Si:ch73-62l21.1

Overview
NameSi:ch73-62l21.1
Smed IDSMED30028997
Length (bp)1762
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:ch73-62l21.1 (SMED30028997) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:ch73-62l21.1 (SMED30028997) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:ch73-62l21.1 (SMED30028997) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:ch73-62l21.1 (SMED30028997) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028997

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028997SMESG000067484.1 SmedASXL_015732SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30028997SMESG000067484.1 dd_Smed_v6_17638_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30028997SMESG000067484.1 dd_Smed_v6_14685_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30028997SMESG000067484.1 dd_Smed_v4_14685_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:ch73-62l21.1 vs. Ensembl Human
Match: CAMKK1 (calcium/calmodulin dependent protein kinase kinase 1 [Source:HGNC Symbol;Acc:HGNC:1469])

HSP 1 Score: 350.132 bits (897), Expect = 8.662e-114
Identity = 186/397 (46.85%), Postives = 261/397 (65.74%), Query Frame = 3
Query:  369 PYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            PY+   + H+SP     P            +++    +IS  ED    V LNQY+++ +IG+G+YG+V+LAYN  +  +YAMK LSKKKL+K  G   RPPP        S      P +   PL+++Y+EIA  KKL+H N+VKLIEVLDDP+++ LY+VF+ +  GPVME+  D PF E +AR Y+ D +LGLEYLH QKI+HRDIKP+NLLL     +KI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA G+TLY F++GK P  +     L++ I N P+++PE P +S  + DL+ KMLDKNP  RI +P+IK+H W+T +G+  LP+E E+C    +   E +  NS+R +P   TVI +K +L+++SF NP 
Sbjct:   90 PYATGPASHISPRAWRRP------------TIESHHVAISDAED---CVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPP------RGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSEEEHCSVVEVTEEEVK--NSVRLIPSWTTVILVKSMLRKRSFGNPF 463          
BLAST of Si:ch73-62l21.1 vs. Ensembl Human
Match: CAMKK1 (calcium/calmodulin dependent protein kinase kinase 1 [Source:HGNC Symbol;Acc:HGNC:1469])

HSP 1 Score: 350.132 bits (897), Expect = 1.487e-113
Identity = 189/397 (47.61%), Postives = 266/397 (67.00%), Query Frame = 3
Query:  369 PYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            PY+   + H+SP     P            +++    +IS  ED    V LNQY+++ +IG+G+YG+V+LAYN  +  +YAMK LSKKKL+K  G   RPPP        S      P +   PL+++Y+EIA  KKL+H N+VKLIEVLDDP+++ LY+VF+ +  GPVME+  D PF E +AR Y+ D +LGLEYLH QKI+HRDIKP+NLLL     +KI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA G+TLY F++GK P  +     L++ I N P+++PE P +S  + DL+ KMLDKNP  RI +P+IK+H W+T +G+  LP+E E+C  + ++V E+EV NS+R +P   TVI +K +L+++SF NP 
Sbjct:  117 PYATGPASHISPRAWRRP------------TIESHHVAISDAED---CVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPP------RGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSEEEHC--SVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPF 490          
BLAST of Si:ch73-62l21.1 vs. Ensembl Human
Match: CAMKK1 (calcium/calmodulin dependent protein kinase kinase 1 [Source:HGNC Symbol;Acc:HGNC:1469])

HSP 1 Score: 331.643 bits (849), Expect = 1.876e-106
Identity = 186/435 (42.76%), Postives = 261/435 (60.00%), Query Frame = 3
Query:  369 PYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYM--------------------------------------VFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            PY+   + H+SP     P            +++    +IS  ED    V LNQY+++ +IG+G+YG+V+LAYN  +  +YAMK LSKKKL+K  G   RPPP        S      P +   PL+++Y+EIA  KKL+H N+VKLIEVLDDP+++ LY+                                      VF+ +  GPVME+  D PF E +AR Y+ D +LGLEYLH QKI+HRDIKP+NLLL     +KI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA G+TLY F++GK P  +     L++ I N P+++PE P +S  + DL+ KMLDKNP  RI +P+IK+H W+T +G+  LP+E E+C    +   E +  NS+R +P   TVI +K +L+++SF NP 
Sbjct:   90 PYATGPASHISPRAWRRP------------TIESHHVAISDAED---CVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPP------RGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLALQNQAQNIQLDSTNIAKPHSLLPSEQQDSGSTWAARSVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSEEEHCSVVEVTEEEVK--NSVRLIPSWTTVILVKSMLRKRSFGNPF 501          
BLAST of Si:ch73-62l21.1 vs. Ensembl Human
Match: CAMKK2 (calcium/calmodulin dependent protein kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:1470])

HSP 1 Score: 323.553 bits (828), Expect = 2.875e-103
Identity = 180/382 (47.12%), Postives = 252/382 (65.97%), Query Frame = 3
Query:  480 SISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPS 1625
            SI+  +D    V LNQY ++ +IG+GSYG+V+LAYN  D+ YYAMK LSKKKL++ +G   R        +  +  G   P+    P++++Y+EIA  KKL+H N+VKL+EVLDDP+++ LYMVFE V  GPVME+    P  E +AR Y  D + G+EYLHYQKIIHRDIKP+NLL+ +   IKI+DFGVSNEF G D  LS+TVG+PAFMAPES+ +    F+GKALD+WA+G+TLY F+FG+ P  +     L+  I +  + +P+ P ++  + DL+ +MLDKNP  RI +P IK+H W+T  G   LP+E ENC      V E+EV NS++ +P L TVI +K +++++SF NP         + +  G  L K P+
Sbjct:  152 SITGMQDC---VQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRR---PPPRGTRPAPGGCIQPR---GPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVE--VTEEEVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPT 522          
BLAST of Si:ch73-62l21.1 vs. Ensembl Human
Match: CAMKK2 (calcium/calmodulin dependent protein kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:1470])

HSP 1 Score: 323.553 bits (828), Expect = 6.331e-103
Identity = 181/382 (47.38%), Postives = 253/382 (66.23%), Query Frame = 3
Query:  480 SISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPS 1625
            SI+  +D    V LNQY ++ +IG+GSYG+V+LAYN  D+ YYAMK LSKKKL++ +G   RPPP     +    +      +   P++++Y+EIA  KKL+H N+VKL+EVLDDP+++ LYMVFE V  GPVME+    P  E +AR Y  D + G+EYLHYQKIIHRDIKP+NLL+ +   IKI+DFGVSNEF G D  LS+TVG+PAFMAPES+ +    F+GKALD+WA+G+TLY F+FG+ P  +     L+  I +  + +P+ P ++  + DL+ +MLDKNP  RI +P IK+H W+T  G   LP+E ENC      V E+EV NS++ +P L TVI +K +++++SF NP         + +  G  L K P+
Sbjct:  152 SITGMQDC---VQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCI------QPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVE--VTEEEVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPT 522          
BLAST of Si:ch73-62l21.1 vs. Ensembl Celegans
Match: ckk-1 (Calcium/calmodulin-dependent protein kinase kinase [Source:UniProtKB/Swiss-Prot;Acc:Q3Y416])

