----NQIDLE--KMNYV 1671
            L++GAL ASL  G L+DR+GR+  II+S     +GSL+ +   ++  Y   ++  I IGV      I TC  +YIAE+ P+  RG +++L ++ I  GIL A I   +         Y+  L  PL   ++  I M  +  S R+L+ K ++  A +V+ +L+ L +++ EE   I       +++E     + LFR   N   R  ++ G  +    QI G   IL+ +  + +     S E A    + +     I +  A  L+D +G +    I    +  SLV   I+ +N+ + +    + + + N S              N  +  D    I  + +         +D   E +  + +N G + T    Y I         ++ W+ L  +++YV +F+IG+GP+PW+V SEI+P   R   MAL++   W  N + +L F  +        + +IY   ++  +  +  + PET      QI +E  K+NYV
Sbjct:   86 LVIGALLASLTGGVLIDRYGRRTAIILSSCLLGLGSLVLI---LSLSYTVLIVGRIAIGVSISLSSIATC--VYIAEIAPQHRRGLLVSLNELMIVIGILSAYISNYAFANVFHGWKYMFGLVIPL--GVLQAIAMYFLPPSPRFLVMKGQEGAASKVLGRLRALSDTT-EELTVI----KSSLKDEYQYSFWDLFRSKDN--MRTRIMIGLTLVFFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATLLVDHVGSKTFLCIGSSVMAASLVTMGIVNLNIHMNFTHICRSHNSINQSLDESVIYGPGNLSTNNNTLRDHFKGISSHSRSSLMPLRNDVDKRGETTSASLLNAGLSHT---EYQIVTDPGDVPAFLKWLSLASLLVYVAAFSIGLGPMPWLVLSEIFPGGIRGRAMALTSSMNWGINLLISLTFLTVTDLIGLPWVCFIYTIMSLASLLFVVMFIPETKGCSLEQISMELAKVNYV 570          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Human
Match: SLC2A14 (solute carrier family 2 member 14 [Source:HGNC Symbol;Acc:HGNC:18301])

HSP 1 Score: 105.531 bits (262), Expect = 1.575e-23
Identity = 129/526 (24.52%), Postives = 223/526 (42.40%), Query Frame = 1
Query:  175 TRQYIHHIIFPMIGGFMFGHVTGSVS---------INKT-NDL------------FFYLNLPILILGALFASLLTGSLVDRFGRK-KMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCC----PLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKAS-ICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDE-AKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            T   I  I    IG F FG+ TG ++         INKT  D              + L++ I  +G +  S   G  V+RFGR+  M+I++ +    G L+ L   IA      +L  + IG+ C  C    P+YI E++P  +RG   TL Q+ I  GIL+A I     I   ++ +  +L   ++PAI+    +    ES R+LL   +K+E A  ++++L   Q+ S +     I E        + +K+  +  + R    R+ ++    +Q+  Q++GINA+ Y S  +F+   +   +  ++        N I + ++  L+++ GRR L +I L G+ F   ++ V+L       L +N  N  S                       + C+                                ++++V  F IG GPIPW + +E++    R   MA++  + W  NF+  L+F +  +    Y +F I+  F I  +A  +   PET     E + 
Sbjct:    8 TPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCK-IAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD-----IQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFK---DAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSL-------LLKNHYNGMS-----------------------FVCIG------------------------------AILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAY-VFIIFTGFLITFLAFTFFKVPETRGRTFEDIT 463          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Human
Match: SLC2A14 (solute carrier family 2 member 14 [Source:HGNC Symbol;Acc:HGNC:18301])

HSP 1 Score: 105.531 bits (262), Expect = 1.575e-23
Identity = 129/526 (24.52%), Postives = 223/526 (42.40%), Query Frame = 1
Query:  175 TRQYIHHIIFPMIGGFMFGHVTGSVS---------INKT-NDL------------FFYLNLPILILGALFASLLTGSLVDRFGRK-KMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCC----PLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKAS-ICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDE-AKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            T   I  I    IG F FG+ TG ++         INKT  D              + L++ I  +G +  S   G  V+RFGR+  M+I++ +    G L+ L   IA      +L  + IG+ C  C    P+YI E++P  +RG   TL Q+ I  GIL+A I     I   ++ +  +L   ++PAI+    +    ES R+LL   +K+E A  ++++L   Q+ S +     I E        + +K+  +  + R    R+ ++    +Q+  Q++GINA+ Y S  +F+   +   +  ++        N I + ++  L+++ GRR L +I L G+ F   ++ V+L       L +N  N  S                       + C+                                ++++V  F IG GPIPW + +E++    R   MA++  + W  NF+  L+F +  +    Y +F I+  F I  +A  +   PET     E + 
Sbjct:    8 TPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCK-IAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD-----IQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFK---DAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSL-------LLKNHYNGMS-----------------------FVCIG------------------------------AILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAY-VFIIFTGFLITFLAFTFFKVPETRGRTFEDIT 463          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Human
Match: SLC2A14 (solute carrier family 2 member 14 [Source:HGNC Symbol;Acc:HGNC:18301])

HSP 1 Score: 105.145 bits (261), Expect = 2.867e-23
Identity = 129/526 (24.52%), Postives = 223/526 (42.40%), Query Frame = 1
Query:  175 TRQYIHHIIFPMIGGFMFGHVTGSVS---------INKT-NDL------------FFYLNLPILILGALFASLLTGSLVDRFGRK-KMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCC----PLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKAS-ICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDE-AKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            T   I  I    IG F FG+ TG ++         INKT  D              + L++ I  +G +  S   G  V+RFGR+  M+I++ +    G L+ L   IA      +L  + IG+ C  C    P+YI E++P  +RG   TL Q+ I  GIL+A I     I   ++ +  +L   ++PAI+    +    ES R+LL   +K+E A  ++++L   Q+ S +     I E        + +K+  +  + R    R+ ++    +Q+  Q++GINA+ Y S  +F+   +   +  ++        N I + ++  L+++ GRR L +I L G+ F   ++ V+L       L +N  N  S                       + C+                                ++++V  F IG GPIPW + +E++    R   MA++  + W  NF+  L+F +  +    Y +F I+  F I  +A  +   PET     E + 
Sbjct:   46 TPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCK-IAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD-----IQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFK---DAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSL-------LLKNHYNGMS-----------------------FVCIG------------------------------AILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAY-VFIIFTGFLITFLAFTFFKVPETRGRTFEDIT 501          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Celegans
Match: hmit-1.3 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q21455])

HSP 1 Score: 185.267 bits (469), Expect = 5.967e-51
Identity = 144/534 (26.97%), Postives = 262/534 (49.06%), Query Frame = 1
Query:  208 MIGGFMFGHVTGSVS-----------INKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGI-APKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYIT---VLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKII---LEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKR-NQNN-------------NCSNFLSCDDCLNNI-CEYCQI-------------DENSGYTCVN--YGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            +IGGF+FG+ TG VS           I   + ++  + + I    A   SL +G   D  GRKK+II + V   IG++I  +        I  +L+G+ IG      P+Y++E +P  IRG+++T +Q+ IT G+++A+I+  +    D   +    +     +PAII  +  L + ES RWL    R  EA+EV+ ++       ++  +  I    E  +  + E++     + RIL+    RK+++ G  +Q+  Q++GIN ++Y +  + +        T +W        NF+ +F+   L++++GRR L L+S+ G+I  L+ + V+  L+    L+  +Q N              C  + +CD C+ +  C +C+              D++S Y+       +N TN G    +  D  C      + ++ M+ Y++SF+ G  P+PWV+ +E YP W RST +++ST   W+ N I +L F ++  +   Y  F+IYC  T+  +  ++ + PET    ++++ 
Sbjct:   36 VIGGFLFGYDTGIVSAAMLYVPNASGIKPLDSVWQEIIVSITPGVAAIGSLCSGPGSDFLGRKKIIIGASVTFTIGAIICAAAWTKIILLIGRILLGLAIGFASMIVPIYVSEASPSHIRGKLVTGFQLMITVGLVIANIIGGAFSYVDPDQVGWRLMFAFAAVPAIIQFVCFLFLPESPRWLYEHGRTVEAREVLTRIYNGHTEWVDYEINEISFSYEEELRAKAEHAGNGPTIIRILKTPHVRKAMIIGSLLQMFQQLSGINTVMYYTGNIIRSAGVKDNHTTIWISVGTSAINFLGTFIPIALVERVGRRVLLLVSMIGVILFLIAMGVSFLLINNDSLRTFDQQNYTLNYNPSVKHAAKCLKYSNCDFCVTDENCGFCESKVAKKGYCLPFPSDDSSDYSATGICEFSNLTNNGTDFEWE-DTYCHTKFTVLPIIIMVFYLLSFSAGYAPLPWVLNAEFYPLWARSTAVSVSTACNWIFNLIVSLTFLSLSQAATKYGTFFIYCGCTMVALVFVFFFVPETKGYSIDEVE 568          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Celegans
Match: hmit-1.3 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q21455])

HSP 1 Score: 185.267 bits (469), Expect = 5.967e-51
Identity = 144/534 (26.97%), Postives = 262/534 (49.06%), Query Frame = 1
Query:  208 MIGGFMFGHVTGSVS-----------INKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGI-APKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYIT---VLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKII---LEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKR-NQNN-------------NCSNFLSCDDCLNNI-CEYCQI-------------DENSGYTCVN--YGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            +IGGF+FG+ TG VS           I   + ++  + + I    A   SL +G   D  GRKK+II + V   IG++I  +        I  +L+G+ IG      P+Y++E +P  IRG+++T +Q+ IT G+++A+I+  +    D   +    +     +PAII  +  L + ES RWL    R  EA+EV+ ++       ++  +  I    E  +  + E++     + RIL+    RK+++ G  +Q+  Q++GIN ++Y +  + +        T +W        NF+ +F+   L++++GRR L L+S+ G+I  L+ + V+  L+    L+  +Q N              C  + +CD C+ +  C +C+              D++S Y+       +N TN G    +  D  C      + ++ M+ Y++SF+ G  P+PWV+ +E YP W RST +++ST   W+ N I +L F ++  +   Y  F+IYC  T+  +  ++ + PET    ++++ 
Sbjct:   36 VIGGFLFGYDTGIVSAAMLYVPNASGIKPLDSVWQEIIVSITPGVAAIGSLCSGPGSDFLGRKKIIIGASVTFTIGAIICAAAWTKIILLIGRILLGLAIGFASMIVPIYVSEASPSHIRGKLVTGFQLMITVGLVIANIIGGAFSYVDPDQVGWRLMFAFAAVPAIIQFVCFLFLPESPRWLYEHGRTVEAREVLTRIYNGHTEWVDYEINEISFSYEEELRAKAEHAGNGPTIIRILKTPHVRKAMIIGSLLQMFQQLSGINTVMYYTGNIIRSAGVKDNHTTIWISVGTSAINFLGTFIPIALVERVGRRVLLLVSMIGVILFLIAMGVSFLLINNDSLRTFDQQNYTLNYNPSVKHAAKCLKYSNCDFCVTDENCGFCESKVAKKGYCLPFPSDDSSDYSATGICEFSNLTNNGTDFEWE-DTYCHTKFTVLPIIIMVFYLLSFSAGYAPLPWVLNAEFYPLWARSTAVSVSTACNWIFNLIVSLTFLSLSQAATKYGTFFIYCGCTMVALVFVFFFVPETKGYSIDEVE 568          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Celegans
Match: hmit-1.1 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q9XXR3])

HSP 1 Score: 166.392 bits (420), Expect = 2.892e-44
Identity = 149/534 (27.90%), Postives = 243/534 (45.51%), Query Frame = 1
Query:  208 MIGGFMFGHVTGSVSIN----------KTNDLFFYLNLPILILG-ALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLI-TLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDK---SYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRF---MLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV---YVRRLKRNQ-----------NNNCSNFLSCDDCLN-NICEYCQIDENS--GYTCVNYG----------ANCTNKGNYSIYNFDNP---CTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            +IGGF+FG+ T  VS            K  D  +   L  +  G A   SL++G+  D  GR+K+I+ +     IG+L+   S       +  VL+GI IG      P+Y+ E  P  +RG ++  + + I+FG ++A+I   +    D     +  +     +P+II  +  + + E+ RWL     + E +EV+ K+    +  +E  +  I+  N    +EN +      +++RIL+     K+   G  +Q   Q+AGIN ILY +  + +     +  T +W   L+   NFI  FV   LI+K+GRR + L S   ++ SLV I V   LV       L  NQ              C  + +CD C+  + C +C  D N+  GY C+  G           +CTN       NF      C      + ++   +Y+++F+ G   +PWV+ SE YP W RST +A+ST + W+ N I  L + ++      Y  FW+Y   T+     I    PET    +E++ 
Sbjct:   33 VIGGFLFGYDTSVVSAAMLYMPDAPGLKPMDTVWQEVLVSISPGMAAVGSLMSGTSSDYIGRRKVILGASAIFTIGALVCAASVNKIMLLVGRVLLGIAIGFASMIVPVYLGETAPTHVRGMLVAAFALMISFGQVVANITGGAFSYIDPYNVGWRLMFAFAAVPSIIQFVCFMFLPETPRWLYENGFETETREVLEKVYNGDKEWVEYEMAEIIAFNEDQAKENEKAHASGPVIWRILKTPHVLKACFIGSMLQAFQQLAGINTILYYTADIIRSSGISNNHTTIWISVLLSLCNFIGPFVPMSLIEKVGRRIIFLFSCGLVVLSLVFIGVAFLLVNHDSAATLPANQYGSNFNSSYPDAKGCMAYSNCDYCVTTDACGFCH-DANTKQGY-CLPAGFDNPEVYSSTGSCTNSNGSIANNFKWEKYYCDTKYTLLPIIACGVYLLTFSSGFTSLPWVLNSEFYPMWARSTCVAISTTSNWVFNLIIALTYLSLTQVIGKYGAFWLYAGLTVIAFIFILFLVPETKGYSIEEVE 564          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Celegans
Match: hmit-1.2 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q9XXQ9])

HSP 1 Score: 162.925 bits (411), Expect = 5.508e-43
Identity = 147/539 (27.27%), Postives = 252/539 (46.75%), Query Frame = 1
Query:  208 MIGGFMFGHVTGSVS-----------INKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLI-TLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYIT---VLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIE---EFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-------YVRR---LKRNQNNN-----CSNFLSCDDCL-NNICEYCQIDENSGYTCVNYGAN----------CTNKGNYSIYNFDNP---------CTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            +IGGF+FG+ T  VS           +     ++  + + I    A   +  +G+  DR+GRK +II S +  + G++I  ++       I  + +G+GIG      P+Y+ E +P  +RG +++ + + I+FG ++A+I+       +   I    +     IPA+I  +  + + E+ RWL      ++A++V+ K+       IE     +K   E      EE  +   +++RIL+     K+   G  +Q   Q+AGIN ILY +  + +     +Y T +W   ++   N I  F     I+K+GRRKL L S  G++ SLV+I V+  LV       + R    L  N  +N     C    +CD C+ +  C +C+  E     C+    N          CTN  + S  +F N          CT     + ++ M +Y+++F+ G   +PWV+ SE YP W RST +++ST + W+ N I  L + ++  +   Y  FW+Y  FTI     IY   PET    ++++ 
Sbjct:   34 IIGGFLFGYDTSVVSAAMLYVPEAPGLKPMGTVWKEVIVSITPGMAAVGAWFSGAGSDRYGRKPIIIGSTLIFVCGAVICAVAWTKIVMLIGRIFLGVGIGFASMVVPVYLGEASPTHVRGTLVSAFAMMISFGQVVANIMGGVFSYWEPYTIGWRLMFAFAGIPALIQFVCFIFLPETPRWLYENGHTEQAEQVLEKIYGGNTEWIEYELAEIKTYAEERQKQMEEEKKSGPVIWRILKTPHVLKACFIGSMLQAFQQLAGINTILYYTADIIRSAGIENYHTIIWISVILSICNLIGPFAPMFFIEKLGRRKLFLFSCAGVVVSLVLIGVSFLLVGNDSAPNFDRSAYLLAGNYQSNGEAESCLMLSNCDSCVTSEHCGFCEDSETRTGFCLPVDHNDVTLYSSTGLCTNGLDKSNSSFPNATSYVWQKHHCTTSYTILPIVMMGVYLLTFSCGFTSLPWVLNSEFYPMWARSTCVSISTLSNWVFNLIIALTYLSLTHAITKYGAFWLYAIFTIIAFIFIYFLVPETTGYSIDEVE 572          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Celegans
Match: R09B5.11 (Facilitated glucose transporter homolog [Source:UniProtKB/Swiss-Prot;Acc:O44616])

HSP 1 Score: 91.6633 bits (226), Expect = 2.284e-19
Identity = 96/443 (21.67%), Postives = 188/443 (42.44%), Query Frame = 1
Query:  241 GSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKY----ITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVK-ASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTK-NRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLID--KIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNI 1545
            G V      D  + + + +  +G +F S  +G L D+FGRK  ++ + +  ++ ++   +  +   Y        LVG+  G+     P+++ E+ P  +RG+  + +Q++I+  I+L+  +    I      +  +     IP  + L  +    ES ++L++K N ++EA+ ++ KL+   +   EE   ++ E  + +E  +      LF+       +  ++    +    Q +GI+A+ + S L+F+  N +S    ++          I +F    LID  K GR++L +  L G+  S ++I + L L                                   N+GY                         +Y+N + +L    +V++FA G GPIPW  TSE++ +  R    A+S  + W+ N++  L F  I
Sbjct:   88 GEVLSQYQADFIWSVAVSMFSVGGMFGSFCSGFLADKFGRKSTLLYNNILALLAAVCLSTSKLFNFYPMIVFGRFLVGLNCGITSGLVPMFLTELAPANLRGKCGSFHQLNISVAIVLSQALGLPQIFGTQVGWPYIFACVAIPTFLQLATIPFCVESPKYLISKLNDREEARRILEKLRGHTKVD-EELEHMVQETMVTVEPLHQPGYVSLFK----GDNQWPMIVSILMMFSQQFSGISAVTFYSTLIFKR-NGLSGNEPMYATVGFGCIKLIATFGCLFLIDHPKFGRKRLHIAGLSGMCISSILIVITLTL----------------------------------SNAGYHWA----------------------SYMNVLFILS---FVVTFAFGPGPIPWFFTSELFDSATRGRAAAVSATSNWVANWMVGLTFLPI 465          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333500)