HSP 1 Score: 348.206 bits (892), Expect = 1.819e-114
Identity = 181/380 (47.63%), Postives = 255/380 (67.11%), Query Frame = 3
Query:  495 EDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDG-DHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLR--FGSVSRINETKNGTDLLKDPS 1625
            + S   + LNQY++ ++IGQGSYG+V+LAYN +D N YA+K L K KL+K+   F +PPP R   ++        P    +PLQ + KEIA  KKL+H N+VKL+EVLDDP+  +LYMVFE+VE G ++EI  D P  E  A  Y  DTL GLEYLHYQKI+HRDIKP+NLLLS +  +KI+DFGVS EF G D +LS T G+PAFMAPE++ +G +H ++G+A DIW+LGITLYAF+ G VP  +     L++ I N+PI++PE P +S  + D++  ML K+P  R+ +  +KVH W+T DG   + +E ENC    + V E+E+ N +R +PRL+T+I +K +  +K F NP R    + S I + +  +  +KDP+
Sbjct:   10 QRSESYIQLNQYRLMEEIGQGSYGIVKLAYNEEDKNLYALKVLDKMKLLKNFACFRQPPPRRNKENAA-------PSVLRNPLQLVQKEIAILKKLSHPNVVKLVEVLDDPNDNYLYMVFEFVEKGSILEIPTDKPLDEDTAWSYFRDTLCGLEYLHYQKIVHRDIKPSNLLLSDIGQVKIADFGVSCEFEGIDAFLSGTAGTPAFMAPEALTEGANHFYSGRAQDIWSLGITLYAFVIGTVPFVDNYIIALHKKIKNDPIVFPEAPILSEALQDIILGMLKKDPGHRLMLHEVKVHTWVTRDGTVPMSSEQENCHL--VTVTEEEIENCVRVIPRLDTLILVKAMGHRKRFGNPFRNKLSAQSSIRDRRKSSS-VKDPT 379          
BLAST of Si:ch73-62l21.1 vs. Ensembl Celegans
Match: ckk-1 (Calcium/calmodulin-dependent protein kinase kinase [Source:UniProtKB/Swiss-Prot;Acc:Q3Y416])

HSP 1 Score: 350.517 bits (898), Expect = 5.198e-114
Identity = 189/408 (46.32%), Postives = 266/408 (65.20%), Query Frame = 3
Query:  420 PHG---LQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDG-DHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLR--FGSVSRINETKNGTDLLKDPS 1625
            PH    L +  S +     R V S+S  + S   + LNQY++ ++IGQGSYG+V+LAYN +D N YA+K L K KL+K+   F +PPP R   ++        P    +PLQ + KEIA  KKL+H N+VKL+EVLDDP+  +LYMVFE+VE G ++EI  D P  E  A  Y  DTL GLEYLHYQKI+HRDIKP+NLLLS +  +KI+DFGVS EF G D +LS T G+PAFMAPE++ +G +H ++G+A DIW+LGITLYAF+ G VP  +     L++ I N+PI++PE P +S  + D++  ML K+P  R+ +  +KVH W+T DG   + +E ENC    + V E+E+ N +R +PRL+T+I +K +  +K F NP R    + S I + +  +  +KDP+
Sbjct:   92 PHSSNNLAATMSPNLSRPTRYVKSVS-QQRSESYIQLNQYRLMEEIGQGSYGIVKLAYNEEDKNLYALKVLDKMKLLKNFACFRQPPPRRNKENAA-------PSVLRNPLQLVQKEIAILKKLSHPNVVKLVEVLDDPNDNYLYMVFEFVEKGSILEIPTDKPLDEDTAWSYFRDTLCGLEYLHYQKIVHRDIKPSNLLLSDIGQVKIADFGVSCEFEGIDAFLSGTAGTPAFMAPEALTEGANHFYSGRAQDIWSLGITLYAFVIGTVPFVDNYIIALHKKIKNDPIVFPEAPILSEALQDIILGMLKKDPGHRLMLHEVKVHTWVTRDGTVPMSSEQENCHL--VTVTEEEIENCVRVIPRLDTLILVKAMGHRKRFGNPFRNKLSAQSSIRDRRKSSS-VKDPT 488          
BLAST of Si:ch73-62l21.1 vs. Ensembl Celegans
Match: par-4 (Serine/threonine-protein kinase par-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9GN62])

HSP 1 Score: 132.88 bits (333), Expect = 3.900e-33
Identity = 74/227 (32.60%), Postives = 121/227 (53.30%), Query Frame = 3
Query:  723 QRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEI---KARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFT--GDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQW 1388
            ++ ++  + I  E++  +++NH N++KLIE+ + P++  +YMVFEY   G V ++    P   +   ++    I+   GL YLH +++ H+DIKP NLL+S    +KI DFGV+ +      D   +   G+P F  PE +      F G   D+W+ G+TLY  + GK P E      LY+ I   P+  P N  ++  + DLL K+L+K+  ER       +H W
Sbjct:   79 RKITNGWENIRSEMSILRRMNHRNVIKLIEIFNIPAKGKVYMVFEYC-IGSVQQLLDMEPARRLTIGESHAIFIELCQGLNYLHSKRVSHKDIKPGNLLVSIDFTVKICDFGVAEQINLFQRDGRCTKVNGTPKFQPPECIYGNHDFFDGYKADMWSAGVTLYNLVSGKYPFEKPVLLKLYECIGTEPLQMPTNVQLTKDLQDLLTKLLEKDFNERPTCLETMIHPW 304          
BLAST of Si:ch73-62l21.1 vs. Ensembl Celegans
Match: aak-2 (5'-AMP-activated protein kinase catalytic subunit alpha-2 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZQ4])

HSP 1 Score: 133.265 bits (334), Expect = 6.530e-33
Identity = 73/231 (31.60%), Postives = 131/231 (56.71%), Query Frame = 3
Query:  726 RASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQL 1415
            ++ D + KI +EI       H +I++L +V+  PS   ++M+ E+V  G + + I K       +AR++    + G++Y H   ++HRD+KP NLLL + + +KI+DFG+SN  T  D +L ++ GSP + APE +      + G  +D+W+ G+ LYA L G +P ++ +   L++ I +   ++P    +   +++LLH ML  +P++R  I ++  H+W   D  N L
Sbjct:   62 KSLDVVGKIRREIQNLSLFRHPHIIRLYQVISTPSD--IFMIMEHVSGGELFDYIVKHGRLKTAEARRFFQQIISGVDYCHRHMVVHRDLKPENLLLDEQNNVKIADFGLSNIMTDGD-FLRTSCGSPNYAAPEVI--SGKLYAGPEVDVWSCGVILYALLCGTLPFDDEHVPSLFRKIKSG--VFPTPDFLERPIVNLLHHMLCVDPMKRATIKDVIAHEWFQKDLPNYL 285          
BLAST of Si:ch73-62l21.1 vs. Ensembl Celegans
Match: aak-2 (5'-AMP-activated protein kinase catalytic subunit alpha-2 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZQ4])