HSP 1 Score: 110.923 bits (276), Expect = 2.468e-25
Identity = 109/456 (23.90%), Postives = 210/456 (46.05%), Query Frame = 1
Query:  340 LVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKY----ITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVK-ASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLL-TKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFS---------RIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKM 1662
            + +RFGRK  ++++ V  I G+ +     ++  Y    +   ++G+  G+  +  P+YI+E+ P  +RG + T+ Q+++T G+LL+ ++    I   ++ +  +L   + PAI+ LI +    ES R+LL TK  ++EA++ +R+L+     S+EE ++   E       + S+       ++ +   R  L+ G  +Q+  Q +GINA+ Y S  LF   + ++ E+A +    I     + + V+  L+D+ GRR L L  L G+    + I ++                   FL              I E  GY                         ++++++ ++  + +V+ FA+G G IPW++T+E++    R + MA++    W+ NF+  + F ++  +          +F AIFWI+           YK  PET     E++
Sbjct:  143 MANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRA--SGSVEEDIE---EMRAEERAQQSESHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMS-SGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITIS-------------------FL--------------IKEFFGYV--------------------QEMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFT----------YKKVPETKNKTFEEI 529          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333499)

HSP 1 Score: 109.768 bits (273), Expect = 3.111e-25
Identity = 109/456 (23.90%), Postives = 210/456 (46.05%), Query Frame = 1
Query:  340 LVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKY----ITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVK-ASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLL-TKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFS---------RIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKM 1662
            + +RFGRK  ++++ V  I G+ +     ++  Y    +   ++G+  G+  +  P+YI+E+ P  +RG + T+ Q+++T G+LL+ ++    I   ++ +  +L   + PAI+ LI +    ES R+LL TK  ++EA++ +R+L+     S+EE ++   E       + S+       ++ +   R  L+ G  +Q+  Q +GINA+ Y S  LF   + ++ E+A +    I     + + V+  L+D+ GRR L L  L G+    + I ++                   FL              I E  GY                         ++++++ ++  + +V+ FA+G G IPW++T+E++    R + MA++    W+ NF+  + F ++  +          +F AIFWI+           YK  PET     E++
Sbjct:   87 MANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRA--SGSVEEDIE---EMRAEERAQQSESHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMS-SGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITIS-------------------FL--------------IKEFFGYV--------------------QEMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFT----------YKKVPETKNKTFEEI 473          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333494)

HSP 1 Score: 110.153 bits (274), Expect = 5.055e-25
Identity = 109/456 (23.90%), Postives = 210/456 (46.05%), Query Frame = 1
Query:  340 LVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKY----ITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVK-ASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLL-TKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFS---------RIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKM 1662
            + +RFGRK  ++++ V  I G+ +     ++  Y    +   ++G+  G+  +  P+YI+E+ P  +RG + T+ Q+++T G+LL+ ++    I   ++ +  +L   + PAI+ LI +    ES R+LL TK  ++EA++ +R+L+     S+EE ++   E       + S+       ++ +   R  L+ G  +Q+  Q +GINA+ Y S  LF   + ++ E+A +    I     + + V+  L+D+ GRR L L  L G+    + I ++                   FL              I E  GY                         ++++++ ++  + +V+ FA+G G IPW++T+E++    R + MA++    W+ NF+  + F ++  +          +F AIFWI+           YK  PET     E++
Sbjct:  174 MANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRA--SGSVEEDIE---EMRAEERAQQSESHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMS-SGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITIS-------------------FL--------------IKEFFGYV--------------------QEMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFT----------YKKVPETKNKTFEEI 560          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Fly
Match: Tret1-2 (gene:FBgn0033644 transcript:FBtr0088075)

HSP 1 Score: 99.7525 bits (247), Expect = 6.047e-22
Identity = 102/481 (21.21%), Postives = 196/481 (40.75%), Query Frame = 1
Query:  295 ILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSL-ITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKR-FMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYF---NNMSYETALWF---GS---------LIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RI 1686
            I+ L AL   +  G L++  GR+  I+ + V  I+ SL I  +  +        L G  +G+     P+Y+ E     +RG +  L       GIL+  +  + +   + S +  L   L   +  LI M+ + E+ RW + + +++ A++ ++ L+  +E+ +E  +K ++++    + + +Q     LF+  RN +   S+  G                    + FQ F   N + + T   F   GS         ++   NF  +F+   LID++GR+ L  +S   +I +L I+                                            + C  +G + ++ G                W+ L   ++Y++ F++G GPIPW++  EI PA  R    ++ T   W C F+    F ++  +   +  FW++ A  I G+  +  + PET    LE++   +  R+
Sbjct:   77 IMPLAALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFM---NWSMLAFLGAAL--PVPFLILMIIIPETPRWFVNRGQEERARKALKWLRG-KEADVEPELKELMQSQADADRQATQNTCLELFK--RNNLKPLSISLGL-------------------MFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIVGVVNFFATFMGIILIDRLGRKILLYVSDIAMIVTLSIL-----------------------------------------GGFFYCKAHGPDVSHLG----------------WLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVPETRGKSLEEIERKMMGRV 473          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Fly
Match: CG10960 (gene:FBgn0036316 transcript:FBtr0075943)

HSP 1 Score: 96.6709 bits (239), Expect = 5.080e-21
Identity = 104/460 (22.61%), Postives = 192/460 (41.74%), Query Frame = 1
Query:  298 LILGALFASLLTGSLVDRFGRK-KMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 1674
            + LGA    +  G L++  GRK  M+ +   F +  +++  +  ++  Y +  ++GI  G  C   P+Y  E+  K IRG + + +Q+ IT GIL    V A +    K +   +   ++P I   I    + ES  +L++K+R + A + I+ L+  +E   E  +  + E +     E    +  ++  L   + RK+L     +    Q+ GINA+++ +  +F   N  +   A W   LI     + +FV+  ++DK+GRR L L S   +  S   I V   L         Q  + +  +S                                               + W+ +  + L++I F+IG GP+PW++  E++    +    +L+  + WL  F+    F N+         FW++   T+ G+  +Y   PET    L ++   L
Sbjct:   66 MTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFILGIAGGAFCVTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGV----KIFWLSIICGILPLIFGAI-FFFMPESPTYLVSKDRSENAIKSIQWLRG-KEYDYEPELAELRETD----RETKANKVNVWAALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEAN--TGIEAEWATILIGIMQVVATFVSTLVVDKLGRRILLLASGISMAISTTAIGVYFFL---------QKQDAAQVVS-----------------------------------------------LGWLPVASLCLFIIMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGGTFWLFAGLTVVGVIFVYFAVPETKGKSLNEIQQEL 457          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc2a13b (solute carrier family 2 member 13b [Source:ZFIN;Acc:ZDB-GENE-090812-1])

HSP 1 Score: 231.491 bits (589), Expect = 7.099e-68
Identity = 160/522 (30.65%), Postives = 268/522 (51.34%), Query Frame = 1
Query:  202 FPMIGGFMFGHVTGSVS--------INKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIII-SCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICR-KDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL--------VYVRRLKRNQNNNCSNFLSCDDC-LNNICEYC--------------QIDE-NSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            F  +GGF+FG+ TG VS          K + ++  L + I +  A  ++L  G L  RFGR+  I++ S +FC  G +++++          + VG+G+G+     P+YIAE++P  +RG+++T+  + IT G  +AS+V  +        +  +L   ++PA +  +G L + ES RWLL K     A  V+R+++   +   EEF  I    +I  E+ +     +L+R+L +  AR++L+ GC +Q+  Q+AGIN ++Y S  + Q       + A+W  +   F NF+ + V   L++++GRR+L + SL G   SL+++A    L         +        N+ C N+  C+ C L+  C +C               +D  N+    +    N T K + S++   N C    +W++LLG+ILY+  FA GMGP+PW V SEIYP W RST  A S G  W+CN + +L F ++     +Y  F++Y A  + G   +    PET  + LE++ 
Sbjct:   41 FSALGGFLFGYDTGVVSGAMLLLKREKKLSSVWQELLVSITVGAAAVSALAGGFLNGRFGRRVCILLASFIFCAGGIILSVARNKEALLCGRLTVGLGLGIASMTVPVYIAEVSPPDLRGQLVTVNTLFITGGQFIASVVDGAFSYLPHDGWRFMLGLSVVPAALQFLGFLFLPESPRWLLQKGFTQNALLVLRQIRGDVDVE-EEFESI--RCSIQEEQRDVAGGPVLWRMLASPPARRALIVGCGLQMFQQLAGINTVMYYSATILQMSGVQDDQMAIWLAAGTAFTNFLFTLVGVWLVERVGRRRLTMASLLGTAVSLMVLAAGFLLSAQASPPVTFHPSNPSIHNSTCGNYGFCESCMLDPDCGFCYGLNATAVVQSSCVPVDPANTETAALGRCFNGTQKAS-SVFWAYNYCPTPYSWVVLLGLILYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWICNVLVSLTFLHVAQYLTYYGAFFLYAALALLGFVFVSGCLPETKGLRLEEIE 558          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Zebrafish
Match: SLC2A13 (proton myo-inositol cotransporter-like [Source:NCBI gene;Acc:101882338])

HSP 1 Score: 129.798 bits (325), Expect = 6.077e-33
Identity = 97/296 (32.77%), Postives = 151/296 (51.01%), Query Frame = 1
Query:  859 FRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLK--------RNQNNNCSNFLSCDDC-LNNICEYCQIDENS----GYTCVNYGANCTNKGNYS--------------IYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            +R+L    AR++L+ GC +Q+  Q++GIN ++Y S  + Q       + A+W  ++  F NF+ + +   L++++GRRKL L S+FG + SL +++V   L                  N++C+  LSC+ C L+  C YC   ENS      +CV      T +  +                YNF   C    +W++LLG++LY+ SFA GMGP+PW V SEIYP W RST  A S G  W  N + +L F ++     +Y +F++Y +    G   IY   PET    LE++ 
Sbjct:    1 WRMLTFPPARRALIVGCGLQMFQQLSGINTVMYYSATILQMSGVRDDKLAIWLVTVTAFTNFLFTLLGVWLVERVGRRKLTLGSIFGTVLSLCVLSVGFLLSAQHSPPVTLHLSDPTTPNSSCAAHLSCEPCMLDPGCGYC-YQENSTAVFASSCVPVNPASTERAAWGKCSNSTHLPDSGIWAYNF---CPTSYSWVVLLGLVLYLASFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWTFNVLVSLTFLHMAQYLTYYGVFFLYTSLAFTGFFFIYGCLPETKGRRLEEIE 292          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc2a8 (solute carrier family 2 member 8 [Source:ZFIN;Acc:ZDB-GENE-030829-25])

HSP 1 Score: 112.079 bits (279), Expect = 7.228e-26
Identity = 122/508 (24.02%), Postives = 223/508 (43.90%), Query Frame = 1
Query:  196 IIFPMIGGFMFGHVTGSV-SINKTNDLFFYLNLPILILGALFASLLT----------GSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPK-----YITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQ--YFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            ++ P+  GF+ G+ + ++  + +  DL   L++      + F S++T          G +V+R GRK    +S +FC I  +   +  IA +     Y+  VL G+  GV     PLYI+EM  + +RG + +  Q+ +  GI+ A +    +   D  ++ V ++  IP  ++L+ M  + E+ R+LL + ++ EA++ +R L+     +  E       A I    +N ++ F L   L++    K L  G  + ++ Q  GINAI++ +  +F+  +F +    T +   + + F     + +A  ++DK GR+ L ++S   +  S  +  V  +L  ++        N S+  S     + + E                              D P  + + W+ +  M  ++  FAIG GP PW+V SEI+P   R    AL     W C FI    F N+  +      FW++ A     +     + PET    LE++ 
Sbjct:   44 VLGPLSFGFVLGYSSPAIPELRRIQDLRLQLSVE---EASWFGSVVTIGAALGGLLGGWIVERIGRK----LSLMFCAIPFIFGFTTIIAAQNHWMFYVGRVLTGLASGVTSLVVPLYISEMAHERVRGTLGSCVQLMVVIGIMGAYVTGLFL---DWRWLAVASS--IPPTLMLLSMCFMPETPRFLLCQGKRREAEDALRFLRGPDAPAEWEC------ARIEDAYKNEEQSFSLGD-LKDPGVYKPLGIGVMMMLLQQFTGINAIMFYAETIFEQAHFKSSDVATVIVAATQVVF-----TAIAALIMDKAGRKVLLILSGVVMCISEAVFGVYFKLTVMK-------PNNSSLTSVLTDTHGLLE------------------------------DQPSAD-LAWLAVGSMGFFIAGFAIGWGPTPWLVMSEIFPTRVRGLGSALCVLTNWTCAFIVTKTFQNLMDALSSAGTFWMFSALCASNVVFTAFFVPETKGKTLEEIQ 489          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc2a3b (solute carrier family 2 member 3b [Source:ZFIN;Acc:ZDB-GENE-121031-5])

HSP 1 Score: 112.464 bits (280), Expect = 8.505e-26
Identity = 116/483 (24.02%), Postives = 222/483 (45.96%), Query Frame = 1
Query:  238 TGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKY----ITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVK-ASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLL-TKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV--YVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKM 1662
            TG    + T    + + + I   G +  SL  G+LV++ G +K +++S +  +IG  +     I   Y    +  +++G+  G+     P+Y+ E+ P  +RG   TL+Q+ +  GIL+A I+   S+      +  +L    +PA+I  I ++   ES R+LL + N++DEA++ +  L+    S +E+ ++ + +  + +  E   KR  +  + RN   R+ ++    +Q+  Q++GINA++Y S    + F N      ++    +   N + + V+  L+++ GRR L LI L G+ F ++++ ++L+LV   + + K  QN                     ID  S                       +   + +  + +L +  +V SF +G GPIPW + +E++    R   MA++    W  +F+  L+F  I   +I   +F I+    +  I   Y   PET     E +
Sbjct:   56 TGEPMDDYTVTTLWSVAVAIFNFGGMIGSLSVGALVNKLGGRKSMLLSNILALIGGGLMGLSSICSSYELLIVGRLVIGVFCGLSTGLTPMYVGEIAPTALRGAFGTLHQLGVVIGILVAQILGLESLLGSQTLWPLLLALTALPAVIQSIMLIFCLESPRYLLISLNKEDEARQALTSLR--GHSDVEDDIREMKDEAMKMSME---KRVSIPELFRNPAYRQPIIIAIILQLSQQLSGINAVMYYST---EIFRNAGITEPVFATIGMGVVNTVFTVVSLFLVERAGRRTLHLIGLTGMTFCVLLVTISLKLVDSEIEKAKLLQNGTAI-----------------IDSAS----------------------PSEGISTVKVLAILAVFGFVASFEMGPGPIPWFIVAELFAQGPRPAAMAVAGCCNWTASFLVGLLFP-ILSKKIGAYVFIIFLILLVVFIVFTYFRVPETKGRTFEDI 490          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc2a3b (solute carrier family 2 member 3b [Source:ZFIN;Acc:ZDB-GENE-121031-5])

HSP 1 Score: 112.464 bits (280), Expect = 8.505e-26
Identity = 116/483 (24.02%), Postives = 222/483 (45.96%), Query Frame = 1
Query:  238 TGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKY----ITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVK-ASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLL-TKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV--YVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKM 1662
            TG    + T    + + + I   G +  SL  G+LV++ G +K +++S +  +IG  +     I   Y    +  +++G+  G+     P+Y+ E+ P  +RG   TL+Q+ +  GIL+A I+   S+      +  +L    +PA+I  I ++   ES R+LL + N++DEA++ +  L+    S +E+ ++ + +  + +  E   KR  +  + RN   R+ ++    +Q+  Q++GINA++Y S    + F N      ++    +   N + + V+  L+++ GRR L LI L G+ F ++++ ++L+LV   + + K  QN                     ID  S                       +   + +  + +L +  +V SF +G GPIPW + +E++    R   MA++    W  +F+  L+F  I   +I   +F I+    +  I   Y   PET     E +
Sbjct:   56 TGEPMDDYTVTTLWSVAVAIFNFGGMIGSLSVGALVNKLGGRKSMLLSNILALIGGGLMGLSSICSSYELLIVGRLVIGVFCGLSTGLTPMYVGEIAPTALRGAFGTLHQLGVVIGILVAQILGLESLLGSQTLWPLLLALTALPAVIQSIMLIFCLESPRYLLISLNKEDEARQALTSLR--GHSDVEDDIREMKDEAMKMSME---KRVSIPELFRNPAYRQPIIIAIILQLSQQLSGINAVMYYST---EIFRNAGITEPVFATIGMGVVNTVFTVVSLFLVERAGRRTLHLIGLTGMTFCVLLVTISLKLVDSEIEKAKLLQNGTAI-----------------IDSAS----------------------PSEGISTVKVLAILAVFGFVASFEMGPGPIPWFIVAELFAQGPRPAAMAVAGCCNWTASFLVGLLFP-ILSKKIGAYVFIIFLILLVVFIVFTYFRVPETKGRTFEDI 490          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Xenopus
Match: phf21b (PHD finger protein 21B [Source:Xenbase;Acc:XB-GENE-969993])

HSP 1 Score: 216.853 bits (551), Expect = 2.892e-62
Identity = 160/565 (28.32%), Postives = 273/565 (48.32%), Query Frame = 1
Query:   97 CSFFKFISIAVHLNHQQLKNKIEVYFTRQYIHHI-IFPMIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDR--------------FGRKKMIIISCVFCIIGSLITLSPGIAPKYITN-VLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKAS---ICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA--------VNLQLVYVRRLKRNQNNNCSNFLSCDDC-LNNICEYCQIDENSG---YTCVNYGANCTNKGNY-------------SIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEK 1659
            C+     S       +  + + +   T  +++ + +F  +GGF+FG+ TG VS          L    + L AL+  LL  S V                 GR+  I+++ +    G++I  +       +   V+VG+GIG+     P+YIAE  P  +RGR++T+  + IT G   A++V  +   + R    Y+  L+   +PA++  +G L + ES RWL+ K +  +A+ V+ +++  Q  +I+E    I  +    E+E +    +++R+L     R++L+ GC +Q+  Q+AGIN ++Y S  + Q         A+W  ++  F NF  + +   L++K+GRRKL L SL G   +L ++A        V+  + +        N+ C+ +  C+ C L+  C +C     S     +C+    + T++  +             SI+ + N C    +W  LLG+ILY++ FA GMGP+PW V SEIYP W RST  A S+G  W+CN + +L F +      +Y  F++Y      G+  IY   PET    LE+
Sbjct:   49 CTSINSQSTGAGDLERAARKQFQQDVTPAFVYVVSVFSALGGFLFGYDTGVVS-----GAMLLLKRE-MNLSALWQELLVSSTVGAAALSALAGGVLNGVLGRRPCILMASLLFTAGAVILAAARDKETLLGGRVVVGLGIGIASMTVPVYIAEAAPPHLRGRLVTINTLFITGGQFSAAVVDGAFSYLARDGWRYMLGLSA--VPAVLQFLGFLFLPESPRWLIQKGQTQKARRVLSQIRGNQ--TIDEEYDSIKNSIDEEEKEGATGGPIIYRMLIYPPTRRALIVGCGLQMFQQLAGINTVMYYSATILQMSGVDDDRLAIWLAAVTAFTNFSFTLLGVWLVEKLGRRKLTLGSLTGTTVALFVLALGFLLSAQVSPPVTFTPGDPSGPNSTCTQYSYCNKCMLDPNCGFCYKKNGSSIVDSSCIPVNTDSTDRAAWGRCMNETKSKAGGSIWAY-NYCPTSYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGVNWICNVLISLTFLHTAEYLTYYGAFFLYAGLACVGLIFIYGCLPETKGKKLEE 602          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Xenopus
Match: phf21b (PHD finger protein 21B [Source:Xenbase;Acc:XB-GENE-969993])

HSP 1 Score: 203.756 bits (517), Expect = 2.757e-57
Identity = 154/552 (27.90%), Postives = 266/552 (48.19%), Query Frame = 1
Query:   97 CSFFKFISIAVHLNHQQLKNKIEVYFTRQYIHHI-IFPMIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDR--------------FGRKKMIIISCVFCIIGSLITLSPGIAPKYITN-VLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKAS---ICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA--------VNLQLVYVRRLKRNQNNNCSNFLSCDDC-LNNICEYCQIDENSG---YTCVNYGANCTNKGNY-------------SIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFT---ICGIA 1611
            C+     S       +  + + +   T  +++ + +F  +GGF+FG+ TG VS          L    + L AL+  LL  S V                 GR+  I+++ +    G++I  +       +   V+VG+GIG+     P+YIAE  P  +RGR++T+  + IT G   A++V  +   + R    Y+  L+   +PA++  +G L + ES RWL+ K +  +A+ V+ +++  Q  +I+E    I  +    E+E +    +++R+L     R++L+ GC +Q+  Q+AGIN ++Y S  + Q         A+W  ++  F NF  + +   L++K+GRRKL L SL G   +L ++A        V+  + +        N+ C+ +  C+ C L+  C +C     S     +C+    + T++  +             SI+ + N C    +W  LLG+ILY++ FA GMGP+PW V SEIYP W RST  A S+G  W+CN + +L F +      +Y  F++Y        CG +
Sbjct:   49 CTSINSQSTGAGDLERAARKQFQQDVTPAFVYVVSVFSALGGFLFGYDTGVVS-----GAMLLLKRE-MNLSALWQELLVSSTVGAAALSALAGGVLNGVLGRRPCILMASLLFTAGAVILAAARDKETLLGGRVVVGLGIGIASMTVPVYIAEAAPPHLRGRLVTINTLFITGGQFSAAVVDGAFSYLARDGWRYMLGLSA--VPAVLQFLGFLFLPESPRWLIQKGQTQKARRVLSQIRGNQ--TIDEEYDSIKNSIDEEEKEGATGGPIIYRMLIYPPTRRALIVGCGLQMFQQLAGINTVMYYSATILQMSGVDDDRLAIWLAAVTAFTNFSFTLLGVWLVEKLGRRKLTLGSLTGTTVALFVLALGFLLSAQVSPPVTFTPGDPSGPNSTCTQYSYCNKCMLDPNCGFCYKKNGSSIVDSSCIPVNTDSTDRAAWGRCMNETKSKAGGSIWAY-NYCPTSYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGVNWICNVLISLTFLHTAEYLTYYGAFFLYAGLARLCTCGAS 589          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Xenopus
Match: slc2a10 (solute carrier family 2 (facilitated glucose transporter), member 10 [Source:NCBI gene;Acc:780388])

HSP 1 Score: 116.701 bits (291), Expect = 5.459e-27
Identity = 122/525 (23.24%), Postives = 230/525 (43.81%), Query Frame = 1
Query:  208 MIGGFMFGH----VTGSVSINKTNDLFFYLN-------LPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITN-VLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTV-SESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKI-ARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVR------------RLKRNQNNNCSNFL-----------SCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNY--INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            ++GG +FG+    ++G++ + KT    + L        +  ++ GAL ASL+ G ++DR+GR+  I+ S +  + GS+I ++       I   V +G  I +    C +Y++E+     RG +++LY+  IT GIL++  +   +   ++S+  +    ++PA    I +L + S+ ++    +   D+      +L++  E+   EF           + +   +++    + R+K   R   L G  + +  Q  G   +LY +  +FQ     S  +A+     +       + +A    DK GRR L L     I+ ++ I  + +    V+            R   +  +N S  L           + D+ ++ +    +    +     N+    +        + + P +NY  +NWI LL M+ +V +F+IG GP+ W+V SEIYPA  R    A      W  N +  L F ++  S      F +Y    +  IA IY + PET    LE+++
Sbjct:   16 LLGGIVFGYELGIISGALLVLKT---VYQLTCFEQEALVSAVLFGALLASLIGGIIIDRWGRRTAILASNLVVLAGSIILIATSTFWWLIVGRVTIGFAISISSMACCIYVSEIVRPHQRGMLVSLYETGITVGILISYAMNYFLSGVNESWKYMFGLAIVPAAFQFISILFLPSKPHKLNFWEQDTDDG---FIELEETGEAG--EF-----------KPDTYDRQYTFLDLFRSKDNMRTRTLLGLGLVLFQQFTGQPNVLYYASTIFQSVGFQSNSSAVLASVGLGVVKVASTLIAICFADKAGRRILLLAGC--IVMTIAITGIGIVSFTVKMDSHRDCGSVTGRNMSSGESNVSQLLGIVHAETSTINTLDNSVHQLAMAIRSPSLANSASSNHKDLISQNSTVLPASPELP-SNYTILNWITLLSMMAFVSAFSIGFGPMTWIVLSEIYPADIRGRAFAFCNSFNWAANLLITLTFLDVIASIGLSWTFLLYGVVGLLAIAFIYFFIPETKGQSLEEID 518          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Xenopus
Match: slc2a10 (solute carrier family 2 (facilitated glucose transporter), member 10 [Source:NCBI gene;Acc:780388])

HSP 1 Score: 116.316 bits (290), Expect = 6.471e-27
Identity = 122/525 (23.24%), Postives = 230/525 (43.81%), Query Frame = 1
Query:  208 MIGGFMFGH----VTGSVSINKTNDLFFYLN-------LPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITN-VLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTV-SESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKI-ARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVR------------RLKRNQNNNCSNFL-----------SCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNY--INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            ++GG +FG+    ++G++ + KT    + L        +  ++ GAL ASL+ G ++DR+GR+  I+ S +  + GS+I ++       I   V +G  I +    C +Y++E+     RG +++LY+  IT GIL++  +   +   ++S+  +    ++PA    I +L + S+ ++    +   D+      +L++  E+   EF           + +   +++    + R+K   R   L G  + +  Q  G   +LY +  +FQ     S  +A+     +       + +A    DK GRR L L     I+ ++ I  + +    V+            R   +  +N S  L           + D+ ++ +    +    +     N+    +        + + P +NY  +NWI LL M+ +V +F+IG GP+ W+V SEIYPA  R    A      W  N +  L F ++  S      F +Y    +  IA IY + PET    LE+++
Sbjct:   26 LLGGIVFGYELGIISGALLVLKT---VYQLTCFEQEALVSAVLFGALLASLIGGIIIDRWGRRTAILASNLVVLAGSIILIATSTFWWLIVGRVTIGFAISISSMACCIYVSEIVRPHQRGMLVSLYETGITVGILISYAMNYFLSGVNESWKYMFGLAIVPAAFQFISILFLPSKPHKLNFWEQDTDDG---FIELEETGEAG--EF-----------KPDTYDRQYTFLDLFRSKDNMRTRTLLGLGLVLFQQFTGQPNVLYYASTIFQSVGFQSNSSAVLASVGLGVVKVASTLIAICFADKAGRRILLLAGC--IVMTIAITGIGIVSFTVKMDSHRDCGSVTGRNMSSGESNVSQLLGIVHAETSTINTLDNSVHQLAMAIRSPSLANSASSNHKDLISQNSTVLPASPELP-SNYTILNWITLLSMMAFVSAFSIGFGPMTWIVLSEIYPADIRGRAFAFCNSFNWAANLLITLTFLDVIASIGLSWTFLLYGVVGLLAIAFIYFFIPETKGQSLEEID 528          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Xenopus
Match: slc2a10 (solute carrier family 2 (facilitated glucose transporter), member 10 [Source:NCBI gene;Acc:780388])

HSP 1 Score: 116.316 bits (290), Expect = 6.537e-27
Identity = 122/525 (23.24%), Postives = 230/525 (43.81%), Query Frame = 1
Query:  208 MIGGFMFGH----VTGSVSINKTNDLFFYLN-------LPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITN-VLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTV-SESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKI-ARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVR------------RLKRNQNNNCSNFL-----------SCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNY--INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            ++GG +FG+    ++G++ + KT    + L        +  ++ GAL ASL+ G ++DR+GR+  I+ S +  + GS+I ++       I   V +G  I +    C +Y++E+     RG +++LY+  IT GIL++  +   +   ++S+  +    ++PA    I +L + S+ ++    +   D+      +L++  E+   EF           + +   +++    + R+K   R   L G  + +  Q  G   +LY +  +FQ     S  +A+     +       + +A    DK GRR L L     I+ ++ I  + +    V+            R   +  +N S  L           + D+ ++ +    +    +     N+    +        + + P +NY  +NWI LL M+ +V +F+IG GP+ W+V SEIYPA  R    A      W  N +  L F ++  S      F +Y    +  IA IY + PET    LE+++
Sbjct:   16 LLGGIVFGYELGIISGALLVLKT---VYQLTCFEQEALVSAVLFGALLASLIGGIIIDRWGRRTAILASNLVVLAGSIILIATSTFWWLIVGRVTIGFAISISSMACCIYVSEIVRPHQRGMLVSLYETGITVGILISYAMNYFLSGVNESWKYMFGLAIVPAAFQFISILFLPSKPHKLNFWEQDTDDG---FIELEETGEAG--EF-----------KPDTYDRQYTFLDLFRSKDNMRTRTLLGLGLVLFQQFTGQPNVLYYASTIFQSVGFQSNSSAVLASVGLGVVKVASTLIAICFADKAGRRILLLAGC--IVMTIAITGIGIVSFTVKMDSHRDCGSVTGRNMSSGESNVSQLLGIVHAETSTINTLDNSVHQLAMAIRSPSLANSASSNHKDLISQNSTVLPASPELP-SNYTILNWITLLSMMAFVSAFSIGFGPMTWIVLSEIYPADIRGRAFAFCNSFNWAANLLITLTFLDVIASIGLSWTFLLYGVVGLLAIAFIYFFIPETKGQSLEEID 518          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc2a13 (solute carrier family 2 (facilitated glucose transporter), member 13 [Source:MGI Symbol;Acc:MGI:2146030])

HSP 1 Score: 226.098 bits (575), Expect = 1.923e-65
Identity = 169/563 (30.02%), Postives = 270/563 (47.96%), Query Frame = 1
Query:  124 AVHLNHQQLKNKIEVYFTRQYIHHII-----FPMIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLV--------------DRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLV-GIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKA--SICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA--------VNLQLVYVRRLKRNQNNNCSNFLSCDDC-LNNICEYCQ-------IDE-----NSGYTCVNYGANCTNK------GNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            A  L   +L+      F R      +     F  +GGF+FG+ TG VS          L    + LGA++  LL    V                 GR+  I+++   C +GS +  +       +   LV G+GIG+     P+YIAE++P  +RGR++T+  + IT G   AS+V    S  +KD  +  +L    IPA+I  +G L + ES RWL+ K +  +A+ ++ +++  Q  +I+E    I  +    E+E +    ++ R+L     R++L+ GC +Q+  Q++GIN I+Y S  + Q         A+W  S+  F NFI + V   L++K+GRRKL   SL G   +L+I+A        V+ ++ +      +QN  C+ +  C++C L+  C +C        ID      N   T       C N+      G +  Y+F   C    +W  L+G++LY++ FA GMGP+PW V SEIYP W RST  A S G  W+ N + +L F +      +Y  F++Y  F   G+  +Y   PET    LE++ 
Sbjct:   45 AASLQGAELERAARRQFQRDETPAFVYAAAAFSALGGFLFGYDTGVVSGA------MLLLRRQMRLGAMWQELLVSGAVGAAAVAALAGGALNGALGRRSAILLASALCTVGSAVLAAAANKETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKD-GWRYMLGLAAIPAVIQFLGFLFLPESPRWLIQKGQTQKARRILSQMRGNQ--TIDEEYDSIRNSIEEEEKEATAAGPIICRMLSYPPTRRALVVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASITAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFLLSAQVSPRVTFRPTTPSDQNTTCTGYSYCNECMLDPDCGFCYKINGSAVIDSSCVPVNKASTTEAAWGRCDNETKFKAEGAHWAYSF---CPTPYSWTALVGLVLYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFVYGCLPETKGKKLEEIE 595          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc2a12 (solute carrier family 2 (facilitated glucose transporter), member 12 [Source:MGI Symbol;Acc:MGI:3052471])

HSP 1 Score: 123.25 bits (308), Expect = 3.485e-29
Identity = 130/501 (25.95%), Postives = 230/501 (45.91%), Query Frame = 1
Query:  298 LILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGV------ICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVK---ASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKL-----ALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFL---SCDDCLNNIC---EYCQIDENSGYTCVNYGANCTNKGNY----SIYNFDNPCTNY------------INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETN-------QIDLEKMNYV 1671
            L++GA  ASL  G L+DR+GR+  II+S     +GSL+ +   ++  Y   ++  + IGV      I TC  +YIAE+ P+  RG +++L ++ I  GIL A I     A+I    K Y+  L  PL   ++  I M  +  S R+L+ K +++ A +V+RKL+ + +++ EE   I       +++E     + LFR   N   R  +L G  +    Q  G   IL+ +  + +     S E A    + +     + +  A  L+D IG +       +++S   +   +V + +N+    + R     N +   F+   + +  ++N      + +I   S  + +  G     KG      S+ N     T +              W+ L  +++YV +F+IG+GP+PW+V SEI+P   R   MAL++   W  N + +L F  +        + +IY   ++  +A +  + PET         ++L K NYV
Sbjct:   90 LLIGAFLASLTGGVLIDRYGRRLAIILSSCLLGLGSLVLI---MSLSYTLLIMGRVAIGVSISLSSIATC--VYIAEIAPQHRRGLLVSLNELMIVTGILFAYISNYAFANISNGWK-YMFGLVIPL--GVLQAIAMYFLPPSPRFLVMKGQEESAGKVLRKLRVISDTT-EELTLI----KSSLKDEYQYSFWDLFRSKDNM--RTRILIGLTLVFFVQTTGQPNILFYASTVLKSVGFQSNEAASLASTGVGVVKVVSTIPATLLVDHIGSKTFLCIGSSVMSASLLTMGIVNLNINMNFTNICRSHSLLNQSLEEFVFYATGNLSISNSSLREHFKRITPYSKGSFMPMGNGMEPKGEMTFTSSLPNAGLSRTEHQGVTDTAVVPAAYKWLSLASLLVYVAAFSIGLGPMPWLVLSEIFPGGIRGRAMALTSSMNWGVNLLISLTFLTVTDLIGLSWVCFIYTIMSLASLAFVVLFIPETKGCSLEQISVELAKANYV 575          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc2a3 (solute carrier family 2 (facilitated glucose transporter), member 3 [Source:MGI Symbol;Acc:MGI:95757])

HSP 1 Score: 95.1301 bits (235), Expect = 2.878e-20
Identity = 122/524 (23.28%), Postives = 221/524 (42.18%), Query Frame = 1
Query:  175 TRQYIHHIIFPMIGGFMFGHVTGSVSINKT--NDLFFYL------NLP--------------ILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCC----PLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKAS-ICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLL-TKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKM 1662
            T   +  +    IG F FG+ TG ++  +T   D   Y       +LP              I  +G +  S   G  V+RFGR+  +++  +  II   +     IA      +L  + IG+ C  C    P+YI E++P  +RG   TL Q+ I  GIL+A I     I   ++ +  +L   +IPAI+    +    ES R+LL  K  +D+A E++++L     S + + ++ + + ++ + +E   K+  +  + R+    + LL    +Q+  Q++GINA+ Y S  +F+   +   +  ++        N I + V+  L+++ GRR L +I L G+    V + ++L L                                                  K +Y   +F          + ++ +++YV  F IG GPIPW + +E++    R   +A++    W  NF+  ++F +       Y +F I+ AF I  +   +   PET     E +
Sbjct:    7 TPSLVFAVTVATIGSFQFGYNTGVINAPETILKDFLNYTLEERLEDLPSEGLLTALWSLCVAIFSVGGMIGSFSVGLFVNRFGRRNSMLLVNLLAIIAGCLMGFAKIAESVEMLILGRLLIGIFCGLCTGFVPMYIGEVSPTALRGAFGTLNQLGIVVGILVAQIFGLDFILGSEELWPGLLGLTIIPAILQSAALPFCPESPRFLLINKKEEDQATEILQRL--WGTSDVVQEIQEMKDESVRMSQE---KQVTVLELFRSPNYVQPLLISIVLQLSQQLSGINAVFYYSTGIFK---DAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAVCSVFMTISLLL--------------------------------------------------KDDYEAMSF----------VCIVAILIYVAFFEIGPGPIPWFIVAELFSQGPRPAAIAVAGCCNWTSNFLVGMLFPSAAAYLGAY-VFIIFAAFLIFFLIFTFFKVPETKGRTFEDI 461          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc2a2 (solute carrier family 2 (facilitated glucose transporter), member 2 [Source:MGI Symbol;Acc:MGI:1095438])