HSP 1 Score: 133.265 bits (334), Expect = 6.530e-33
Identity = 73/231 (31.60%), Postives = 131/231 (56.71%), Query Frame = 3
Query:  726 RASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQL 1415
            ++ D + KI +EI       H +I++L +V+  PS   ++M+ E+V  G + + I K       +AR++    + G++Y H   ++HRD+KP NLLL + + +KI+DFG+SN  T  D +L ++ GSP + APE +      + G  +D+W+ G+ LYA L G +P ++ +   L++ I +   ++P    +   +++LLH ML  +P++R  I ++  H+W   D  N L
Sbjct:   62 KSLDVVGKIRREIQNLSLFRHPHIIRLYQVISTPSD--IFMIMEHVSGGELFDYIVKHGRLKTAEARRFFQQIISGVDYCHRHMVVHRDLKPENLLLDEQNNVKIADFGLSNIMTDGD-FLRTSCGSPNYAAPEVI--SGKLYAGPEVDVWSCGVILYALLCGTLPFDDEHVPSLFRKIKSG--VFPTPDFLERPIVNLLHHMLCVDPMKRATIKDVIAHEWFQKDLPNYL 285          
BLAST of Si:ch73-62l21.1 vs. Ensembl Fly
Match: CG17698 (gene:FBgn0040056 transcript:FBtr0333912)

HSP 1 Score: 338.961 bits (868), Expect = 1.013e-107
Identity = 183/408 (44.85%), Postives = 262/408 (64.22%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLS--STVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGS 1571
            I PN PYSP+++P  SP             S+      R+   IS+ + S   + LNQY++ +QIGQGSYGLV+LAY+ +DS +YAMK LSKK+L++ +GL  R                  P++A+ PL ++Y+EIA  KKL+H N+VKL+EVLDDP ++ LYMVFE V+ G V+ I  D+P  E +A     ++LLGLEYLH+QKIIH DIKP NLLL++   +KI+D GV NEF GDD  +S  ST G+PAF APE++  G + + G+A D+WALG TLY+ +FG VP    +  LLY+ I  + + +PEN  V+  +   + +ML+KNP +RI IP +K  +W+T+DG   LPTE ENC    +D  ++++ + +R +P+L+T+I IK +LK+ SF NP   G 
Sbjct:  238 IYPNVPYSPYSTPFSSPR------------SSRRKPAFRESRRISI-DKSGSFLQLNQYRLMEQIGQGSYGLVKLAYSEEDSTHYAMKILSKKRLLRQAGLMRR-----------------GPRKATSPLDRVYREIAVLKKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVLRIPTDNPLSEKRAWSIFRESLLGLEYLHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAGTPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKFPENHKVTENLKSCIVQMLEKNPTQRITIPQLKTSKWVTSDGDYPLPTEEENCCLVQVD--DEDIDSVVRSIPKLDTLILIKTMLKKHSFGNPFVKGC 613          
BLAST of Si:ch73-62l21.1 vs. Ensembl Fly
Match: CG17698 (gene:FBgn0040056 transcript:FBtr0333914)

HSP 1 Score: 326.635 bits (836), Expect = 7.060e-103
Identity = 182/426 (42.72%), Postives = 262/426 (61.50%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEY------------------LHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLS--STVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGS 1571
            I PN PYSP+++P  SP             S+      R+   IS+ + S   + LNQY++ +QIGQGSYGLV+LAY+ +DS +YAMK LSKK+L++ +GL  R                  P++A+ PL ++Y+EIA  KKL+H N+VKL+EVLDDP ++ LYMVFE V+ G V+ I  D+P  E +A     ++LLGLEY                  +H+QKIIH DIKP NLLL++   +KI+D GV NEF GDD  +S  ST G+PAF APE++  G + + G+A D+WALG TLY+ +FG VP    +  LLY+ I  + + +PEN  V+  +   + +ML+KNP +RI IP +K  +W+T+DG   LPTE ENC    +D  ++++ + +R +P+L+T+I IK +LK+ SF NP   G 
Sbjct:  238 IYPNVPYSPYSTPFSSPR------------SSRRKPAFRESRRISI-DKSGSFLQLNQYRLMEQIGQGSYGLVKLAYSEEDSTHYAMKILSKKRLLRQAGLMRR-----------------GPRKATSPLDRVYREIAVLKKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVLRIPTDNPLSEKRAWSIFRESLLGLEYYTMLSSSAISLKRIFVYTVHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAGTPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKFPENHKVTENLKSCIVQMLEKNPTQRITIPQLKTSKWVTSDGDYPLPTEEENCCLVQVD--DEDIDSVVRSIPKLDTLILIKTMLKKHSFGNPFVKGC 631          
BLAST of Si:ch73-62l21.1 vs. Ensembl Fly
Match: CG17698 (gene:FBgn0040056 transcript:FBtr0111166)

HSP 1 Score: 285.034 bits (728), Expect = 8.089e-91
Identity = 137/286 (47.90%), Postives = 197/286 (68.88%), Query Frame = 3
Query:  720 PQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLS--STVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGS 1571
            P++A+ PL ++Y+EIA  KKL+H N+VKL+EVLDDP ++ LYMVFE V+ G V+ I  D+P  E +A     ++LLGLEYLH+QKIIH DIKP NLLL++   +KI+D GV NEF GDD  +S  ST G+PAF APE++  G + + G+A D+WALG TLY+ +FG VP    +  LLY+ I  + + +PEN  V+  +   + +ML+KNP +RI IP +K  +W+T+DG   LPTE ENC    +D  ++++ + +R +P+L+T+I IK +LK+ SF NP   G 
Sbjct:   20 PRKATSPLDRVYREIAVLKKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVLRIPTDNPLSEKRAWSIFRESLLGLEYLHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAGTPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKFPENHKVTENLKSCIVQMLEKNPTQRITIPQLKTSKWVTSDGDYPLPTEEENCCLVQVD--DEDIDSVVRSIPKLDTLILIKTMLKKHSFGNPFVKGC 303          
BLAST of Si:ch73-62l21.1 vs. Ensembl Fly
Match: CG17698 (gene:FBgn0040056 transcript:FBtr0333913)

HSP 1 Score: 204.912 bits (520), Expect = 7.743e-58
Identity = 124/282 (43.97%), Postives = 170/282 (60.28%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEY------------------LHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLS--STVGSPAFMAPESVRDG 1139
            I PN PYSP+++P  SP             S+      R+   IS+ + S   + LNQY++ +QIGQGSYGLV+LAY+ +DS +YAMK LSKK+L++ +GL  R                  P++A+ PL ++Y+EIA  KKL+H N+VKL+EVLDDP ++ LYMVFE V+ G V+ I  D+P  E +A     ++LLGLEY                  +H+QKIIH DIKP NLLL++   +KI+D GV NEF GDD  +S  ST G+PAF APE++  G
Sbjct:  238 IYPNVPYSPYSTPFSSPR------------SSRRKPAFRESRRISI-DKSGSFLQLNQYRLMEQIGQGSYGLVKLAYSEEDSTHYAMKILSKKRLLRQAGLMRR-----------------GPRKATSPLDRVYREIAVLKKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVLRIPTDNPLSEKRAWSIFRESLLGLEYYTMLSSSAISLKRIFVYTVHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAGTPAFRAPETLIPG 489          

HSP 2 Score: 60.8474 bits (146), Expect = 2.405e-9
Identity = 26/65 (40.00%), Postives = 43/65 (66.15%), Query Frame = 3
Query: 1374 KVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFG 1568
            +  +W+T+DG   LPTE ENC    +D  ++++ + +R +P+L+T+I IK +LK+ SF NP   G
Sbjct:  490 QTSKWVTSDGDYPLPTEEENCCLVQVD--DEDIDSVVRSIPKLDTLILIKTMLKKHSFGNPFVKG 552          
BLAST of Si:ch73-62l21.1 vs. Ensembl Fly
Match: AMPKalpha (gene:FBgn0023169 transcript:FBtr0070216)