HSP 1 Score: 80.1073 bits (196), Expect = 2.553e-15
Identity = 78/306 (25.49%), Postives = 152/306 (49.67%), Query Frame = 1
Query:  271 LFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYI----TNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKAS--ICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKD-EAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFN-NMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV 1164
            + + L++    +G + AS   G L D+ GR K ++ +    + G+L+       P +        + G+  G+I    P+YI E+ P  +RG + TL+Q+++  GIL++ I   S  +  +D  +I +L    +PA++  + +L   ES R+L  K  ++  AK+ +++L+       E+  K I E     EE +++++  + ++  +   R+ +L    + +  Q +GIN I Y S  +FQ    +      +  G++    N I + V+  L++K GRR L L  + G+ F  + ++V L L+
Sbjct:   94 MLWSLSVSSFAVGGMVASFFGGWLGDKLGRIKAMLAANSLSLTGALLMGCSKFGPAHALIIAGRSVSGLYCGLISGLVPMYIGEIAPTTLRGALGTLHQLALVTGILISQIAGLSFILGNQDHWHI-LLGLSAVPALLQCLLLLFCPESPRYLYIKLEEEVRAKKSLKRLR-----GTEDVTKDINEMKKEKEEASTEQKVSVIQLFTDANYRQPILVALMLHMAQQFSGINGIFYYSTSIFQTAGISQPVYATIGVGAI----NMIFTAVSVLLVEKAGRRTLFLTGMIGMFFCTIFMSVGLVLL 389          

HSP 2 Score: 54.299 bits (129), Expect = 2.777e-7
Identity = 31/107 (28.97%), Postives = 52/107 (48.60%), Query Frame = 1
Query: 1357 YINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYF-----PETNQIDLEKM 1662
            +++++ +  + L+V  F IG GPIPW + +E +    R T +AL+  + W+CNF+  L F  I            Y  F   G+ L++  F     PET     E++
Sbjct:  394 WMSYVSMTAIFLFVSFFEIGPGPIPWFMVAEFFSQGPRPTALALAAFSNWVCNFVIALCFQYI------ADFLGPYVFFLFAGVVLVFTLFTFFKVPETKGKSFEEI 494          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc2a7 (solute carrier family 2 (facilitated glucose transporter), member 7 [Source:MGI Symbol;Acc:MGI:3650865])

HSP 1 Score: 79.7221 bits (195), Expect = 3.344e-15
Identity = 75/280 (26.79%), Postives = 139/280 (49.64%), Query Frame = 1
Query:  304 LGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKY----ITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVK-ASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRW-LLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEEN--SQKRFMLFRILRNK-IARKSLLFGCYXXXXXXXXXXXXXLYNS----PLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLAL 1104
            LG L  SL+ G +V+++GRK  ++I+ VF I  +++     +A  +    ++ VLVGI  G+  +  P+Y+ E+ P+ +RG + T+ +V +  G+LLA I    +I      +  +L    +PA+I L+ +    ES R+ L+ K  ++ A++ +R+L+  Q  ++E  ++ +       + E   S      FR LR + I+   L+ G  +  I  +     ++Y S    P   QY            GS +   N + + V+  +I+++GRR L L
Sbjct:   98 LGGLLGSLVVGLMVNKWGRKGTLLINNVFAITSAVLMGVSKVARAFELIILSRVLVGICAGIAYSTLPMYLGELAPQNLRGALGTMTEVFVIIGVLLAQIFSLQAILGNATGWPILLALTGVPAVIQLLSLPFFPESPRYTLIEKGDEETARQALRRLRG-QNYNVEAEMEEMRTEERTEQAEGRLSVLNLFTFRPLRWQLISIVVLMAGQQLSGINAVNYYADVIYTSAGVDPTQSQYVT---------LGSGV--INLVMTLVSAVIIERLGRRILLL 365          
BLAST of Proton myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|Q3UHK1|MYCT_MOUSE (Proton myo-inositol cotransporter OS=Mus musculus OX=10090 GN=Slc2a13 PE=1 SV=2)

HSP 1 Score: 226.098 bits (575), Expect = 1.345e-64
Identity = 169/563 (30.02%), Postives = 270/563 (47.96%), Query Frame = 1
Query:  124 AVHLNHQQLKNKIEVYFTRQYIHHII-----FPMIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLV--------------DRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLV-GIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKA--SICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA--------VNLQLVYVRRLKRNQNNNCSNFLSCDDC-LNNICEYCQ-------IDE-----NSGYTCVNYGANCTNK------GNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            A  L   +L+      F R      +     F  +GGF+FG+ TG VS          L    + LGA++  LL    V                 GR+  I+++   C +GS +  +       +   LV G+GIG+     P+YIAE++P  +RGR++T+  + IT G   AS+V    S  +KD  +  +L    IPA+I  +G L + ES RWL+ K +  +A+ ++ +++  Q  +I+E    I  +    E+E +    ++ R+L     R++L+ GC +Q+  Q++GIN I+Y S  + Q         A+W  S+  F NFI + V   L++K+GRRKL   SL G   +L+I+A        V+ ++ +      +QN  C+ +  C++C L+  C +C        ID      N   T       C N+      G +  Y+F   C    +W  L+G++LY++ FA GMGP+PW V SEIYP W RST  A S G  W+ N + +L F +      +Y  F++Y  F   G+  +Y   PET    LE++ 
Sbjct:   45 AASLQGAELERAARRQFQRDETPAFVYAAAAFSALGGFLFGYDTGVVSGA------MLLLRRQMRLGAMWQELLVSGAVGAAAVAALAGGALNGALGRRSAILLASALCTVGSAVLAAAANKETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKD-GWRYMLGLAAIPAVIQFLGFLFLPESPRWLIQKGQTQKARRILSQMRGNQ--TIDEEYDSIRNSIEEEEKEATAAGPIICRMLSYPPTRRALVVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASITAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFLLSAQVSPRVTFRPTTPSDQNTTCTGYSYCNECMLDPDCGFCYKINGSAVIDSSCVPVNKASTTEAAWGRCDNETKFKAEGAHWAYSF---CPTPYSWTALVGLVLYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFVYGCLPETKGKKLEEIE 595          
BLAST of Proton myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|Q96QE2|MYCT_HUMAN (Proton myo-inositol cotransporter OS=Homo sapiens OX=9606 GN=SLC2A13 PE=1 SV=3)

HSP 1 Score: 225.328 bits (573), Expect = 3.052e-64
Identity = 168/552 (30.43%), Postives = 272/552 (49.28%), Query Frame = 1
Query:  124 AVHLNHQQLKNKIEVYFTRQYIHHIIFPMIGGFMFGHVTGSVSIN--------KTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLV-GIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKA--SICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA--------VNLQLVYVRRLKRNQNNNCSNFLSCDDC-LNNICEYC-QIDENS--GYTCVNYGANCTNKGNYS---------------IYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            A     QQ +    VY         +F  +GGF+FG+ TG VS            + L+  L +   +  A  ++L  G+L   FGR+  I+++      GS +  +       +   LV G+GIG+     P+YIAE++P  +RGR++T+  + IT G   AS+V    S  +KD  +  +L    +PA+I   G L + ES RWL+ K +  +A+ ++ +++  Q  +I+E    I       E+E      ++ R+L     R++L+ GC +Q+  Q++GIN I+Y S  + Q         A+W  S+  F NFI + V   L++K+GRRKL   SL G   +L+I+A        V+ ++ +       QN  C+ +  C++C L+  C +C ++++++    +CV      TN+  +                 YNF   C    +W  LLG+ILY++ FA GMGP+PW V SEIYP W RST  A S+G  W+ N + +L F +      +Y  F++Y  F   G+  IY   PET    LE++ 
Sbjct:   67 AARRQFQQDETPAFVYVV------AVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQELLVSSTVGAAAVSALAGGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKD-GWRYMLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQ--TIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKTEDIFWAYNF---CPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIE 606          
BLAST of Proton myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|Q921A2|MYCT_RAT (Proton myo-inositol cotransporter OS=Rattus norvegicus OX=10116 GN=Slc2a13 PE=1 SV=2)

HSP 1 Score: 222.246 bits (565), Expect = 3.151e-63
Identity = 168/563 (29.84%), Postives = 270/563 (47.96%), Query Frame = 1
Query:  124 AVHLNHQQLKNKIEVYFTRQYIHHII-----FPMIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLV--------------DRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLV-GIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKA--SICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA--------VNLQLVYVRRLKRNQNNNCSNFLSCDDC-LNNICEYC-QIDENS--GYTCVNYGANCTNKGNYS---------------IYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            A  L   +L+      F R      +     F  +GGF+FG+ TG VS          L    + LGA++  LL    V                 GR+  I+++   C +GS +  +       +   LV G+GIG+     P+YIAE++P  +RGR++T+  + IT G   AS+V    S  +KD  +  +L    IPA+I  +G L + ES RWL+ K +  +A+ ++ +++  Q  +I+E    I  +    E+E S    ++ R+L     R++L  GC +Q+  Q++GIN I+Y S  + Q         A+W  S+  F NFI + V   L++K+GRRKL   SL G   +L I+A        V+ ++ +       QN  C+ +  C++C L+  C +C +I+ ++    +CV      TN+  +                 Y+F   C    +W  L+G++LY++ FA GMGP+PW V SEIYP W RST  A S G  W+ N + +L F +      +Y  F++Y  F   G+  +Y   PET    LE++ 
Sbjct:   45 AASLQGAELERAARRQFQRDETPAFVYAAAAFSALGGFLFGYDTGVVSGA------MLLLRRQMRLGAMWQELLVSGAVGAAAVAALAGGALNGALGRRSAILLASALCTVGSAVLAAAANKETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKD-GWRYMLGLAAIPAVIQFLGFLFLPESPRWLIQKGQTQKARRILSQMRGNQ--TIDEEYDSIRNSIEEEEKEASAAGPIICRMLSYPPTRRALAVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASITAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALTILALGFLLSAQVSPRVTFRPTAPSGQNATCTEYSYCNECMLDPDCGFCYKINSSAVIDSSCVPVNKASTNEAAWGRCENETKFKAEDVHWAYSF---CPTPYSWTALVGLVLYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFVYGCLPETKGKKLEEIE 595          
BLAST of Proton myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|Q9ZQP6|INT3_ARATH (Probable inositol transporter 3 OS=Arabidopsis thaliana OX=3702 GN=INT3 PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 2.200e-50
Identity = 149/534 (27.90%), Postives = 256/534 (47.94%), Query Frame = 1
Query:  211 IGGFMFGHVTGSVS-------------INKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYI--TNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRK-----LKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAV------NLQLVYVRRLKRN--QNNNCSNFL------------SCDDCLNNICEYCQ--IDENSGYTCVNYGAN----CTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 1674
            IGG +FG+ TG ++              NKT      + + + + GA+  + + G   D+FGR+  ++I+ V  ++G+L+ +    AP  I    +LVG G+G+     PLYI+EM+P  IRG +++   + IT G  L+ ++  +      ++  +L    IPAII    MLT+ ES RWL   +RK E+++++ +     + + + ++++E V+       +I    S K   L   L N + R  L  G  +Q+  Q  GIN ++Y SP + Q+    S +TA+    +    N + S V+   +D+ GRRKL +IS+FGII  LVI+A       N      +R  RN  +N  C  F             +C  CL   C +C     E +   C+   A+    C +KG      F + C +   ++ ++ + LY+I +A GMG +PW+V SEIYP   R     ++  + W+ N + +  F  +  +      F ++   +  G+  I+   PET  +  E++  +L
Sbjct:   35 IGGLLFGYNTGVIAGALLYIKEEFGEVDNKT--WLQEIIVSMTVAGAIVGAAIGGWYNDKFGRRMSVLIADVLFLLGALVMVI-AHAPWVIILGRLLVGFGVGMASMTSPLYISEMSPARIRGALVSTNGLLITGGQFLSYLINLAFVHTPGTWRWMLGVSAIPAIIQFCLMLTLPESPRWLYRNDRKAESRDILERIYPAEMVEAEIAALKESVRAETADEDIIGHTFSDK---LRGALSNPVVRHGLAAGITVQVAQQFVGINTVMYYSPTILQFAGYASNKTAMALALITSGLNAVGSVVSMMFVDRYGRRKLMIISMFGIITCLVILAAVFNEASNHAPKIDKRDSRNFAKNATCPAFAPFTASRSPPSNWNCMKCLQYDCGFCSNGAQEYAPGACIVQSADMKALCHSKGRTF---FKDGCPSKFGYLAIVFLGLYIIVYAPGMGTVPWIVNSEIYPLRYRGLAGGIAAVSNWMSNLVVSETFLTLTNAVGSSGTFLLFAGSSAVGLFFIWLLVPETKGLQFEEVEKLL 559          
BLAST of Proton myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|Q9C757|INT2_ARATH (Probable inositol transporter 2 OS=Arabidopsis thaliana OX=3702 GN=INT2 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 4.908e-48
Identity = 147/556 (26.44%), Postives = 263/556 (47.30%), Query Frame = 1
Query:  136 NHQQLKNKIEVYFTRQYIHHIIFPM-IGGFMFGHVTGSVSIN--------KTNDLFFYLNLPILILGALFASLLTGSLV---DRFGRKKMIIISCVFCIIGSLI-TLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEA-NIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVII-------AVNLQLVYVRRLKRNQNNNCSNFLS--------CDDCL---NNICEYCQI---DENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RIFKLK 1698
            +    K    + +   Y+  + F   IGG +FG+ TG +S          K+ D   +L   I+ +    A +         D+ GR+  I+++    ++G++I   +P  +   +  V VG+G+G+     PLYI+E +P  IRG +++     IT G  L+ ++  +      ++  +L    IPA++  + M T+ ES RWL  K R++EAK ++R++   ++  +E+ ++ + ++    I EE S ++  + ++ + K  R+ L+ G  +Q+  Q  GIN ++Y SP + Q     S  TAL    +    N   S ++   ID+IGR+KL +ISLFG+I SL I+       A +   +     +R  N +C ++ S        C  CL   +  C YC      E+ G   ++  +      N +   +   C +   W  LLG+ LY+I F+ GMG +PW+V SEIYP   R     ++  A W+ N I    F ++  +      F I+   ++  +  +    PET  + +E++  +L  R  + K
Sbjct:   11 DESAFKECFSLTWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKSVDRNTWLQEMIVSMAVAGAIVGAAIGGWANDKLGRRSAILMADFLFLLGAIIMAAAPNPSLLVVGRVFVGLGVGMASMTAPLYISEASPAKIRGALVSTNGFLITGGQFLSYLINLAFTDVTGTWRWMLGIAGIPALLQFVLMFTLPESPRWLYRKGREEEAKAILRRIYSAED--VEQEIRALKDSVETEILEEGSSEKINMIKLCKAKTVRRGLIAGVGLQVFQQFVGINTVMYYSPTIVQLAGFASNRTALLLSLVTAGLNAFGSIISIYFIDRIGRKKLLIISLFGVIISLGILTGVFYEAATHAPAISSLETQRFNNISCPDYKSAMNTNAWDCMTCLKASSPSCGYCSSPIGKEHPGACWISDDSVKDLCHNENRLWYTRGCPSNFGWFALLGLGLYIIFFSPGMGTVPWIVNSEIYPLRFRGICGGIAATANWISNLIVAQSFLSLTEAIGTSWTFLIFGVISVIALLFVMVCVPETKGMPMEEIEKMLERRSMEFK 564          
BLAST of Proton myo-inositol cotransporter vs. TrEMBL
Match: A0A0H3YJX4 (Slc2a-9 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc2a-9 PE=2 SV=1)