HSP 1 Score: 138.658 bits (348), Expect = 1.517e-34
Identity = 96/305 (31.48%), Postives = 157/305 (51.48%), Query Frame = 3
Query:  726 RASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITND------------GKNQLPTEAENCGFASIDVNEDEVANS-IRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKN 1598
            ++ D + KI +EI   K   H +I+KL +V+  PS   ++M+ EYV  G + + I K     E +AR++    + G++Y H   I+HRD+KP NLLL     +KI+DFG+SN    D  +L ++ GSP + APE +      + G  +DIW+ G+ LYA L G +P ++ +   L++ I +   ++P    ++  V++L+ +ML  +PL+R  I  IK H+W   D              N + T A         V E EV NS +   P  +  I   +++  K FA+     + ++INE  N
Sbjct:   65 KSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSD--IFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMML-DGEFLRTSCGSPNYAAPEVI--SGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSG--IFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSSIEQDSNVIDTYAVAEVCTKFGVKETEVHNSLLSGDPHDQLAIAYHLIIDNKRFAD----DAANQINEINN 358          
BLAST of Si:ch73-62l21.1 vs. Ensembl Zebrafish
Match: camkk1a (calcium/calmodulin-dependent protein kinase kinase 1, alpha a [Source:ZFIN;Acc:ZDB-GENE-050327-62])

HSP 1 Score: 343.584 bits (880), Expect = 2.023e-112
Identity = 186/387 (48.06%), Postives = 255/387 (65.89%), Query Frame = 3
Query:  432 QSIYSNSYGSLQRDVSSISVT-EDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINE 1589
            +  Y +S  + Q  + S  V+  DS   + LNQY+++ +IG+GSYG+V+LAYN  D  YYAMK +SKKKLMK  G         +              +   PL+++Y+EIA  KKL+H NIVKL+EVLDDP+++ L+MVFE ++ GPVME+  DSPF E +AR Y  D +LG+EYLHYQKI+HRDIKP+NLLL     +KI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA+G+TLY F++GK P  +     L+  I +  + +P+ P+VS G+  L+ +MLDKNP  RI IP IKV  W+T DGK+ LP E E+C    +   E +  NS++FVP L  VI +K +L+++SF NP  F   SR  E
Sbjct:   23 RGTYMSSRIARQPTIESKRVSISDSQDCIQLNQYKLKSEIGKGSYGVVKLAYNEDDDKYYAMKVVSKKKLMKQYGFPR------RPPPRGPKAAQGEQPKVLGPLERVYQEIAILKKLDHLNIVKLVEVLDDPAEDNLHMVFELMQKGPVMEVPSDSPFSEDQARHYFRDIVLGIEYLHYQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLSDNRQSFSGKALDVWAMGVTLYCFVYGKCPFIDEYILALHNKIKSKVVEFPDTPTVSEGLKSLVSRMLDKNPDTRITIPEIKVDPWVTQDGKDPLPLEEEHCTVVEVTEEEVQ--NSVKFVPSLSAVILVKAMLRKRSFGNP--FECPSRREE 399          
BLAST of Si:ch73-62l21.1 vs. Ensembl Zebrafish
Match: camkk1a (calcium/calmodulin-dependent protein kinase kinase 1, alpha a [Source:ZFIN;Acc:ZDB-GENE-050327-62])

HSP 1 Score: 344.354 bits (882), Expect = 3.351e-112
Identity = 186/387 (48.06%), Postives = 255/387 (65.89%), Query Frame = 3
Query:  432 QSIYSNSYGSLQRDVSSISVT-EDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINE 1589
            +  Y +S  + Q  + S  V+  DS   + LNQY+++ +IG+GSYG+V+LAYN  D  YYAMK +SKKKLMK  G         +              +   PL+++Y+EIA  KKL+H NIVKL+EVLDDP+++ L+MVFE ++ GPVME+  DSPF E +AR Y  D +LG+EYLHYQKI+HRDIKP+NLLL     +KI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA+G+TLY F++GK P  +     L+  I +  + +P+ P+VS G+  L+ +MLDKNP  RI IP IKV  W+T DGK+ LP E E+C    +   E +  NS++FVP L  VI +K +L+++SF NP  F   SR  E
Sbjct:   70 RGTYMSSRIARQPTIESKRVSISDSQDCIQLNQYKLKSEIGKGSYGVVKLAYNEDDDKYYAMKVVSKKKLMKQYGFPR------RPPPRGPKAAQGEQPKVLGPLERVYQEIAILKKLDHLNIVKLVEVLDDPAEDNLHMVFELMQKGPVMEVPSDSPFSEDQARHYFRDIVLGIEYLHYQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLSDNRQSFSGKALDVWAMGVTLYCFVYGKCPFIDEYILALHNKIKSKVVEFPDTPTVSEGLKSLVSRMLDKNPDTRITIPEIKVDPWVTQDGKDPLPLEEEHCTVVEVTEEEVQ--NSVKFVPSLSAVILVKAMLRKRSFGNP--FECPSRREE 446          
BLAST of Si:ch73-62l21.1 vs. Ensembl Zebrafish
Match: camkk1b (calcium/calmodulin-dependent protein kinase kinase 1, alpha b [Source:ZFIN;Acc:ZDB-GENE-080722-13])

HSP 1 Score: 332.798 bits (852), Expect = 1.513e-107
Identity = 183/385 (47.53%), Postives = 250/385 (64.94%), Query Frame = 3
Query:  498 DSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPSLF--LQRSS 1646
            D +  V LNQY+++ +IG+GSYG+V+LAYN  D  YYAMK +SKK+L+K  G   RPP    + S  S      P   S  L ++Y+EIA  KKL+H N+VKL+EVLDDP+++ L+MVFE V  GPVME+  DSP  E  A  Y  D +LG+EYLHYQKIIHRDIKP+NLLL     +KI+DFGVSNEF G+D  LS++ G+PAFMAPE++ D D  F+GKALDIWA+G+TL+ F+FGK P  +     L++ I +  + +P+ P +S  + DL+ +MLDK P  RI +  IK+H W+T DG + LP E ++C    +   E +  NS++ VP L  VI +K +L+++SF+NP    S  +         L  D SLF  L R S
Sbjct:   83 DGDDCVQLNQYKLKNEIGKGSYGVVKLAYNEDDDQYYAMKLVSKKRLIKQLGFRRRPPSRESNGSVGSQENLLKP---SGLLDRVYQEIAILKKLDHLNVVKLVEVLDDPAEDNLHMVFELVPKGPVMEVPTDSPLSEEMAHLYFRDIILGIEYLHYQKIIHRDIKPSNLLLGDDGHVKIADFGVSNEFEGNDALLSNSAGTPAFMAPETLTDQDQRFSGKALDIWAMGVTLFCFVFGKCPFHDDYILGLHEKIRSMSVEFPDKPEISEQLKDLITRMLDKVPETRITLAEIKLHPWVTVDGTDLLPLEEDHCTVVEVTEEEVQ--NSVKLVPSLSAVILVKSMLRKRSFSNPFECPSGRQGRSMSAPGGLTVDMSLFRPLSRGS 462          
BLAST of Si:ch73-62l21.1 vs. Ensembl Zebrafish
Match: camkk1b (calcium/calmodulin-dependent protein kinase kinase 1, alpha b [Source:ZFIN;Acc:ZDB-GENE-080722-13])

HSP 1 Score: 331.257 bits (848), Expect = 2.145e-107
Identity = 174/354 (49.15%), Postives = 240/354 (67.80%), Query Frame = 3
Query:  498 DSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            D +  V LNQY+++ +IG+GSYG+V+LAYN  D  YYAMK +SKK+L+K  G   RPP    + S  S      P   S  L ++Y+EIA  KKL+H N+VKL+EVLDDP+++ L+MVFE V  GPVME+  DSP  E  A  Y  D +LG+EYLHYQKIIHRDIKP+NLLL     +KI+DFGVSNEF G+D  LS++ G+PAFMAPE++ D D  F+GKALDIWA+G+TL+ F+FGK P  +     L++ I +  + +P+ P +S  + DL+ +MLDK P  RI +  IK+H W+T DG + LP E ++C    +   E +  NS++ VP L  VI +K +L+++SF+NP 
Sbjct:   83 DGDDCVQLNQYKLKNEIGKGSYGVVKLAYNEDDDQYYAMKLVSKKRLIKQLGFRRRPPSRESNGSVGSQENLLKP---SGLLDRVYQEIAILKKLDHLNVVKLVEVLDDPAEDNLHMVFELVPKGPVMEVPTDSPLSEEMAHLYFRDIILGIEYLHYQKIIHRDIKPSNLLLGDDGHVKIADFGVSNEFEGNDALLSNSAGTPAFMAPETLTDQDQRFSGKALDIWAMGVTLFCFVFGKCPFHDDYILGLHEKIRSMSVEFPDKPEISEQLKDLITRMLDKVPETRITLAEIKLHPWVTVDGTDLLPLEEDHCTVVEVTEEEVQ--NSVKLVPSLSAVILVKSMLRKRSFSNPF 431          
BLAST of Si:ch73-62l21.1 vs. Ensembl Zebrafish
Match: camkk1b (calcium/calmodulin-dependent protein kinase kinase 1, alpha b [Source:ZFIN;Acc:ZDB-GENE-080722-13])

HSP 1 Score: 331.257 bits (848), Expect = 2.145e-107
Identity = 174/354 (49.15%), Postives = 240/354 (67.80%), Query Frame = 3
Query:  498 DSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            D +  V LNQY+++ +IG+GSYG+V+LAYN  D  YYAMK +SKK+L+K  G   RPP    + S  S      P   S  L ++Y+EIA  KKL+H N+VKL+EVLDDP+++ L+MVFE V  GPVME+  DSP  E  A  Y  D +LG+EYLHYQKIIHRDIKP+NLLL     +KI+DFGVSNEF G+D  LS++ G+PAFMAPE++ D D  F+GKALDIWA+G+TL+ F+FGK P  +     L++ I +  + +P+ P +S  + DL+ +MLDK P  RI +  IK+H W+T DG + LP E ++C    +   E +  NS++ VP L  VI +K +L+++SF+NP 
Sbjct:   83 DGDDCVQLNQYKLKNEIGKGSYGVVKLAYNEDDDQYYAMKLVSKKRLIKQLGFRRRPPSRESNGSVGSQENLLKP---SGLLDRVYQEIAILKKLDHLNVVKLVEVLDDPAEDNLHMVFELVPKGPVMEVPTDSPLSEEMAHLYFRDIILGIEYLHYQKIIHRDIKPSNLLLGDDGHVKIADFGVSNEFEGNDALLSNSAGTPAFMAPETLTDQDQRFSGKALDIWAMGVTLFCFVFGKCPFHDDYILGLHEKIRSMSVEFPDKPEISEQLKDLITRMLDKVPETRITLAEIKLHPWVTVDGTDLLPLEEDHCTVVEVTEEEVQ--NSVKLVPSLSAVILVKSMLRKRSFSNPF 431          
BLAST of Si:ch73-62l21.1 vs. Ensembl Xenopus
Match: fam13b (family with sequence similarity 13 member B [Source:Xenbase;Acc:XB-GENE-983583])

HSP 1 Score: 367.081 bits (941), Expect = 2.618e-120
Identity = 202/416 (48.56%), Postives = 270/416 (64.90%), Query Frame = 3
Query:  369 PYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLK 1616
            PY+   + H+SP     P    +I SN          SIS   DS+  V LNQY+++ +IG+GSYG+V+LAYN  D  YYAMK LSKK+L+K  G   RPPP        S  G+    +   PL ++Y+EIA  KKL+H NIV+L+EVLDDP+++ LYMVF+    GPVME+  + PF E +AR Y  D +LG+EYLHYQKIIHRDIKP+NLLL     IKI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA+G+TLY F+FGK P  +     L+  I   P+ +PE PSVS  + DL+ KMLDK P +RI +P IKVH W+TN G + LP E E+C    ++V E+EV NS++ +P L TVI +K +L+++SF NP         + +  G  L+K
Sbjct:  109 PYATGPASHISPRIVRRP----TIESNRV--------SIS---DSDDCVQLNQYKLQSEIGKGSYGVVKLAYNQSDDKYYAMKVLSKKRLLKQYGFPRRPPP------RGSKTGSGDQTKPMAPLDRVYQEIAILKKLDHVNIVRLVEVLDDPAEDNLYMVFDLFRKGPVMEVPSEQPFAEHQARVYFRDIVLGIEYLHYQKIIHRDIKPSNLLLGDDGHIKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLLDSGQGFSGKALDVWAMGVTLYCFVFGKCPFMDEFILALHNKIKYKPVEFPEEPSVSNDLKDLILKMLDKKPEDRITVPEIKVHPWVTNRGGDPLPLEEEHCTI--VEVTEEEVKNSVKLIPSLTTVILVKAMLRKRSFGNPFECARREERSMSAPGNLLIK 501          
BLAST of Si:ch73-62l21.1 vs. Ensembl Xenopus
Match: fam13b (family with sequence similarity 13 member B [Source:Xenbase;Acc:XB-GENE-983583])

HSP 1 Score: 366.311 bits (939), Expect = 9.885e-120
Identity = 199/397 (50.13%), Postives = 264/397 (66.50%), Query Frame = 3
Query:  369 PYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            PY+   + H+SP     P    +I SN          SIS   DS+  V LNQY+++ +IG+GSYG+V+LAYN  D  YYAMK LSKK+L+K  G   RPPP        S  G+    +   PL ++Y+EIA  KKL+H NIV+L+EVLDDP+++ LYMVF+    GPVME+  + PF E +AR Y  D +LG+EYLHYQKIIHRDIKP+NLLL     IKI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA+G+TLY F+FGK P  +     L+  I   P+ +PE PSVS  + DL+ KMLDK P +RI +P IKVH W+TN G + LP E E+C    ++V E+EV NS++ +P L TVI +K +L+++SF NP 
Sbjct:  109 PYATGPASHISPRIVRRP----TIESNRV--------SIS---DSDDCVQLNQYKLQSEIGKGSYGVVKLAYNQSDDKYYAMKVLSKKRLLKQYGFPRRPPP------RGSKTGSGDQTKPMAPLDRVYQEIAILKKLDHVNIVRLVEVLDDPAEDNLYMVFDLFRKGPVMEVPSEQPFAEHQARVYFRDIVLGIEYLHYQKIIHRDIKPSNLLLGDDGHIKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLLDSGQGFSGKALDVWAMGVTLYCFVFGKCPFMDEFILALHNKIKYKPVEFPEEPSVSNDLKDLILKMLDKKPEDRITVPEIKVHPWVTNRGGDPLPLEEEHCTI--VEVTEEEVKNSVKLIPSLTTVILVKAMLRKRSFGNPF 482          
BLAST of Si:ch73-62l21.1 vs. Ensembl Xenopus
Match: ENSXETT00000001514.1 (calcium/calmodulin-dependent protein kinase kinase 2, beta [Source:NCBI gene;Acc:100135108])