HSP 1 Score: 627.091 bits (1616), Expect = 0.000e+0
Identity = 331/516 (64.15%), Postives = 398/516 (77.13%), Query Frame = 1
Query:  157 KIEVYFTRQYIHHIIFPMIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYIT------VLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEE----NSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 1674
             IEV +T Q+IH+I FP+IGGFMFG+VTG+V       +F    +  +  GAL +SL TG L DRFGRKK II+SC+F I+GSLI+ +  +    +   L+GIG+G+  TCCPLYIAE+TPK+IRGR+IT+YQ+ +TFG+ LAS+V A++     +Y +      +L TP +PA+ +LIGMLTV ESYRWLL+KNR DEA EV+RKLKQ+ ES+I EFV+ ILEAN++IEE+      QK+F+L RIL +KIARK+L+ GC +Q++ Q+ GIN ++Y +  LFQ +   + +  LWF  L+ F N I SFVAYKLIDKIGRRKLALISLFGII S VIIAVNLQLV VR LKRNQNNNC NFLSCDDC+NNICEYCQIDENSGYTCVNYGANCTNKGNY IYNFDN CTN INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALST A WL    CNL  T   F+R  Y  FWIY AFTICGIALIYK FPE NQ ++E++ +VL
Sbjct:   31 NIEVLYTNQFIHYITFPIIGGFMFGYVTGTVP--DVYGIFHMFMVATIAGGALLSSLPTGYLADRFGRKKTIILSCLFYIVGSLISFNYRVVIA-VGRFLIGIGLGISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTYGSDTTTPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIEEDLQEQKEQKKFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIISSSVIIAVNLQLVDVRYLKRNQNNNCRNFLSCDDCINNICEYCQIDENSGYTCVNYGANCTNKGNYPIYNFDNHCTNNINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTAKWL----CNLTVTMTVFTRRLYETFWIYSAFTICGIALIYKNFPEMNQANMEEILHVL 539          
BLAST of Proton myo-inositol cotransporter vs. TrEMBL
Match: A0A0H3YIU7 (Slc2a-10 OS=Schmidtea mediterranea OX=79327 GN=slc2a-10 PE=2 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 5.708e-111
Identity = 218/536 (40.67%), Postives = 319/536 (59.51%), Query Frame = 1
Query:  175 TRQYIHHIIFPMIGGFMFGHVTGSVS--INKTNDLFFYLNLPI------LILGALFASLLTGSLVDRFGRKK-MIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKS-YITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEAN----IVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRN--QNNNCSNFLSCDDCL-NNICEYCQIDEN------------------SGYTCVNY-GANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 1674
            +R +I  IIFP+IGGFMFG+ TG +S  +    D F    +         +L A  +SL+TG L D  GRKK +II    F I   ++ +S          + VG G+G+   CCP+YIAE++P  IRGR+I +YQ+SIT G+  A++V AS     K  +  +L    IP+ I  IGMLTV ESYRWLL+KN+ DEA+ +I    Q+ E  I E++  I+ AN    + ++E     R ++F+I RN +AR+SLL GC +Q++ QI GIN I+Y + L+ +        T LW  +L+ FFNFIPSF+ + LIDKIGRRKL++ SL  ++ SL+ IA+  Q++  +  K     NN C   ++C++C+ ++ C +C I                     S Y+   +   N T+  + +I+N+D  C +  +W++++G+ILY+ISF+IGMGPIPW +TSEIYP WCRSTNMALST   W+ N I +L F ++  +   Y  FW+Y +F   GI  IYK+ PETNQ  LE++N +L
Sbjct:   21 SRSFIWQIIFPIIGGFMFGYDTGVISGALLLIRDHFHLSTISQEIVVSGTVLSAALSSLITGWLSDWIGRKKTIIISCICFIIGSIIMGISQNFIMLVFGRIFVGFGVGISAACCPVYIAEVSPHQIRGRLIVIYQISITGGMFFAALVDASFFYLGKEGWRYMLGGAAIPSFIEFIGMLTVPESYRWLLSKNKVDEARTIIVNQGQVPEERITEYIDEIVRANQQIQMQVKEHEGNSRSLIFQIFRNDVARRSLLIGCGLQMLQQIIGINTIMYYTALVIRMSGVKDISTILWLSALVAFFNFIPSFIGFILIDKIGRRKLSISSLCCVLLSLITIAITFQVLVSQSEKVTYPSNNYCGKKINCEECVTSSACGFCYIPNAINKSIVLNTSCLATQTHFSKYSSSGWCSQNATHFVSNAIWNYDF-CVSKYSWVIIVGLILYLISFSIGMGPIPWAITSEIYPLWCRSTNMALSTSTNWVFNLIVSLTFLSLTEAITKYGTFWLYSSFAFFGILFIYKFVPETNQRSLEEINDLL 555          
BLAST of Proton myo-inositol cotransporter vs. TrEMBL
Match: A0A1S3IAC6 (proton myo-inositol cotransporter isoform X2 OS=Lingula unguis OX=7574 GN=LOC106162381 PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 6.436e-74
Identity = 171/522 (32.76%), Postives = 273/522 (52.30%), Query Frame = 1
Query:  199 IFPMIGGFMFGHVTGSVSIN--------KTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIA-PKYI---TNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIE-EFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLK---RNQNNNCSNFLSCDDCLNNI-CEYCQIDENSGYTCVN---------------YGA-NCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            +F  IGGF+FG+ TG VS          + + L+  L + + I  A   +L+ G L D FGRK +I+ + +   +GS+I    G+A  KY+     ++VGI IG+   C P+Y+AE  P  +RGR++ LYQ+ IT GIL+A++     C  ++ +  +L    IP+ I  +G L + ES RWL+TK R D+A+ V++ ++ + +   E + +K   E +  +E     +R +L  +L+    R++L+ GC +QI+ Q+ GIN ++Y S  + +        TA+W  ++    NF+ +FV   L++KIGRR L L SL G I SL  +A+  QL  +           N C+   +CD C+ ++ C +C  D N+  T VN               YG  N T+      + +D  C    +W+ ++G++ Y++ FA GMGP+PW + SEIYP W RST  A +T   W CN + ++ F  +  S   Y  FW+Y      G   +    PET    LE+M 
Sbjct:   37 LFSAIGGFLFGYDTGVVSGAMILLREEFRLDSLWQELIVSVTIGAAAVFALVGGVLNDSFGRKPVIVTASLIFTVGSIIM---GLAIDKYMLLAGRIVVGIAIGLASACIPMYVAECAPSPLRGRLVVLYQLLITAGILVAAVCDGLFCYVEQGWRYMLGLAGIPSAIQFLGFLFMPESPRWLITKQRDDQARRVLQSIRGVLDVDDEFDGIKKSCEED-EMELRERGRRPVLLIMLQTPAVRRALIIGCSLQIVQQLVGINTVMYYSATIIKMSGIRDKSTAIWLSAVTAAVNFVFTFVGLYLVEKIGRRPLTLGSLIGAIVSLAWLAIGFQLNALHSPPITVVEAVNPCNQHSTCDQCMVDLSCGFCYNDANN--TAVNGSCLATSYDDPLTSLYGRCNSTSLPGSVAWAYDY-CPTSFSWMAMVGLVSYLVFFAPGMGPMPWTINSEIYPLWARSTGNAAATFWNWTCNLLVSMTFLTLTESLTRYGTFWLYAGLGTIGFIFLLILLPETKGKSLEEME 551          
BLAST of Proton myo-inositol cotransporter vs. TrEMBL
Match: A0A2P2IC98 (Proton myo-inositol cotransporter-like OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 2.502e-71
Identity = 162/547 (29.62%), Postives = 288/547 (52.65%), Query Frame = 1
Query:  127 VHLNHQQLKNKIEVYFTRQYIHHIIFPMIGGFMFGHVTGSVSIN--------KTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLI-TLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRR----LKRNQNNNCSNFLSCDDC-LNNICEYCQIDENSGYT---C----------VNYGANCTNK---GNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF 1677
            +    Q      E   TR  +   +F  IGGF+FG+ TG VS          + + ++    +   I  A  ASL +G+L D +GR+++II   +   +GS++   SPG     +  ++VG+ IG+   C PLY++E     +RGR+     V +T G   AS+V A +   D  +  +    ++PAI   +G L + ES RWL+ ++R +EA+EV+++ + + ++ +++ +  I+ AN   +++ S     L RI   +  R++L+ GC +Q   Q+AGIN ++Y S  +          TA+W  + +  FNF+ +FV   L++++GRR L L+SL G++  L+ +AV+ QL Y       +  N  + CSN+ SC  C  +  C +C  +++S Y+   C          ++   +CT+    GN   Y++   C +  + + +LG+ LY++ FA GMG +PW + SE+YP W RS  + ++T   W  N I +L F ++  +   +  F+++ A +  G+A+ Y + PET  + +E   ++LF
Sbjct:    1 METEEQTADTSPEGGLTRAMVVLTLFSAIGGFLFGYDTGVVSGAMLLVREDFELSTIWHECIVSATIAAAWLASLASGALADWYGRRRVIIAGSLLFTVGSVVMAASPGKGVLLLGRIIVGLAIGLASMCVPLYLSETAESGLRGRLTVTNVVFVTGGQFFASLVCAGLVTVDDGWRWMFGLAIVPAITQFVGFLFMPESPRWLVQQDRLEEAREVLQRFR-VSDAVVDKELHDIVAANE--DDKESSSGATLSRIFSTRSVRRALILGCLLQAFQQLAGINTVMYYSASIITMAGIGDPNTAIWISAGVASFNFVFTFVGLWLVERVGRRPLLLVSLAGVVLCLLELAVSFQLAYYDSPGIDMPTNMTSECSNYTSCSTCTFSQECGFCFPEDDSSYSNSSCLQADHDHFNQMSMSGDCTDPSALGNTFAYDW---CPSAYSALAILGLCLYLLCFAPGMGTMPWTINSELYPGWARSRCVGIATSFNWCSNLIVSLTFLSLTQAINKHGTFYLFSAVSAVGLAVFYWWLPETRSVSMEH-THLLF 540          
BLAST of Proton myo-inositol cotransporter vs. TrEMBL
Match: A0A1W5BE03 (proton myo-inositol cotransporter-like isoform X3 OS=Ciona intestinalis OX=7719 GN=LOC100179926 PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 8.379e-69
Identity = 167/545 (30.64%), Postives = 270/545 (49.54%), Query Frame = 1
Query:  136 NHQQLKNKIEVYFTRQYIHHIIF-PMIGGFMFGHVTGSVSIN--------KTNDLFFYLNLPILI-LGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLI-TLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRK-DKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLK--------RNQNNNCSNFLSCDDCLNNI-CEYCQ--------------IDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
             H      ++   T ++++ + F   IGGF+FG+ TG VS            N+L+  L + I +   ALFA  + G L    GR+K+I+ + V   +GS++  L+ G         +VG+GIG+     P+YIAE++P  +RGR++++  + IT G  +AS V  +     +  +  +L    IPA I  IG + + ES RWL+ K+++D A   ++K+   +     EF KI       + EE +Q +  L R+  +   R++++ GC +Q+  QI+GIN ++Y S  + Q     +   A+W  ++  F NF  + V   L++K+GRR L L+SL G++ SL+ ++    L  +             N  + C  F SC  C+ +  C YC               +  N   T ++   NC+ K   S Y   N C    +W+ L GMILY+  FA GMGP+PW + SEIYP W RS   A S G  W+ N + +L F ++  +  +   F +Y  F  CG   I+ + PET    LE++ 
Sbjct:   27 EHNAPATVVKPQTTNKFVYVLTFFSAIGGFLFGYDTGVVSGAMIILKQKFALNNLWQELIVAITVGFAALFA-FMGGPLNTWLGRRKVIMFASVVFTVGSIVLALASGKEMLLCGRAVVGVGIGLASMTVPMYIAEVSPSNVRGRLVSINNLFITGGQFVASCVDGAFSSDVEDGWRYMLGLAAIPATIQFIGFIFLPESPRWLIQKHKEDLAIRSLQKIISDESDIRREFEKI----KTSMLEEQTQGKVTLTRLFSDISVRRAIMVGCALQLFQQISGINTVMYYSATIIQMSGVRNNTLAIWLAAVTAFVNFCFTIVGVWLVEKVGRRLLTLVSLGGVVVSLLFLSTGFFLSALHSPPVTMNSTDILNDTSGCFKFKSCVGCMQSTACGYCYTQYGQPWNVTQATCLPTNPDNTQLSLLGNCSTKHEGSPYFASNYCPTKYSWMALAGMILYLAFFAPGMGPMPWTINSEIYPQWARSAGNAFSAGTNWVFNVVVSLTFLDVTTALTYQGAFLLYAGFAFCGFIFIFLFLPETKGKPLEEVQ 566          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc2a13b (solute carrier family 2 member 13b [Source:ZFIN;Acc:ZDB-GENE-090812-1])

HSP 1 Score: 203.756 bits (517), Expect = 3.280e-58
Identity = 142/459 (30.94%), Postives = 236/459 (51.42%), Query Frame = 1
Query:  352 FGRKKMIII-SCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICR-KDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVY-----VRRLKRNQNNNCSNFLSCDDC-LNNICEYCQIDENSGYTCVNYGANCTNKGNYS-------------IYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
             GR+  I++ S +F + G +++LSP      +  ++VG+GIG+     P+YIAE++P  +RG+++T+  + IT G  +AS+V  +        +  +L    +PA++  IG L + ES RWLL K R  +A+EV+  ++   E+  EEF  I        +E  S    +L+RIL +  AR++L+ GC +Q+  Q++GIN ++Y S  + Q       + A+W  +   F NF+ + V   L++   + KL L+   G   SL ++AV   L       V     + N  CS++  C++C L+  C +C     +G T ++   +  +  N                YN+   C    +WI++LG++LY+  FA GMGP+PW V SEIYP W RST  A S G  W+CN + +L F ++     +Y  F++Y    + G   +    PET  + LE + 
Sbjct:   40 LGRRLCILLASFIFSVGGVVLSLSPNKEVLLVGRLIVGLGIGIASMTVPVYIAEVSPSHLRGQLVTINTLFITGGQFIASVVDGAFSYLSHGGWRYMLGLSAVPAVLQFIGFLFLPESPRWLLQKGRSQQAREVLTHIRA-TENVDEEFNNIKNIIEEEEKE--SGGGLVLWRILTSAPARRALVVGCGLQMFQQLSGINTVMYYSATILQMAGVRDDKMAIWLSAATAFTNFLFTLVGVWLVEH--KTKLYLLLSSGTTVSLSVLAVGFLLSAQASPPVTIHPTSLNTTCSHYGFCENCMLDPACGFCY--RENGSTILSSSCDPVDPANTDEACKFIIHALCIWAYNY---CPTPYSWIVMLGLLLYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWICNVLVSLTFLHVAEYLTYYGAFFLYSGLALLGFFFVLGCLPETKGLMLEDIE 488          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Cavefish
Match: SLC2A13 (solute carrier family 2 member 13 [Source:NCBI gene;Acc:103031966])

HSP 1 Score: 201.83 bits (512), Expect = 1.530e-56
Identity = 146/466 (31.33%), Postives = 254/466 (54.51%), Query Frame = 1
Query:  352 FGRKKMIII-SCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICR-KDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEEN-SQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL-------VYVRRLKRN-QNNNCSNFLSCDDC-LNNICEYCQIDENS----GYTCV----------NYG--ANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
             GR+  +++ SCVF I G +++ +PG     +  +LVG+G+G+     P+YIAE +P  +RG+++T+  + IT G  +AS++  +    +   +  +L    +PA++   G L + ES RWL+ K    +A+ V+ +++  Q    EE+  I  +++I  EE++      +L+R+L    AR++L+ GC +Q+  Q++GIN ++Y S  + Q       + A+W  SL    NF+ + +   L++K+GRR+L+L S+ G   SL ++A    L       V +     +  N++C+ +LSC+ C L+  C +C   +NS      +CV           +G  +N T   ++S++ + N C    +W++LLG+ILY+  FA G+GP+PW V SEIYP W RST  A S G  W  N + +L F ++     +Y  F++Y + ++ G   IY   PET    LE++ 
Sbjct:  157 LGRRVCVLLASCVFAIGGVVLSAAPGKEVLLVGRLLVGLGLGISSMTVPVYIAEASPPHLRGQLVTVNTLFITAGQFVASLIDGAFSYVQHGGWRYMLGLSAVPALVQFFGFLFLPESPRWLIQKGLTQKARRVLSQIRGNQNID-EEYESI--KSSIEEEEKDCGGDGPILWRMLTYPPARRALIVGCGLQMFQQLSGINTVMYYSATILQMSGVRDDKLAIWLSSLTALTNFLFTLLGVWLVEKVGRRRLSLGSIIGTSVSLCLLAFGFLLSAQHSPPVTIHPTDPSLANSSCTRYLSCEPCMLDPSCGFC-YQQNSTAVFAASCVPVNQASTERAAWGRCSNSTQSADHSLWAY-NFCPTSYSWVVLLGLILYLAFFAPGLGPMPWTVNSEIYPLWARSTGNACSAGVNWTFNVLVSLTFLHLAQYLTYYGAFFLYSSLSLLGFFFIYGCLPETKGRRLEEIE 617          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc2a10 (solute carrier family 2 member 10 [Source:NCBI gene;Acc:103042379])

HSP 1 Score: 122.479 bits (306), Expect = 2.844e-29
Identity = 125/499 (25.05%), Postives = 224/499 (44.89%), Query Frame = 1
Query:  211 IGGFMFGHVTGSVSINKTN-DLFFYLN-------LPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVL-VGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKI-ARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENS-GYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 1674
            +GG +FG+  G +S         F+L        +  L++GA+FASL+ G L+DR GR+  I++S +  + GSLI  S       +   L VG  I +    C ++++EM P   RG ++TLY+  +T GIL+A  V   +    + +  +    + P +  L+ +        W+L    +    +++   + + +   EE       +N V+++    KRF +F + + K   R   L G  + +  Q  G   +L+ +  +FQ     +  +A+     +     + +FVA    DK GRR L       +I    ++A  L L+ +  L RN   + +   S + C NN     Q+ +N      +    + T+ G   +     P     NW++L+ M+  V +F++  GP+ W++ SEI+PA  R    A +    W+ N I +  F ++  +      F+IY    +  +A IY   PET    L+ ++  L
Sbjct:   15 LGGLVFGYELGIISGALMQLKAQFHLTCVQQETVVSALLIGAVFASLVGGWLIDRHGRRTSILVSNLLLLCGSLILSSSNSFLMLVVGRLSVGFAICISSMSCCIFVSEMVPSHRRGLMVTLYEAGVTVGILVAYAVNYVLAGVLEGWRYMFGLAVAPCLAQLVSV--------WVLPSQNQGLV-QLVPDSQNMSDCPEEE-----PSSNQVLKD---HKRFTIFHLFQRKDNLRSRTLIGLGLVLFQQFTGQPNVLFYASTIFQSMGFKNNASAILASLGLGIVKVVATFVAMLCADKAGRRPL-------LIGGCSVMA--LGLILIGFLSRNSLLDATRHCSSEPCFNNTM---QVHKNPMELDLMKISNHTTDAGLLDM----PPAMGSYNWLILICMMSVVAAFSVSFGPMTWLILSEIFPAELRGRAFAFTNFFNWVANLIVSFSFLSVIDAIGLSGTFFIYGVIAVAAVAFIYFLLPETKGKSLQDIDQEL 480          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc2a3b (solute carrier family 2, facilitated glucose transporter member 3-like [Source:NCBI gene;Acc:103028878])

HSP 1 Score: 115.161 bits (287), Expect = 9.830e-27
Identity = 101/415 (24.34%), Postives = 197/415 (47.47%), Query Frame = 1
Query:  307 GALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTC----CPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKS-YITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIF 1536
            G + +S+  G+LV++FGR K +++S    +IG  +         Y   +L  + IG+ C       P+Y+ E+ P   RG   TL+Q++I  GIL+A I+   +    +  +  +L    +PA++  + ++  SES R+LL   +++E    I  L + QE   ++  ++  EA+ +    N +++  +  + RN I R+ ++    + +  Q +GINA+ Y S  +F+  + +S       G+ I   N + + V+  L+++ GRR L +  L G+    +++ + LQLV        Q + C+  + C+                              G  ++ +  +  T  I+++ +L +  +V SF IG GPIPW + +E++    R   +A+   + W+ NF+  + F
Sbjct:   80 GGMVSSVFVGALVNKFGRTKSMLLSNTLALIGGALMGLASACRSYEMVILGRLVIGLFCGLYTGLTPMYVGELAPTAQRGAFGTLHQLAIVIGILIAQILGLEVLLGSEYLWPLLLGLTALPAVLQSVMLIFCSESPRYLLINLKQEEEARRILVLLRGQEDVEDDIREMKEEADKL----NQEQKVSIPELFRNPIYRQPIIIAIVMNVSQQFSGINAVFYYSTQIFKS-SGVSEPIYATIGTGI--INTVFTVVSLFLVERAGRRTLQMFGLGGMAICALVMTIVLQLVL--DPCAPQEDLCAAPVVCN------------------------------GTVAVTSDASSKTPVISYVAILAVFGFVASFEIGPGPIPWFIATELFAQDARPAAVAVGGCSNWISNFLVAMFF 455          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc2a3b (solute carrier family 2, facilitated glucose transporter member 3-like [Source:NCBI gene;Acc:103028878])