HSP 1 Score: 352.443 bits (903), Expect = 2.527e-114
Identity = 209/469 (44.56%), Postives = 284/469 (60.55%), Query Frame = 3
Query:  195 FPINQDFETD--KIIENYNSTNSLSSAFPNHSDSCGKLAQLNWQNS----------EENKFGLPS--ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            F  N + ETD  +I E+    +          D  GKL   N + S            N  G+    I P+ PYSP  SP  SP     P            +++    SI+  +D    V LNQYQ++ +IG+GSYG+V+LAYN  D+ YYAMK LSKKKLM+ +G   RPPP        +   T+   +A  P++++Y+EIA  +KL+H N+VKLIEVLDDPS++ LYMVFE V  GPVM++    P  E +AR Y  D + G+EYLHYQKIIHRD+KP+NLLL +   IKI+DFGVSN F G+D +LS+TVG+PAFMAPE++ +    F+GKALD+WA+G+TL  F+FG+ P  +     L+  I N P+ +P+   +S  + DLL  MLDKNP  RI +P +K+H W+T  G   LPTE ENC      V E+EV NSI+ +P L TVI +K +L+++SF NP 
Sbjct:   72 FKENSEVETDLHRINESECKLDDRKVLPVGRKDCKGKLNMTNRKLSLQERSQSTPASSNSLGMNGRYIYPSLPYSPVTSPQSSPRLPRRP------------TVESHRVSITGCQD---CVQLNQYQLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKKLMRQAGFPRRPPP------RGAKTATEGGVQAMGPIERVYQEIAILRKLDHPNVVKLIEVLDDPSEDHLYMVFELVRRGPVMDVPTTKPLTEDQARFYFQDLIKGIEYLHYQKIIHRDVKPSNLLLGEDGHIKIADFGVSNTFEGNDAFLSNTVGTPAFMAPETLSETRKIFSGKALDVWAMGVTLNCFVFGQCPFMDERILALHSKIKNQPLEFPDQHDISEDLKDLLLHMLDKNPESRISVPELKLHPWVTKQGLEPLPTEDENCTLVE--VTEEEVENSIKHIPSLATVILVKSMLRKRSFGNPF 517          
BLAST of Si:ch73-62l21.1 vs. Ensembl Xenopus
Match: ENSXETT00000001488.1 (calcium/calmodulin-dependent protein kinase kinase 2, beta [Source:NCBI gene;Acc:100135108])

HSP 1 Score: 352.829 bits (904), Expect = 3.386e-114
Identity = 192/402 (47.76%), Postives = 261/402 (64.93%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            I P+ PYSP  SP  SP     P            +++    SI+  +D    V LNQYQ++ +IG+GSYG+V+LAYN  D+ YYAMK LSKKKLM+ +G   RPPP        +   T+   +A  P++++Y+EIA  +KL+H N+VKLIEVLDDPS++ LYMVFE V  GPVM++    P  E +AR Y  D + G+EYLHYQKIIHRD+KP+NLLL +   IKI+DFGVSN F G+D +LS+TVG+PAFMAPE++ +    F+GKALD+WA+G+TL  F+FG+ P  +     L+  I N P+ +P+   +S  + DLL  MLDKNP  RI +P +K+H W+T  G   LPTE ENC    +     EV NSI+ +P L TVI +K +L+++SF NP 
Sbjct:  139 IYPSLPYSPVTSPQSSPRLPRRP------------TVESHRVSITGCQD---CVQLNQYQLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKKLMRQAGFPRRPPP------RGAKTATEGGVQAMGPIERVYQEIAILRKLDHPNVVKLIEVLDDPSEDHLYMVFELVRRGPVMDVPTTKPLTEDQARFYFQDLIKGIEYLHYQKIIHRDVKPSNLLLGEDGHIKIADFGVSNTFEGNDAFLSNTVGTPAFMAPETLSETRKIFSGKALDVWAMGVTLNCFVFGQCPFMDERILALHSKIKNQPLEFPDQHDISEDLKDLLLHMLDKNPESRISVPELKLHPWVTKQGLEPLPTEDENCTLVEVTEE--EVENSIKHIPSLATVILVKSMLRKRSFGNPF 517          
BLAST of Si:ch73-62l21.1 vs. Ensembl Xenopus
Match: fam13b (family with sequence similarity 13 member B [Source:Xenbase;Acc:XB-GENE-983583])

HSP 1 Score: 344.354 bits (882), Expect = 1.278e-111
Identity = 189/416 (45.43%), Postives = 256/416 (61.54%), Query Frame = 3
Query:  369 PYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLK 1616
            PY+   + H+SP     P    +I SN          SIS   DS+  V LNQY+++ +IG+GSYG+V+LAYN  D  YY                 +RPPP        S  G+    +   PL ++Y+EIA  KKL+H NIV+L+EVLDDP+++ LYM   +    PVME+  + PF E +AR Y  D +LG+EYLHYQKIIHRDIKP+NLLL     IKI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA+G+TLY F+FGK P  +     L+  I   P+ +PE PSVS  + DL+ KMLDK P +RI +P IKVH W+TN G + LP E E+C    ++V E+EV NS++ +P L TVI +K +L+++SF NP         + +  G  L+K
Sbjct:  109 PYATGPASHISPRIVRRP----TIESNRV--------SIS---DSDDCVQLNQYKLQSEIGKGSYGVVKLAYNQSDDKYYV----------------SRPPP------RGSKTGSGDQTKPMAPLDRVYQEIAILKKLDHVNIVRLVEVLDDPAEDNLYMGKNFFLM-PVMEVPSEQPFAEHQARVYFRDIVLGIEYLHYQKIIHRDIKPSNLLLGDDGHIKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLLDSGQGFSGKALDVWAMGVTLYCFVFGKCPFMDEFILALHNKIKYKPVEFPEEPSVSNDLKDLILKMLDKKPEDRITVPEIKVHPWVTNRGGDPLPLEEEHCTI--VEVTEEEVKNSVKLIPSLTTVILVKAMLRKRSFGNPFECARREERSMSAPGNLLIK 484          
BLAST of Si:ch73-62l21.1 vs. Ensembl Mouse
Match: Camkk1 (calcium/calmodulin-dependent protein kinase kinase 1, alpha [Source:MGI Symbol;Acc:MGI:1891766])

HSP 1 Score: 348.977 bits (894), Expect = 1.249e-113
Identity = 187/397 (47.10%), Postives = 260/397 (65.49%), Query Frame = 3
Query:  369 PYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            PYS   + H+SP     P            +++    +IS TED    V LNQY+++ +IG+G+YG+V+LAYN  +  +YAMK LSKKKL+K  G   RPPP        S      P +   PL+++Y+EIA  KKL+H N+VKLIEVLDDP+++ LY+VF+ +  GPVME+  D PFPE +AR Y+ D +LGLEYLH QKI+HRDIKP+NLLL     +KI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA G+TLY F++GK P  +     L++ I N  +++PE P VS  + DL+ +MLDKNP  RI + +IK+H W+T  G+  LP+E E+C    +   E +  NS+R +P   TVI +K +L+++SF NP 
Sbjct:   90 PYSTGPASHISPRSWRRP------------TIESHRVAISDTED---CVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPP------RGSQATQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFPEEQARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDYILTLHRKIKNEAVVFPEEPEVSEDLKDLILRMLDKNPETRIGVSDIKLHPWVTKHGEEPLPSEEEHCSVVEVTEEEVK--NSVRLIPSWTTVILVKSMLRKRSFGNPF 463          
BLAST of Si:ch73-62l21.1 vs. Ensembl Mouse
Match: Camkk2 (calcium/calmodulin-dependent protein kinase kinase 2, beta [Source:MGI Symbol;Acc:MGI:2444812])

HSP 1 Score: 321.627 bits (823), Expect = 1.592e-102
Identity = 168/350 (48.00%), Postives = 233/350 (66.57%), Query Frame = 3
Query:  510 IVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
             V LNQY ++ +IG+GSYG+V+LAYN  D+ YYAMK LSKKK      L  +    R+     +        +   P++++Y+EIA  KKL+H N+VKL+EVLDDP+++ LYMVFE V  GPVME+    P  E +AR Y  D + G+EYLHYQKIIHRDIKP+NLL+ +   IKI+DFGVSNEF G D  LS+TVG+PAFMAPES+ +    F+GKALD+WA+G+TLY F+FG+ P  +     L+  I +  + +P+ P ++  + DL+ +MLDKNP  RI +P IK+H W+T  G   LP+E ENC    +     EV NS++ +P L TVI +K +++++SF NP 
Sbjct:  159 CVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKK------LIRQAGFPRRPPPRGARPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEE--EVENSVKHIPSLATVILVKTMIRKRSFGNPF 500          
BLAST of Si:ch73-62l21.1 vs. Ensembl Mouse
Match: Camkk2 (calcium/calmodulin-dependent protein kinase kinase 2, beta [Source:MGI Symbol;Acc:MGI:2444812])

HSP 1 Score: 322.013 bits (824), Expect = 3.545e-102
Identity = 172/372 (46.24%), Postives = 240/372 (64.52%), Query Frame = 3
Query:  510 IVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPS 1625
             V LNQY ++ +IG+GSYG+V+LAYN  D+ YYAMK LSKKK      L  +    R+     +        +   P++++Y+EIA  KKL+H N+VKL+EVLDDP+++ LYMVFE V  GPVME+    P  E +AR Y  D + G+EYLHYQKIIHRDIKP+NLL+ +   IKI+DFGVSNEF G D  LS+TVG+PAFMAPES+ +    F+GKALD+WA+G+TLY F+FG+ P  +     L+  I +  + +P+ P ++  + DL+ +MLDKNP  RI +P IK+H W+T  G   LP+E ENC    +     EV NS++ +P L TVI +K +++++SF NP         + +  G  L K P+
Sbjct:  159 CVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKK------LIRQAGFPRRPPPRGARPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEE--EVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPT 522          
BLAST of Si:ch73-62l21.1 vs. Ensembl Mouse
Match: Camkk1 (calcium/calmodulin-dependent protein kinase kinase 1, alpha [Source:MGI Symbol;Acc:MGI:1891766])

HSP 1 Score: 295.819 bits (756), Expect = 3.694e-95
Identity = 152/290 (52.41%), Postives = 206/290 (71.03%), Query Frame = 3
Query:  510 IVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKV 1379
             V LNQY+++ +IG+G+YG+V+LAYN  +  +YAMK LSKKKL+K  G   RPPP        S      P +   PL+++Y+EIA  KKL+H N+VKLIEVLDDP+++ LY+VF+ +  GPVME+  D PFPE +AR Y+ D +LGLEYLH QKI+HRDIKP+NLLL     +KI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA G+TLY F++GK P  +     L++ I N  +++PE P VS  + DL+ +MLDKNP  RI + +IK+
Sbjct:    2 CVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPP------RGSQATQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFPEEQARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDYILTLHRKIKNEAVVFPEEPEVSEDLKDLILRMLDKNPETRIGVSDIKI 285          
BLAST of Si:ch73-62l21.1 vs. Ensembl Mouse
Match: Camkk2 (calcium/calmodulin-dependent protein kinase kinase 2, beta [Source:MGI Symbol;Acc:MGI:2444812])

HSP 1 Score: 293.893 bits (751), Expect = 1.900e-93
Identity = 145/296 (48.99%), Postives = 202/296 (68.24%), Query Frame = 3
Query:  738 PLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPS 1625
            P++++Y+EIA  KKL+H N+VKL+EVLDDP+++ LYMVFE V  GPVME+    P  E +AR Y  D + G+EYLHYQKIIHRDIKP+NLL+ +   IKI+DFGVSNEF G D  LS+TVG+PAFMAPES+ +    F+GKALD+WA+G+TLY F+FG+ P  +     L+  I +  + +P+ P ++  + DL+ +MLDKNP  RI +P IK+H W+T  G   LP+E ENC      V E+EV NS++ +P L TVI +K +++++SF NP         + +  G  L K P+
Sbjct:   24 PIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVE--VTEEEVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPT 317          
BLAST of Si:ch73-62l21.1 vs. UniProt/SwissProt
Match: sp|Q8N5S9|KKCC1_HUMAN (Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=CAMKK1 PE=1 SV=2)

HSP 1 Score: 350.132 bits (897), Expect = 4.160e-113
Identity = 186/397 (46.85%), Postives = 261/397 (65.74%), Query Frame = 3
Query:  369 PYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            PY+   + H+SP     P            +++    +IS  ED    V LNQY+++ +IG+G+YG+V+LAYN  +  +YAMK LSKKKL+K  G   RPPP        S      P +   PL+++Y+EIA  KKL+H N+VKLIEVLDDP+++ LY+VF+ +  GPVME+  D PF E +AR Y+ D +LGLEYLH QKI+HRDIKP+NLLL     +KI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA G+TLY F++GK P  +     L++ I N P+++PE P +S  + DL+ KMLDKNP  RI +P+IK+H W+T +G+  LP+E E+C    +   E +  NS+R +P   TVI +K +L+++SF NP 
Sbjct:   90 PYATGPASHISPRAWRRP------------TIESHHVAISDAED---CVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPP------RGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSEEEHCSVVEVTEEEVK--NSVRLIPSWTTVILVKSMLRKRSFGNPF 463          
BLAST of Si:ch73-62l21.1 vs. UniProt/SwissProt
Match: sp|Q3Y416|KKCC_CAEEL (Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans OX=6239 GN=ckk-1 PE=1 SV=2)