HSP 1 Score: 97.8265 bits (242), Expect = 3.460e-21
Identity = 95/400 (23.75%), Postives = 183/400 (45.75%), Query Frame = 1
Query:  358 RKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTC----CPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKS-YITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCL--NNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIF 1536
            R K +++S    +IG  +         Y   +L  + IG+ C       P+Y+ E+ P   RG   TL+Q++I  GIL+A I+   +    +  +  +L    +PA++  + ++  SES R+LL   +++E    I  L + QE   ++  ++  EA+ +    N +++  +  + RN I R+ ++    + +  Q +GINA+ Y S  +F+  + +S       G+ I   N + + V+  L+++ GRR L +  L G+    +++ + LQLV                   D C    ++C                 A     G  ++ +  +  T  I+++ +L +  +V SF IG GPIPW + +E++    R   +A+   + W+ NF+  + F
Sbjct:   45 RTKSMLLSNTLALIGGALMGLASACRSYEMVILGRLVIGLFCGLYTGLTPMYVGELAPTAQRGAFGTLHQLAIVIGILIAQILGLEVLLGSEYLWPLLLGLTALPAVLQSVMLIFCSESPRYLLINLKQEEEARRILVLLRGQEDVEDDIREMKEEADKL----NQEQKVSIPELFRNPIYRQPIIIAIVMNVSQQFSGINAVFYYSTQIFKS-SGVSEPIYATIGTGI--INTVFTVVSLFLVERAGRRTLQMFGLGGMAICALVMTIVLQLV------------------LDPCAPQEDLC----------------AAPVVCNGTVAVTSDASSKTPVISYVAILAVFGFVASFEIGPGPIPWFIATELFAQDARPAAVAVGGCSNWISNFLVAMFF 403          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002434.1 (pep scaffold:Pmarinus_7.0:GL479978:1522:11010:-1 gene:ENSPMAG00000002223.1 transcript:ENSPMAT00000002434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.951e-12
Identity = 48/181 (26.52%), Postives = 90/181 (49.72%), Query Frame = 1
Query:  850 FMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA--------VNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINW 1368
            ++L++++++   R++L+ GC +Q+  Q+AGIN ++Y S  + Q        TA+W  S   F NFI S +   L++++GRR+L+LIS+ G I SL ++          +  ++         N++C  +        ++CE C +D   G+    +G N ++    S    D   T+   W
Sbjct:    2 WVLWKMIKHPPTRRALVVGCGLQMFQQLAGINTVMYYSATILQMAGVADDSTAIWLASATAFTNFIFSALGVWLVERVGRRQLSLISMAGAIVSLALLGCAFLLASQTSPPVILHPHDPAVTNSSCMAY----SVGRSVCETCMLDPYCGFC---FGMNGSHVDKSSCLPADPDNTDQATW 175          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: SLC2A9 (solute carrier family 2 member 9 [Source:HGNC Symbol;Acc:HGNC:13446])

HSP 1 Score: 67.0106 bits (162), Expect = 4.565e-12
Identity = 103/478 (21.55%), Postives = 198/478 (41.42%), Query Frame = 1
Query:  256 NKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIG----SLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPL-IPAIIVLIGMLTVSESYRWLLTKNRKDEAKE-VIRKL---KQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYF--FNFIPSFVAYKLIDKIGRRKLALISL--FGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYF--PETNQ 1644
            + +  L +   + I+ +G L  +L+   +V RFGRK  ++++    I+     SL  L+      ++   +VGI  G+  +  P+Y+AE++PK +RG    +  + I  G+    ++        +S+ ++L   L +P ++ L  +  + ES R+LL + +  +A E  +++L   + +Q   +E   + I +A+I +    S    +  R +R ++   ++   CY              Y S +    F     + A+    +I       + + ++   I+K+GRR L ++      +IF ++ +A+NLQ  Y          +  ++LS    L  I  +C                                                    IG G IP+V+T E++    R     ++    WL NFI +L+F  I  +   Y+ F ++ A  +C  A I+ YF  PET +
Sbjct:   20 DNSVTLLWSFTIAIMSIGGLVGALIMRFMVQRFGRKGTLLLNNALAILAALLMSLCFLAGSWEMLFLGRFVVGIDAGISLSVLPMYLAEISPKNLRGSTGQVSAIFICLGVFTGQVLNLKEVLGQESHWSILFGILVVPPLVQLATLPFMPESPRYLLLERQDVKAAEKALQRLLGRQDVQREMVEIQAEGIAQAHISV---MSLWGLLRERAVRWQVITVAITMACY----QLCGVNAIWFYASSI----FRQAGIDPAITPYIIISTGGTEVLAALLSGLAIEKLGRRSLLIVGFGAMAVIFGVLTVALNLQDSY----------HWMSYLSIACVLAVIASFC----------------------------------------------------IGPGGIPFVLTGELFEQSYRPAAFTIAGIVSWLSNFILSLVFPFIQTALDAYS-FLVFAA--VCLGAAIFLYFVLPETKK 421          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: oct2 (organic cation transporter 2 [Source:ZFIN;Acc:ZDB-GENE-080204-92])

HSP 1 Score: 52.373 bits (124), Expect = 2.254e-7
Identity = 45/191 (23.56%), Postives = 90/191 (47.12%), Query Frame = 1
Query:  265 NDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVF-CIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEE 834
            N     L+  +L +G L  ++L G + DR+GR+  +++S V   I G L+  +P  A       L GI      T   +   E      R  V  + Q+  +FG+++ S +   +  +   Y+ +  T  +P +++      + ES RWL+++NRK++A  V++K+  +    + + ++   E     +E+
Sbjct:  152 NAWLLDLSQALLNVGLLVGAILMGYVSDRYGRRWSLMVSIVMQTIFGVLVAFAPNYAAFVCMRTLQGIFNMGSWTTVFVTATEFVGSGQRRVVHMVLQMFFSFGVIMLSGIAYYL--RTWRYLQLALT--LPNVVLFSYYWLLPESPRWLISQNRKEQAFGVLKKIASVNGRELSDNIRKNFEEVTRADEK 338          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006105.1 (pep scaffold:Pmarinus_7.0:GL483550:10411:12132:-1 gene:ENSPMAG00000005515.1 transcript:ENSPMAT00000006105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 4.070e-7
Identity = 28/108 (25.93%), Postives = 44/108 (40.74%), Query Frame = 1
Query: 1351 TNYINWILLL---GMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            T  + W+ L    G+      F++G GPIPW+V SE++P   R     +     W+  F+     +       F   FW + +    G  L     PET    LE++ 
Sbjct:   51 TGSLGWLALASMAGLHRRCGRFSLGWGPIPWIVMSEVFPVRWRGVASGVCVAVNWISAFVVTKPTSAAVEWLGFPGAFWFFASVCAAGFVLTIVALPETKGRSLEQIQ 158          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: slc2a10 (solute carrier family 2 member 10 [Source:NCBI gene;Acc:560546])

HSP 1 Score: 49.6766 bits (117), Expect = 9.445e-7
Identity = 62/285 (21.75%), Postives = 123/285 (43.16%), Query Frame = 1
Query:  334 GSLVDRFGRKKMIIISCVFCIIGS-LITLSPGIAPKYITNVLVGIGIGV--ICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLT----------TPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIE-EFVKIILEANIVIEEENSQKRFMLFRILRNKIA-RKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVII 1143
            G L+DR GR+  +  S    + GS  +  +P  A       +VG+ I    + TC  +Y+AE+     RG +++ Y++ +T G+L A      + R     +  +            P +  +++L+  L  S S   LL   + + A+  +R++   Q+ S E + ++  LE          +K++ +  +LR K + R  +L G  +    Q+ G   +L+ +  +F+        + L     +       + VA  ++D++GRR+  L     +  SL  +
Sbjct:   64 GPLLDRLGRRSAVACSGALLVTGSAFLACAPSYAALLGGRAVVGVAIAASSVATC--VYVAEVAHPRRRGALVSAYELGVTGGVLAAYAANLVLGRGPGGTVGGVAPWRWMFGLCCVPALAQVMLLVACLPASPSS--LLRCGQAEAAERTLRRILGQQDVSAEIDALRSSLE---------MEKQYSVLDLLRRKDSMRTRMLIGGGLVAFQQLTGQPTVLFYAASVFRAAGYRGEASVLLASVGLGLVKVAATSVAVAVVDRVGRRRSLLAGSVAMALSLAAV 335          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Yeast
Match: HXT2 (High-affinity glucose transporter of the major facilitator superfamily; expression is induced by low levels of glucose and repressed by high levels of glucose [Source:SGD;Acc:S000004613])

HSP 1 Score: 107.071 bits (266), Expect = 5.662e-25
Identity = 132/514 (25.68%), Postives = 216/514 (42.02%), Query Frame = 1
Query:  214 GGFMFGHVTGSVS--INKTN----------DLFFYLN-------LPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIA--PKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPL----IPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIV---IEEENSQKRFMLFRILRNKIA-RKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFN-NMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            GGF+FG  TG++S  +N+T+          D  +YL+       + I  +G  F  L  G L D +GR+  ++   +  I+G +I ++        +I  ++ G+G+G I    P  I+E  PK IRG  ++ YQ+ IT GI L          KD S       PL      AI ++ GML V ES R+L+ K R ++AK   R L +  + +IE+   I+ E + +   +E E          +  NK A    ++ G  IQ + Q+ G N   Y    +F       S++T++  G      NF  +FVA   +DK GRRK     L G   S+ I  V    V V  L  N  +                                                 P +     ++++   L++  FAI   PI +V+ +E YP   ++  MA++ GA W+  F+    FT    S I ++  +++    +     ++ +  ET  + LE++N
Sbjct:   66 GGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGT--KDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAK---RSLAKSNKVTIED-PSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLG----IVNFASTFVALYTVDKFGRRKC----LLGGSASMAICFVIFSTVGVTSLYPNGKD------------------------------------------------QPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGF-FTPFITSAIGFSYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVN 516          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Yeast
Match: HXT13 (Putative transmembrane polyol transporter; supports growth on and uptake of mannitol and sorbitol with moderate affinity when overexpressed in a strain deleted for hexose family members; minor hexose transport activity when overexpressed in a similar strain; induced by non-fermentable carbon sources; induced in low glucose, repressed in high glucose; HXT13 has a paralog, HXT17, that arose from a segmental duplication [Source:SGD;Acc:S000000795])

HSP 1 Score: 106.301 bits (264), Expect = 9.842e-25
Identity = 101/463 (21.81%), Postives = 201/463 (43.41%), Query Frame = 1
Query:  304 LGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIA--PKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLA--SIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESS---IEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFN-NMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA-VNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            +G     L+   L D  GR+  I+I  +  ++G++I +S        ++  ++ G+G G     CP+ ++E+ P  +RG +++LYQ+++TFGI L   S+           +   L    + A+I++IGML V ES R+L+   R +EA+  I K+ ++       +++  +I   A ++ + E  +  +     ++ K+ ++ L+ G  +Q   Q+ G N   +    +F+       +ET++  G++    NF  + +A  ++DKIGRRK  L    G++  +VI A + ++ +Y        +    N +                    +TC                                    Y+  FA    P+ ++V +E +P+  +S  M++ST   WL  F+    FT      I +   +++    +     ++ + PET  + LE++ 
Sbjct:  117 IGCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWALIIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEI--NAGVLAQRELGEASWKELFSVKTKVLQR-LITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGTV----NFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGNAMIV------------------FTC-----------------------------------FYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGF-FTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQ 518          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Yeast
Match: HXT17 (Putative transmembrane polyol transporter; supports growth on and uptake of mannitol and sorbitol with moderate affinity when overexpressed in a strain deleted for hexose family members; minor hexose transport activity when overexpressed in a similar strain; induced by raffinose and galactose at pH 7.7 versus pH 4.7, repressed by high levels of glucose; HXT17 has a paralog, HXT13, that arose from a segmental duplication [Source:SGD;Acc:S000005355])

HSP 1 Score: 104.76 bits (260), Expect = 3.317e-24
Identity = 100/463 (21.60%), Postives = 200/463 (43.20%), Query Frame = 1
Query:  304 LGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIA--PKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLA--SIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESS---IEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFN-NMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA-VNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            +G     L+   L D  GR+  I+I  +  ++G++I +S        ++  ++ G+G G     CP+ ++E+ P  +RG +++LYQ+++TFGI L   S+           +   L    +  +I++IGML V ES R+L+   R +EA+  I K+ ++       +++  +I   A ++ + E  +  +     ++ K+ ++ L+ G  +Q   Q+ G N   +    +F+       +ET++  G++    NF  + +A  ++DKIGRRK  L    G++  +VI A + ++ +Y        +    N +                    +TC                                    Y+  FA    P+ ++V +E +P+  +S  M++ST   WL  F+    FT      I +   +++    +     ++ + PET  + LE++ 
Sbjct:  117 IGCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWTLIIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEI--NAGVLAQRELGEASWKELFSVKTKVLQR-LITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGTV----NFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGNAMIV------------------FTC-----------------------------------FYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGF-FTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQ 518          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Yeast
Match: ITR1 (Myo-inositol transporter; member of the sugar transporter superfamily; expression is repressed by inositol and choline via Opi1p and derepressed via Ino2p and Ino4p; relative distribution to the vacuole increases upon DNA replication stress; ITR1 has a paralog, ITR2, that arose from the whole genome duplication [Source:SGD;Acc:S000002905])

HSP 1 Score: 101.679 bits (252), Expect = 3.243e-23
Identity = 95/338 (28.11%), Postives = 172/338 (50.89%), Query Frame = 1
Query:  211 IGGFMFGHVTG-------SVSINKTNDLFFYLNLPILI----LGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKY-ITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVI-RKLKQLQESSIEEFVKIILEANIVIEEEN-SQKRFMLFRILRNKIAR-KSLLFGCYXXXXXXXXXXXXXLYNSPLLFQY--FNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVR 1173
            I GFMFG+ TG       S+  +  + +  Y    I+     LGAL  S+  G+  D FGRK+ ++ S +  +IG+++ +S     +  +  +++G G+G+     PL+I+E+ PK+IRGR+  +  + +T G L+A    A +   +  +  ++   LIP  +    +  + ++ R+ + K     A EV+ R      E  IE  V+ ++  N  I  +N  +K +   + L    +  ++L+ GC +Q I Q  G N+++Y S  +F+   F N S  + +  G+     NFI + VA+  IDKIGRR + LI L G+  +LV+ ++    + ++
Sbjct:   95 ISGFMFGYDTGYISSALISIGTDLDHKVLTYGEKEIVTAATSLGALITSIFAGTAADIFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVGRLIMGFGVGIGSLIAPLFISEIAPKMIRGRLTVINSLWLTGGQLVAYGCGAGLNYVNNGWRILVGLSLIPTAVQFTCLCFLPDTPRYYVMKGDLARATEVLKRSYTDTSEEIIERKVEELVTLNQSIPGKNVPEKVWNTIKELHTVPSNLRALIIGCGLQAIQQFTGWNSLMYFSGTIFETVGFKNSSAVSIIVSGT-----NFIFTLVAFFSIDKIGRRTILLIGLPGMTMALVVCSIAFHFLGIK 427          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Yeast
Match: GAL2 (Galactose permease; required for utilization of galactose; also able to transport glucose [Source:SGD;Acc:S000004071])

HSP 1 Score: 99.7525 bits (247), Expect = 1.186e-22
Identity = 121/513 (23.59%), Postives = 218/513 (42.50%), Query Frame = 1
Query:  214 GGFMFGHVTGSVSI------------NKTNDLFFYLN-------LPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSP--GIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPL---IPAIIVLIGMLT-VSESYRWLLTKNRKDEAKEVIRKLKQL--QESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFN-NMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA-VNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            GGFMFG  TG++S              K  D   YL+       + I  +G  F  ++     D +GRKK + I     I+G +I ++        +I  ++ G+G+G I   CP+ I+E+ PK +RG +++ YQ+ IT GI L          K  S       PL       + +IG LT V ES R+L   N+ ++AK  I K  ++  ++ +++  + +I+ A I  E+      +      + K+ ++ LL G ++Q+  Q+ G N   Y   ++F+    + S+ET++    +I   NF  +F +   ++ +G RK  L+    ++  +VI A V +  +Y     +  +    N              C I     +TC                                    Y+  +A    P+ WV+T+E +P   +S  MAL++ + W+  F+    FT    S I +   +++    +     ++ + PET  + LE++ 
Sbjct:   81 GGFMFGWDTGTISGFVVQTDFLRRFGMKHKDGTHYLSNVRTGLIVAIFNIGCAFGGIILSKGGDMYGRKKGLSIVVSVYIVGIIIQIASINKWYQYFIGRIISGLGVGGIAVLCPMLISEIAPKHLRGTLVSCYQLMITAGIFLGYCTNYGT--KSYSNSVQWRVPLGLCFAWSLFMIGALTLVPESPRYLCEVNKVEDAKRSIAKSNKVSPEDPAVQAELDLIM-AGIEAEKLAGNASWGELFSTKTKVFQR-LLMGVFVQMFQQLTGNNYFFYYGTVIFKSVGLDDSFETSI----VIGVVNFASTFFSLWTVENLGHRKCLLLGAATMMACMVIYASVGVTRLYPHGKSQPSSKGAGN--------------CMIV----FTC-----------------------------------FYIFCYATTWAPVAWVITAESFPLRVKSKCMALASASNWVWGFLIAF-FTPFITSAINFYYGYVFMGCLVAMFFYVFFFVPETKGLSLEEIQ 531          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO46902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNS4])

HSP 1 Score: 220.705 bits (561), Expect = 7.019e-65
Identity = 157/518 (30.31%), Postives = 261/518 (50.39%), Query Frame = 1
Query:  202 FPMIGGFMFGHVTGSVS--------INKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLV-GIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASIC-RKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNN-------NCSNFLSCDDCLN-NICEYCQIDENSGY----TCVNYGANCTNKGNY-------SIYNFDN-PCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            F  IGGF+FG+ TG VS        +   +D +  L +   I  A+  ++L G L D  GRK ++++       G+++    G     +   LV G+GIG      P+Y+AE  P  +RG+++TL  + IT G  +AS+V       +   +  +L    +P+II+  G + + ES RWL++K +  EA+  + K++    + ++  ++ +     V  +E S +  +L RILR    R++LL GC +Q I Q+ GIN ++Y S  +       + +T++W  + I F N + + V   L+++IGRRKL L SL G+I SL ++     L      K +          +C+N  +C DC+N   C YC   ++ G     +CV Y    T K  Y       S Y++    C +   W+  LG+++Y+ +FA GMGP+PW + SE+YP W RST  A ST   W+CN + ++ F ++         FW+Y    + G    + + PET    LE+++
Sbjct:   11 FAAIGGFLFGYDTGVVSGAMILISEVFHLSDFWHELIVSGTIGTAIVGAVLGGILNDSLGRKPVLVLCSGVFTAGAVVMGVAGTKHVLLVGRLVIGLGIGGASMTVPIYVAEAAPSSMRGKLVTLNNLFITGGQFIASVVDGIFAYDRQNGWRFMLGLAAVPSIIMFFGCVILPESPRWLISKCKYAEARAALCKIRG--RTDVDRELEAVRRTCKVERKERSGQ--VLIRILRFPNTRRALLVGCMLQAIQQLCGINTVMYYSATIILMSGIGNSKTSIWLAAAIAFGNTLFTIVGIFLVERIGRRKLLLGSLAGVILSLFLLGGAFYLAMQHNPKVSTAETINPVFTHCTNQTTCMDCVNVRNCGYCYSTDSDGSILQGSCV-YANTSTTKAWYGRCHTQSSQYSWRYIACPSKYAWMAFLGLVIYIATFAPGMGPMPWTLNSEMYPLWARSTGNACSTAVNWICNLVISMTFLSLMGWITRPGAFWLYGCIAVAGWVFFFVFVPETKGKTLEELD 523          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO42862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E7])

HSP 1 Score: 110.153 bits (274), Expect = 7.465e-26
Identity = 105/408 (25.74%), Postives = 190/408 (46.57%), Query Frame = 1
Query:  295 ILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIG-SLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQY--FNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWL 1509
            ++ LGAL +S L G +VDRFGRK  +++S V   +G  LI  +   A  Y    + G+GIG+I    P YIAE++   +RG + +++Q+SIT G+LLA I         K     L   +IP ++V++ M  V E+ RW L  N +  A + +   +       +E  +I  E  +     ++ ++      LR  I R  L+ G  + +  Q+ G   +++N   +F+   F+N S   ++  G+  +  N I    A  ++DKIGRR L +     +  S + +    +L+ +       N++  N       +++I                                    ++YI+W+ +  +I++ ++F++  GP+PW+V SEI+P   R    +++T A W+
Sbjct:   89 LVTLGALASSPLGGFIVDRFGRKATLMLSAVPSELGWLLIAFAQNHAMMYAGRFIAGLGIGLIAVAVPTYIAEISSAKLRGALGSVHQLSITAGLLLAYIFGVFF----KWRAIALAGAIIPGVLVVL-MFCVPETPRWFLGHNERGAALKSLEWFRGPNGDIEQECFEI--ECTL-----DTHEKLTFSEFLRPAI-RNPLIVGVGLMVFQQLCGAIVVVFNCASIFKSAGFDN-SKAVSILLGASQFGANII----ACLIMDKIGRRILLMSMALLMCISHIGLGTYFELIII-----PSNSSLHNSTVHSGLIHSI-----------------------------------PSSYISWLAITCIIVFNVAFSLAWGPVPWLVMSEIFPLRARGVAGSIATSAAWV 438          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO42861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E6])

HSP 1 Score: 106.301 bits (264), Expect = 1.505e-24
Identity = 109/458 (23.80%), Postives = 201/458 (43.89%), Query Frame = 1
Query:  295 ILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIG-SLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            ++ LGA+  + L G  ++ FGRK  I+   V   +G  LI  +      YI   + G+ +G++    P+YIAE++   +RG + ++ Q+++T G+LLA  +   +    K      +  + PA++V++ M  V E+ RW L+  R+ +A + +   +  +    EE  +I  EA +   +  S   F    I++      +L+F        Q  GINAIL+NS      F+   ++ +     +I    F+ + +A  ++DK GR+ L   +  G+  SL+ +    +L Y+   +       +        L +I                         ++SI          I+W+ +  ++++ + FA+  GP+PW+V SEI+P   R    ++ST   W   F     F NI  +      +W Y   +  G   +  + PET    LE++ 
Sbjct:   50 LVTLGAILGAPLGGWTLEYFGRKGTIMACAVPFEVGWMLIAYANSHYMLYIGRFITGLAVGMVSLTVPVYIAEISSPSLRGMLGSVNQLAVTMGLLLAYSMGVVL----KWRWLACSGAIFPALLVVL-MFFVPETPRWSLSHKRRRDALDAMMWFRGPEADVEEECYRI--EATMDNTQSMSCAEFCRPAIMKPLFISIALMF------FQQFCGINAILFNSA---SIFHQAGFQDSKAVSVIIGAVQFVGTGIACLVVDKAGRKLLLWTTALGMTVSLIALGFYFEL-YIPTTQEQPTPTPA-------LLESI-------------------------HHSI------PAGKISWLAITSIVVFNLVFALAWGPVPWLVMSEIFPLQARGIASSISTLCNWSLAFAVTKTFVNIEDAITIQGTYWFYGGLSFLGFLFVLMFVPETKGKTLEQIE 452          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO32615 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUJ6])

HSP 1 Score: 105.531 bits (262), Expect = 2.545e-24
Identity = 120/497 (24.14%), Postives = 208/497 (41.85%), Query Frame = 1
Query:  205 PMIGGFMFGHVTGSVS-INKTNDLFFYLNL-------PILILGALFASLLTGSLVDRFGRK-KMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEEN-SQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            P+  G+  G+ + + + +   N    YLN         +L +GA+    + G L+D  GRK  +I+ S  FC    LI      A       + G+G+G+     P+YI+E      RG + ++ Q+ IT GIL++  +  +    D  +  V  +   PA ++++ M  + E+ RWL+ K ++  A++ +  L+       +E  +I  +A+I  + +  S K F    +LR  +   SL F        Q +GINA ++    +FQ      ++       LI    F+ S ++  LID+ GRR           F L++  V +                   +SC  C      Y  I  N G T V+                       I W+ +  + +Y++ FA+G GP  W++ SEI+P   R T   ++T   W C+F+    F+ +         F  + AF    +  +Y + PET    LE++ 
Sbjct:   10 PLSFGYCMGYSSAATTQLENKNATDLYLNADEITWFGSLLNIGAMLGGPIQGFLIDLIGRKFALILTSVPFCSGWLLIGFGKNAAMLNAGRFMSGLGVGMASLNVPVYISETASFSNRGAMGSINQLGITAGILISYAIGYAF---DWRWSAVAGS--FPAALLVVLMAFMPETARWLIAKKKETRARKTLLWLRGPDYDIDKELCEI--KASIDTQNQRFSLKEFKNPSLLRPFLISMSLHF------FQQFSGINAFMFYCATIFQ---KAGFKDPTGVPILIGAVQFVASAISLALIDRGGRR-----------FLLIVAGVGMS------------------ISCFTC----AVYFFITVNFGMTEVD-----------------------IAWLSVTSVAVYIVGFALGWGPCTWLIMSEIFPVRARGTATGIATFFNWFCSFVVTKTFSALIDGLTEAGTFCFFGAFVFASVLFVYFFVPETKGKTLEEIQ 434          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO35120 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMF8])

HSP 1 Score: 80.4925 bits (197), Expect = 4.450e-16
Identity = 74/297 (24.92%), Postives = 144/297 (48.48%), Query Frame = 1
Query:  250 SINKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPK----YITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVK-ASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTK-NRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGI 1122
            SI   +D  + + + I  +G +  +L      +RFGRK+ ++ +    I+G+L+      A       +   ++GI  G+     P+Y++E+ P  +RG + TL Q  I  G+L+  I     +    K +  +L   ++PA+  L+ +     S R+LL + +++ +A E +RKL+     + ++  + I E  I  + E + +   + ++   +  +  LL GC + +  Q+ GINA+LY S  +F+         A    + I     + + +A +L++ +GRR L LI L G+
Sbjct:   66 SIGNYSDFEWSIAVAIFAIGGMIGALAGPLFANRFGRKRSLLANNGLAIVGALLMFLSYFAKTSPLLTVGRFVIGINCGMNTAIAPIYLSELAPIHLRGSLGTLNQFGIVSGLLVGFIFGLKQVLGTSKGWQYLLGFSILPAVFQLVTLPWCPNSPRYLLIELDQELQAVEALRKLR-----ATDDVTEDINEMKIERDREATTEHVSVLQLFVRRDLQMPLLIGCVMMMAQQLGGINAVLYYSTSIFEKVGVPESRVAT---TGIGVVALVFTAIAVRLVEVLGRRTLMLIGLGGM 354          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Medaka
Match: slc2a13b (proton myo-inositol cotransporter [Source:NCBI gene;Acc:101158939])

HSP 1 Score: 218.394 bits (555), Expect = 4.292e-63
Identity = 166/523 (31.74%), Postives = 272/523 (52.01%), Query Frame = 1
Query:  202 FPMIGGFMFGHVTGSVSINKTNDLFFYLNLPIL--------ILGALFASLLTGSLVDRF-GRKKMIII-SCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICR-KDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEE-ENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL-------VYVRRLKRNQNNNCSNFLSCDDC-LNNICEYC------QIDENS----GYTCVNYGA--NCTNKGN---YSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            F  +GGF+FG+ TG VS      L   +NL  L         +GA   S L G  ++ + GR+  I++ S +F + G ++ L+P      +  ++VG+GIG+     P+YIAE++P  +RG+++T+  + IT G  +AS+V  +     +  +  +L   ++PA++  +G + + ES RWLL K +  EA +V+R ++  Q    EE+  I  +ANI  EE E      +L R+L +   R++L+ GC +Q+  Q++GIN ++Y S  + Q       + A+W  +     NF+ + V   L++++GRRKL L SL G   SL ++AV   L       V +  +  N N+    + SC+ C L+  C +C      ++ E+S        +++ A   C NK       I+ + N C    +WI+L+G+ LY+  FA GMGP+PW V SEIYP W RST  A S G  W+ N + +L F ++     +Y  F++Y      G+  +    PET  + LE M 
Sbjct:   41 FSALGGFLFGYDTGVVS-GAMLLLKKRMNLSALWQELLVSSTVGAAAVSALAGGFLNGWLGRRICILLASLIFSVGGVMLALAPDKVVLLVGRIIVGLGIGIASMTVPVYIAEVSPPHLRGQLVTVNALFITGGQFIASMVDGAFSYLSEDGWRYMLGLSVLPAVLQFLGFIFLPESPRWLLQKGQNQEALQVLRWIRGDQNVE-EEYDSI--KANIEEEEKEVGAGGVVLLRMLSHGPTRRALIVGCGLQMFQQLSGINTVMYYSATILQMAGVRDDKEAIWLAAATSATNFVFTLVGVWLVERVGRRKLTLGSLLGTGLSLALLAVGFLLSAQSSPPVTLHPVDPN-NSTYRLYGSCEPCMLDPDCGFCFRENGTKVFESSCVPVHQASIDHAAWGRCYNKTEDIKSPIWAY-NYCPTSYSWIVLMGLFLYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWIFNVLVSLTFLHVAEYLTYYGAFFLYTGLVFLGLLFVLGCLPETRGLQLEDME 557          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Medaka
Match: slc2a13b (proton myo-inositol cotransporter [Source:NCBI gene;Acc:101158939])

HSP 1 Score: 218.394 bits (555), Expect = 5.486e-63
Identity = 166/523 (31.74%), Postives = 272/523 (52.01%), Query Frame = 1
Query:  202 FPMIGGFMFGHVTGSVSINKTNDLFFYLNLPIL--------ILGALFASLLTGSLVDRF-GRKKMIII-SCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICR-KDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEE-ENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL-------VYVRRLKRNQNNNCSNFLSCDDC-LNNICEYC------QIDENS----GYTCVNYGA--NCTNKGN---YSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            F  +GGF+FG+ TG VS      L   +NL  L         +GA   S L G  ++ + GR+  I++ S +F + G ++ L+P      +  ++VG+GIG+     P+YIAE++P  +RG+++T+  + IT G  +AS+V  +     +  +  +L   ++PA++  +G + + ES RWLL K +  EA +V+R ++  Q    EE+  I  +ANI  EE E      +L R+L +   R++L+ GC +Q+  Q++GIN ++Y S  + Q       + A+W  +     NF+ + V   L++++GRRKL L SL G   SL ++AV   L       V +  +  N N+    + SC+ C L+  C +C      ++ E+S        +++ A   C NK       I+ + N C    +WI+L+G+ LY+  FA GMGP+PW V SEIYP W RST  A S G  W+ N + +L F ++     +Y  F++Y      G+  +    PET  + LE M 
Sbjct:   41 FSALGGFLFGYDTGVVS-GAMLLLKKRMNLSALWQELLVSSTVGAAAVSALAGGFLNGWLGRRICILLASLIFSVGGVMLALAPDKVVLLVGRIIVGLGIGIASMTVPVYIAEVSPPHLRGQLVTVNALFITGGQFIASMVDGAFSYLSEDGWRYMLGLSVLPAVLQFLGFIFLPESPRWLLQKGQNQEALQVLRWIRGDQNVE-EEYDSI--KANIEEEEKEVGAGGVVLLRMLSHGPTRRALIVGCGLQMFQQLSGINTVMYYSATILQMAGVRDDKEAIWLAAATSATNFVFTLVGVWLVERVGRRKLTLGSLLGTGLSLALLAVGFLLSAQSSPPVTLHPVDPN-NSTYRLYGSCEPCMLDPDCGFCFRENGTKVFESSCVPVHQASIDHAAWGRCYNKTEDIKSPIWAY-NYCPTSYSWIVLMGLFLYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWIFNVLVSLTFLHVAEYLTYYGAFFLYTGLVFLGLLFVLGCLPETRGLQLEDME 557          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Medaka
Match: SLC2A13 (solute carrier family 2 member 13 [Source:NCBI gene;Acc:101157657])

HSP 1 Score: 185.267 bits (469), Expect = 1.167e-50
Identity = 151/526 (28.71%), Postives = 252/526 (47.91%), Query Frame = 1
Query:  202 FPMIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDR--------------FGRKKMIIISCV-FCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICR-KDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQ--KRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL-------VYVRRLKRN-QNNNCSNFLSCDDC-LNNICEYCQIDENSGY---TCVNYG---------ANCTN-----KGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIY-KYFPETNQ 1644
            F  +GGF++G+ TG +S          L    L L AL+  LL  S V                FGR+  ++++   F + G +++ +PG        ++VG+G+G++    P+YIAE +P  +RG+++T+  + IT G   AS++  +    +   +  +L   +IPA++  +G L + ES RWL+ +    +A+ V+ +++  Q    EE+  I    N + EEE        +++R+L     R++LL GC +Q+  Q++GIN ++Y S  + Q         A+W   L    NF+ + +   L++K+GRRKL L S+ G   SL ++AV   +       V  R L     N+ CS +  C+ C L+  C +C    +S     +CV              C+N        Y  YN+   C     W++LLG+++Y  +FA GMGP+PW + SEIYP W RST  A + G  W  N + ++ F ++     +Y  F   C      +A    + FP   Q
Sbjct:   90 FSALGGFLYGYDTGVISGA------MLLLKRELQLSALWQELLISSTVAAAALSALLGGFLNGLFGRRVCVLLASFCFTVGGIVLSAAPGKEALLAGRIIVGVGLGIVTMTVPVYIAEASPPHLRGQLVTVNTLFITGGQFTASLIDGAFSYLQHDGWRYMLGLSVIPAVLQFLGFLFLPESPRWLIQRGLTQKARRVLSQIRGNQNID-EEYDSI---KNSIEEEEKDSGGDGPVVWRMLTYPPTRRALLVGCGLQMFQQLSGINTVMYYSATILQMSGVRDDRLAIWLAGLATLTNFLFTLLGVWLVEKVGRRKLTLGSILGTTLSLSLLAVGFLMSAQHSPPVTFRPLDPAMANSTCSKYRLCEPCMLDPSCGFCYRRNSSALLATSCVAVNKASTEHAAWGRCSNSTLMKDQTYWAYNY---CPTSYFWLVLLGLVMYFAAFAPGMGPMPWTINSEIYPLWARSTGNACAAGVNWTFNILVSVTFLHLAQYLTYYGQFEAPCFSPASSVADAQLQVFPSNQQ 602          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Medaka
Match: SLC2A13 (solute carrier family 2 member 13 [Source:NCBI gene;Acc:101157657])

HSP 1 Score: 174.096 bits (440), Expect = 7.763e-48
Identity = 123/418 (29.43%), Postives = 212/418 (50.72%), Query Frame = 1
Query:  493 PLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICR-KDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL-------VYVRRLKRN-QNNNCSNFLSCDDC-LNNICEYCQIDENSGY---TCVNYG---------ANCTN-----KGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 1665
            P+YIAE +P  +RG+++T+  + IT G   AS++  +    +   +  +L   +IPA++  +G L + ES RWL+ +    +A+ V+ +++  Q  +I+E    I  +    E+++     +++R+L     R++LL GC +Q+  Q++GIN ++Y S  + Q         A+W   L    NF+ + +   L++K+GRRKL L S+ G   SL ++AV   +       V  R L     N+ CS +  C+ C L+  C +C    +S     +CV              C+N        Y  YN+   C     W++LLG+++Y  +FA GMGP+PW + SEIYP W RST  A + G  W  N + ++ F ++     +Y +F++Y +  + G   +Y   PET    LE++ 
Sbjct:    4 PVYIAEASPPHLRGQLVTVNTLFITGGQFTASLIDGAFSYLQHDGWRYMLGLSVIPAVLQFLGFLFLPESPRWLIQRGLTQKARRVLSQIRGNQ--NIDEEYDSIKNSIEEEEKDSGGDGPVVWRMLTYPPTRRALLVGCGLQMFQQLSGINTVMYYSATILQMSGVRDDRLAIWLAGLATLTNFLFTLLGVWLVEKVGRRKLTLGSILGTTLSLSLLAVGFLMSAQHSPPVTFRPLDPAMANSTCSKYRLCEPCMLDPSCGFCYRRNSSALLATSCVAVNKASTEHAAWGRCSNSTLMKDQTYWAYNY---CPTSYFWLVLLGLVMYFAAFAPGMGPMPWTINSEIYPLWARSTGNACAAGVNWTFNILVSVTFLHLAQYLTYYGVFFLYSSLALLGFVFVYGCLPETKARRLEEIE 416          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Medaka
Match: slc2a12 (solute carrier family 2 member 12 [Source:NCBI gene;Acc:101173031])

HSP 1 Score: 111.309 bits (277), Expect = 1.958e-25
Identity = 111/481 (23.08%), Postives = 219/481 (45.53%), Query Frame = 1
Query:  301 ILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLS-PGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXL-YNSPLLFQY-FNNMSYETALWFG-SLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA-VNLQ-LVYVRRLKRNQN-NNCSNFL----------------SCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 1674
            +LGAL   L  G ++DR+GR+  + +S    + G+L+ +S   +    +  V+VG+G  +  T   LYIAE++P+  RG ++TLY++ +  G++L      +       +       + PA++ +  ++ +  S R+L+ + + + A+ V+ +++      +E     + +    ++EE+    + LF    N   R  LL G  +  + Q  G   IL Y SPLL    FN+ +  T    G  ++     IP+ +   L+D++G +    +    +  SL  +  + LQ   ++  L  +Q  +N +  L                S D   + I E  Q  +  G      G    ++G  S        ++ + W  L+ +++YV +F+IG+GP+ +VV SEI+P   R   +++ +   W  N + ++ F  +       ++ ++Y A +   +  +    PET    LE+++  L
Sbjct:   82 LLGALLVCLAGGPILDRYGRRCSLFVSAAMVVGGTLVLISVTSLVALTLGRVIVGMGTALSGTAACLYIAEISPRERRGLLVTLYELMLVVGVMLGFGCCYAFATVPHGWAFTFGLVIPPALLQIGALVFLPPSPRFLVAQGKVEHARAVLARMRN---GHMEHVGTELRDIQAGLKEESEHSFWELFSAKAN--LRSRLLTGAALVFLQQATGQPNILSYASPLLRSVGFNSDAAATLASTGFGVVKVVGTIPAVL---LVDRVGPKSFLCVGAVSMGLSLAALGTLTLQSRTHLTSLCTSQTLDNSTEVLWNLNRTFQDFEEGGLFSTDLPSHWIAEEIQRTDTEG------GGIKDSEGEKS-----QGVSSSLQWASLISLLVYVAAFSIGLGPMVYVVLSEIFPMGVRGRAVSVVSAVNWATNLLISMTFLTLTEKIGVPSVMFLYAAMSFVLLVFVILCVPETKGRTLEEISKEL 543          
BLAST of Proton myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000056331.1 (SMESG000056331.1)

HSP 1 Score: 954.125 bits (2465), Expect = 0.000e+0
Identity = 494/508 (97.24%), Postives = 497/508 (97.83%), Query Frame = 1
Query:  154 NKIEVYFTRQYIHHIIFPMIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF 1677
            NKIEVYFTRQYIHHIIFPMIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKD+SYI VLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYIQIIGQIAGINAILYNSPLLFQYFNNMSYE ALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRL  NQNNNCSNFLSCDDC+NN CEYCQIDE+SGYTCVN GANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWL    CNLIFT IFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF
Sbjct:   14 NKIEVYFTRQYIHHIIFPMIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDESYIIVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYIQIIGQIAGINAILYNSPLLFQYFNNMSYERALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRL--NQNNNCSNFLSCDDCINNYCEYCQIDESSGYTCVNSGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWL----CNLIFTLIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF 515          
BLAST of Proton myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000056331.1 (SMESG000056331.1)

HSP 1 Score: 913.679 bits (2360), Expect = 0.000e+0
Identity = 476/490 (97.14%), Postives = 479/490 (97.76%), Query Frame = 1
Query:  208 MIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXLYNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF 1677
            MIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKD+SYI VLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYIQIIGQIAGINAILYNSPLLFQYFNNMSYE ALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRL  NQNNNCSNFLSCDDC+NN CEYCQIDE+SGYTCVN GANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWL    CNLIFT IFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF
Sbjct:    1 MIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDESYIIVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYIQIIGQIAGINAILYNSPLLFQYFNNMSYERALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRL--NQNNNCSNFLSCDDCINNYCEYCQIDESSGYTCVNSGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWL----CNLIFTLIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF 484          
BLAST of Proton myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000056325.1 (SMESG000056325.1)

HSP 1 Score: 186.808 bits (473), Expect = 6.364e-55
Identity = 91/128 (71.09%), Postives = 99/128 (77.34%), Query Frame = 1
Query: 1291 YGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 1674
            Y  N   KGNYSIYNF NPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALST A W  NF      T   F+   Y  FWIY AFT+CGIALIY+ FPE NQ ++E++ +VL
Sbjct:  132 YLVNVLEKGNYSIYNFHNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSV----TMTVFAIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEILHVL 255          

HSP 2 Score: 80.4925 bits (197), Expect = 1.227e-16
Identity = 43/77 (55.84%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  679 MLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEE-NSQKRFMLFRILRNKIARKSLLFG 906
            MLTV ESYRWLL+KNR DEA EV+RKLKQ+ ES+I EFV+ ILEAN++IEE+   QK    +   R   A +++  G
Sbjct:    1 MLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIEEDLQEQKGRKQYPEARKNEAIEAVAVG 77          
BLAST of Proton myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000056326.1 (SMESG000056326.1)

HSP 1 Score: 159.458 bits (402), Expect = 8.339e-46
Identity = 81/153 (52.94%), Postives = 115/153 (75.16%), Query Frame = 1
Query:  151 KNKIEVYFTRQYIHHIIFPMIGGFMFGHVTGSV-SINKTNDLFFYLNLPILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASI 606
               IEV +T Q+IH+I FP+IGGFMFG+VTG++  +N T+ +   L +  ++ GAL +SL TG L DRFGRKK II+SC+F I+GSL++ +  +    +   LVGIG+G+  TCCPLYIAE+TPK+IRGR+IT+YQ+ +TFG+ LAS+V A++
Sbjct:   13 AGNIEVLYTNQFIHYITFPIIGGFMFGYVTGTIPDVNGTSHM---LIVATVVGGALLSSLPTGYLADRFGRKKTIILSCLFYIVGSLLSFNY-LVEIAVGRFLVGIGLGISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATL 161          
BLAST of Proton myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000081662.1 (SMESG000081662.1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.047e-15
Identity = 108/479 (22.55%), Postives = 206/479 (43.01%), Query Frame = 1
Query:  229 GHVTGSVSINKTNDLFFYLNLP-ILILGALFASLLTGSLVDRFGRKKMIIISCVFCIIGSLI---TLSPGIAP-KYITNVLVGIGIGVICTCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKS-YITVLTTPLIPAIIVLIGMLTVSESYRWLLTKN-RKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYXXXXXXXXXXXXXL-YNSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQIDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETN 1641
            G  +GS+  N     F Y     + ++  +  +  TG + D  GR+  ++++ +F IIG++I   T+   IA   ++    +GI  GV      +Y+ E+ P+  RG +   +Q+++T GI++  ++  +     +S +        IPAI+ LI +    ES R++  K  ++D A++   +L ++++  ++ F+  + E    +E   +Q +F  F++   K  R  L+  C IQ++ Q++GINA++ Y+S +L        Y    +    I   N I +  +  L++K GRR L L     +  SL+ + + + LV           N    LS                          +N    G  S++                 ++ Y+I FA G+GP+P ++  EI+    R    ++S    W  N I    + N+  +   Y+         +C +   + + PET 
Sbjct:   86 GVKSGSIDAN-----FLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLMNHIFVIIGAIINGLTVKTKIASLLFVGRFFIGINSGVTVGLASMYLTEIAPRAYRGAIGACHQLAVTVGIVIGYLLTMTHTLNTESLWPIACACTAIPAILSLILLPLCPESPRFIFLKQFKEDLARKEFIRLNRMED--VDVFLGELREE---VEIAKNQPKFKFFQLFTQKDLRMPLIIACLIQVMQQLSGINAVISYSSSMLSTAGIPEVYSQ--YCVITIGILNVICTLSSLPLLEKFGRRILLLWPSILLAVSLLFLTITVNLV-----------NAPGLLSL-------------------------SNQKIVGGISVFF----------------IMTYIIGFAFGLGPVPALIVGEIFRQEPRGAAYSVSQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVLVCWV-FFFLFMPETK 499          
The following BLAST results are available for this feature:
BLAST of Proton myo-inositol cotransporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC2A136.355e-6530.43solute carrier family 2 member 13 [Source:HGNC Sym... [more]
SLC2A125.568e-3126.29solute carrier family 2 member 12 [Source:HGNC Sym... [more]
SLC2A141.575e-2324.52solute carrier family 2 member 14 [Source:HGNC Sym... [more]
SLC2A141.575e-2324.52solute carrier family 2 member 14 [Source:HGNC Sym... [more]
SLC2A142.867e-2324.52solute carrier family 2 member 14 [Source:HGNC Sym... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmit-1.35.967e-5126.97H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
hmit-1.35.967e-5126.97H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
hmit-1.12.892e-4427.90H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
hmit-1.25.508e-4327.27H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
R09B5.112.284e-1921.67Facilitated glucose transporter homolog [Source:U... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glut12.468e-2523.90gene:FBgn0264574 transcript:FBtr0333500[more]
Glut13.111e-2523.90gene:FBgn0264574 transcript:FBtr0333499[more]
Glut15.055e-2523.90gene:FBgn0264574 transcript:FBtr0333494[more]
Tret1-26.047e-2221.21gene:FBgn0033644 transcript:FBtr0088075[more]
CG109605.080e-2122.61gene:FBgn0036316 transcript:FBtr0075943[more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a13b7.099e-6830.65solute carrier family 2 member 13b [Source:ZFIN;Ac... [more]
SLC2A136.077e-3332.77proton myo-inositol cotransporter-like [Source:NCB... [more]
slc2a87.228e-2624.02solute carrier family 2 member 8 [Source:ZFIN;Acc:... [more]
slc2a3b8.505e-2624.02solute carrier family 2 member 3b [Source:ZFIN;Acc... [more]
slc2a3b8.505e-2624.02solute carrier family 2 member 3b [Source:ZFIN;Acc... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phf21b2.892e-6228.32PHD finger protein 21B [Source:Xenbase;Acc:XB-GENE... [more]
phf21b2.757e-5727.90PHD finger protein 21B [Source:Xenbase;Acc:XB-GENE... [more]
slc2a105.459e-2723.24solute carrier family 2 (facilitated glucose trans... [more]
slc2a106.471e-2723.24solute carrier family 2 (facilitated glucose trans... [more]
slc2a106.537e-2723.24solute carrier family 2 (facilitated glucose trans... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc2a131.923e-6530.02solute carrier family 2 (facilitated glucose trans... [more]
Slc2a123.485e-2925.95solute carrier family 2 (facilitated glucose trans... [more]
Slc2a32.878e-2023.28solute carrier family 2 (facilitated glucose trans... [more]
Slc2a22.553e-1525.49solute carrier family 2 (facilitated glucose trans... [more]
Slc2a73.344e-1526.79solute carrier family 2 (facilitated glucose trans... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3UHK1|MYCT_MOUSE1.345e-6430.02Proton myo-inositol cotransporter OS=Mus musculus ... [more]
sp|Q96QE2|MYCT_HUMAN3.052e-6430.43Proton myo-inositol cotransporter OS=Homo sapiens ... [more]
sp|Q921A2|MYCT_RAT3.151e-6329.84Proton myo-inositol cotransporter OS=Rattus norveg... [more]
sp|Q9ZQP6|INT3_ARATH2.200e-5027.90Probable inositol transporter 3 OS=Arabidopsis tha... [more]
sp|Q9C757|INT2_ARATH4.908e-4826.44Probable inositol transporter 2 OS=Arabidopsis tha... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJX40.000e+064.15Slc2a-9 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
A0A0H3YIU75.708e-11140.67Slc2a-10 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1S3IAC66.436e-7432.76proton myo-inositol cotransporter isoform X2 OS=Li... [more]
A0A2P2IC982.502e-7129.62Proton myo-inositol cotransporter-like OS=Hirondel... [more]
A0A1W5BE038.379e-6930.64proton myo-inositol cotransporter-like isoform X3 ... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a13b3.280e-5830.94solute carrier family 2 member 13b [Source:ZFIN;Ac... [more]
SLC2A131.530e-5631.33solute carrier family 2 member 13 [Source:NCBI gen... [more]
slc2a102.844e-2925.05solute carrier family 2 member 10 [Source:NCBI gen... [more]
slc2a3b9.830e-2724.34solute carrier family 2, facilitated glucose trans... [more]
slc2a3b3.460e-2123.75solute carrier family 2, facilitated glucose trans... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002434.11.951e-1226.52pep scaffold:Pmarinus_7.0:GL479978:1522:11010:-1 g... [more]
SLC2A94.565e-1221.55solute carrier family 2 member 9 [Source:HGNC Symb... [more]
oct22.254e-723.56organic cation transporter 2 [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000006105.14.070e-725.93pep scaffold:Pmarinus_7.0:GL483550:10411:12132:-1 ... [more]
slc2a109.445e-721.75solute carrier family 2 member 10 [Source:NCBI gen... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HXT25.662e-2525.68High-affinity glucose transporter of the major fac... [more]
HXT139.842e-2521.81Putative transmembrane polyol transporter; support... [more]
HXT173.317e-2421.60Putative transmembrane polyol transporter; support... [more]
ITR13.243e-2328.11Myo-inositol transporter; member of the sugar tran... [more]
GAL21.186e-2223.59Galactose permease; required for utilization of ga... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469027.019e-6530.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428627.465e-2625.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428611.505e-2423.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326152.545e-2424.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351204.450e-1624.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a13b4.292e-6331.74proton myo-inositol cotransporter [Source:NCBI gen... [more]
slc2a13b5.486e-6331.74proton myo-inositol cotransporter [Source:NCBI gen... [more]
SLC2A131.167e-5028.71solute carrier family 2 member 13 [Source:NCBI gen... [more]
SLC2A137.763e-4829.43solute carrier family 2 member 13 [Source:NCBI gen... [more]
slc2a121.958e-2523.08solute carrier family 2 member 12 [Source:NCBI gen... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056331.10.000e+097.24SMESG000056331.1[more]
SMESG000056331.10.000e+097.14SMESG000056331.1[more]
SMESG000056325.16.364e-5571.09SMESG000056325.1[more]
SMESG000056326.18.339e-4652.94SMESG000056326.1[more]
SMESG000081662.11.047e-1522.55SMESG000081662.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029002 ID=SMED30029002|Name=Proton myo-inositol cotransporter|organism=Schmidtea mediterranea sexual|type=transcript|length=1705bp
CGTAATTTTAAATTTCGCATTGGTTCAATATATTTTAAATTCTATGAATT
TCGATATCAGTCTAGATAGTCTGTATGGCATATTTGTAGGACATACTGCT
CGTTTTTCAAATTTATTTCAATAGCGGTACACTTGAATCACCAACAATTA
AAAAACAAAATTGAAGTGTATTTTACACGTCAATATATACATCATATTAT
CTTTCCTATGATCGGTGGATTTATGTTTGGCCATGTAACTGGATCAGTAT
CTATAAATAAAACAAATGATTTATTTTTTTATCTCAACCTTCCTATATTA
ATTTTGGGAGCGTTGTTTGCTTCACTTCTAACTGGAAGTCTAGTTGACAG
ATTTGGTCGAAAGAAGATGATAATTATATCATGTGTATTTTGTATTATCG
GGTCATTGATAACTCTGTCACCAGGAATTGCACCAAAATATATTACAAAT
GTATTAGTTGGAATTGGAATAGGTGTAATATGTACTTGCTGTCCCCTCTA
CATTGCGGAAATGACACCAAAACTAATCCGAGGTCGTGTTATTACTCTCT
ATCAAGTCAGTATAACATTTGGAATACTTTTGGCTTCTATAGTCAAAGCG
TCAATTTGTAGGAAAGATAAAAGCTATATAACCGTGTTAACCACTCCATT
AATACCAGCAATTATTGTTTTAATTGGTATGCTTACTGTTTCGGAGAGTT
ATAGATGGCTTCTGACCAAAAATAGAAAAGATGAAGCAAAAGAAGTTATC
CGAAAGCTAAAACAACTCCAAGAATCAAGTATCGAAGAATTTGTTAAAAT
CATTTTGGAAGCAAACATTGTAATCGAAGAAGAAAATTCACAAAAAAGGT
TTATGTTATTTCGAATTCTCAGAAACAAAATTGCAAGAAAGAGTCTTCTA
TTTGGATGTTATATACAGATCATTGGTCAAATAGCCGGGATAAATGCGAT
ACTCTATAATTCACCGCTTTTATTTCAATATTTTAACAATATGAGTTACG
AAACGGCTTTATGGTTTGGGTCATTAATTTATTTTTTCAATTTTATACCG
TCGTTTGTTGCTTATAAATTAATTGACAAAATTGGAAGAAGAAAATTGGC
GCTCATCAGTTTGTTTGGAATCATTTTCAGTTTGGTAATCATTGCGGTAA
ACCTTCAACTAGTCTACGTGAGGCGTCTAAAAAGAAACCAGAATAATAAT
TGTAGCAATTTTCTGTCATGCGATGACTGCCTCAATAATATTTGTGAATA
TTGTCAAATTGACGAAAATTCCGGATATACTTGTGTTAATTATGGGGCAA
ACTGTACAAATAAAGGCAATTATTCAATTTATAACTTCGATAATCCCTGC
ACAAACTATATTAATTGGATTCTTTTGCTGGGAATGATATTGTATGTCAT
CAGTTTTGCAATTGGAATGGGGCCGATTCCTTGGGTGGTCACTTCGGAAA
TATACCCCGCGTGGTGCCGCAGTACCAATATGGCATTATCAACAGGAGCT
ATGTGGTTATGTAATTTCATATGTAATCTCATATTTACAAATATTTTCTT
TAGTCGAATATTTTACGCAATATTTTGGATTTATTGCGCTTTTACAATTT
GTGGAATCGCCCTGATATATAAATATTTCCCAGAAACGAACCAAATAGAT
TTGGAAAAAATGAATTATGTCTTATTTTAAAGAATTTTTAAATTGAAAAT
GTGAC
back to top

protein sequence of SMED30029002-orf-1

>SMED30029002-orf-1 ID=SMED30029002-orf-1|Name=SMED30029002-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=491bp
MIGGFMFGHVTGSVSINKTNDLFFYLNLPILILGALFASLLTGSLVDRFG
RKKMIIISCVFCIIGSLITLSPGIAPKYITNVLVGIGIGVICTCCPLYIA
EMTPKLIRGRVITLYQVSITFGILLASIVKASICRKDKSYITVLTTPLIP
AIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIIL
EANIVIEEENSQKRFMLFRILRNKIARKSLLFGCYIQIIGQIAGINAILY
NSPLLFQYFNNMSYETALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALI
SLFGIIFSLVIIAVNLQLVYVRRLKRNQNNNCSNFLSCDDCLNNICEYCQ
IDENSGYTCVNYGANCTNKGNYSIYNFDNPCTNYINWILLLGMILYVISF
AIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSR
IFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005828MFS_sugar_transport-like
IPR005829Sugar_transporter_CS
IPR020846MFS_dom
IPR003663Sugar/inositol_transpt
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
GO:0008643carbohydrate transport
Vocabulary: molecular function
TermDefinition
GO:0022891substrate-specific transmembrane transporter activity
GO:0022857transmembrane transporter activity
GO:0005215transporter activity