HSP 1 Score: 350.517 bits (898), Expect = 6.612e-113
Identity = 189/408 (46.32%), Postives = 266/408 (65.20%), Query Frame = 3
Query:  420 PHG---LQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDG-DHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLR--FGSVSRINETKNGTDLLKDPS 1625
            PH    L +  S +     R V S+S  + S   + LNQY++ ++IGQGSYG+V+LAYN +D N YA+K L K KL+K+   F +PPP R   ++        P    +PLQ + KEIA  KKL+H N+VKL+EVLDDP+  +LYMVFE+VE G ++EI  D P  E  A  Y  DTL GLEYLHYQKI+HRDIKP+NLLLS +  +KI+DFGVS EF G D +LS T G+PAFMAPE++ +G +H ++G+A DIW+LGITLYAF+ G VP  +     L++ I N+PI++PE P +S  + D++  ML K+P  R+ +  +KVH W+T DG   + +E ENC    + V E+E+ N +R +PRL+T+I +K +  +K F NP R    + S I + +  +  +KDP+
Sbjct:   92 PHSSNNLAATMSPNLSRPTRYVKSVS-QQRSESYIQLNQYRLMEEIGQGSYGIVKLAYNEEDKNLYALKVLDKMKLLKNFACFRQPPPRRNKENAA-------PSVLRNPLQLVQKEIAILKKLSHPNVVKLVEVLDDPNDNYLYMVFEFVEKGSILEIPTDKPLDEDTAWSYFRDTLCGLEYLHYQKIVHRDIKPSNLLLSDIGQVKIADFGVSCEFEGIDAFLSGTAGTPAFMAPEALTEGANHFYSGRAQDIWSLGITLYAFVIGTVPFVDNYIIALHKKIKNDPIVFPEAPILSEALQDIILGMLKKDPGHRLMLHEVKVHTWVTRDGTVPMSSEQENCHL--VTVTEEEIENCVRVIPRLDTLILVKAMGHRKRFGNPFRNKLSAQSSIRDRRKSSS-VKDPT 488          
BLAST of Si:ch73-62l21.1 vs. UniProt/SwissProt
Match: sp|Q8VBY2|KKCC1_MOUSE (Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus OX=10090 GN=Camkk1 PE=1 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 8.734e-113
Identity = 187/397 (47.10%), Postives = 260/397 (65.49%), Query Frame = 3
Query:  369 PYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            PYS   + H+SP     P            +++    +IS TED    V LNQY+++ +IG+G+YG+V+LAYN  +  +YAMK LSKKKL+K  G   RPPP        S      P +   PL+++Y+EIA  KKL+H N+VKLIEVLDDP+++ LY+VF+ +  GPVME+  D PFPE +AR Y+ D +LGLEYLH QKI+HRDIKP+NLLL     +KI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA G+TLY F++GK P  +     L++ I N  +++PE P VS  + DL+ +MLDKNP  RI + +IK+H W+T  G+  LP+E E+C    +   E +  NS+R +P   TVI +K +L+++SF NP 
Sbjct:   90 PYSTGPASHISPRSWRRP------------TIESHRVAISDTED---CVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPP------RGSQATQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFPEEQARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDYILTLHRKIKNEAVVFPEEPEVSEDLKDLILRMLDKNPETRIGVSDIKLHPWVTKHGEEPLPSEEEHCSVVEVTEEEVK--NSVRLIPSWTTVILVKSMLRKRSFGNPF 463          
BLAST of Si:ch73-62l21.1 vs. UniProt/SwissProt
Match: sp|P97756|KKCC1_RAT (Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Camkk1 PE=1 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 5.488e-112
Identity = 187/397 (47.10%), Postives = 261/397 (65.74%), Query Frame = 3
Query:  369 PYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            PYS   + H+SP     P            +++    +IS TED    V LNQY+++ +IG+G+YG+V+LAYN ++  +YAMK LSKKKL+K  G   RPPP        S      P +   PL+++Y+EIA  KKL+H N+VKLIEVLDDP+++ LY+VF+ +  GPVME+  D PFPE +AR Y+ D +LGLEYLH QKI+HRDIKP+NLLL     +KI+DFGVSN+F G+D  LSST G+PAFMAPE++ D    F+GKALD+WA G+TLY F++GK P  +     L++ I N  +++PE P VS  + DL+ KMLDKNP  RI + +IK+H W+T  G+  LP+E E+C    +   E +  NS++ +P   TVI +K +L+++SF NP 
Sbjct:   90 PYSTGPASHMSPRAWRRP------------TIESHHVAISDTED---CVQLNQYKLQSEIGKGAYGVVRLAYNEREDRHYAMKVLSKKKLLKQYGFPRRPPP------RGSQAPQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFPEEQARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDTGQSFSGKALDVWATGVTLYCFVYGKCPFIDEYILALHRKIKNEAVVFPEEPEVSEELKDLILKMLDKNPETRIGVSDIKLHPWVTKHGEEPLPSEEEHCSVVEVTEEEVK--NSVKLIPSWTTVILVKSMLRKRSFGNPF 463          
BLAST of Si:ch73-62l21.1 vs. UniProt/SwissProt
Match: sp|O88831|KKCC2_RAT (Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus OX=10116 GN=Camkk2 PE=1 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 2.570e-102
Identity = 175/372 (47.04%), Postives = 245/372 (65.86%), Query Frame = 3
Query:  510 IVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPS 1625
             V LNQY ++ +IG+GSYG+V+LAYN  D+ YYAMK LSKKKL++ +G   R        +  +  G   P+    P++++Y+EIA  KKL+H N+VKL+EVLDDP+++ LYMVFE V  GPVME+    P  E +AR Y  D + G+EYLHYQKIIHRDIKP+NLL+ +   IKI+DFGVSNEF G D  LS+TVG+PAFMAPES+ +    F+GKALD+WA+G+TLY F+FG+ P  +     L+  I +  + +P+ P ++  + DL+ +MLDKNP  RI +P IK+H W+T  G   LP+E ENC    +     EV NS++ +P L TVI +K +++++SF NP         + +  G  L K P+
Sbjct:  158 CVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRR---PPPRGTRPAPGGCIQPR---GPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEE--EVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPT 521          
BLAST of Si:ch73-62l21.1 vs. TrEMBL
Match: W5MJ65 (Si:ch73-62l21.1 OS=Lepisosteus oculatus OX=7918 PE=3 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 4.645e-122
Identity = 203/424 (47.88%), Postives = 276/424 (65.09%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPS 1625
            I P+ PYSP  SPH SP     P    ++ S+           +S+T+     V LNQY+++ +IG+GSYG+V+LAYN  D+ YYAMK LSKKKL++ +G   RPPP        + +  + P +   PL+++Y+EIA  KKL+H N+VKL+EVLDDPS++ LYMVFE V+ G VME+  D P  E +AR Y  D L G+E+LHYQKIIHRDIKP+NLL+ +   IKI+DFGVSN+F G D  L+STVG+PAF+APE++ +    F+GKALD+WA+G+TLY F+FG+ P  +     L+Q I N P+   E+  VS  + DLL KMLDKNP  RI +P IKVH W+T  G   LP+E ENC    I+V E+EV NS++ +P L TVI +K +L+++SF NP  +G       +  G  L K  S
Sbjct:   79 IYPSLPYSPITSPHSSPRLPRRP----TVESHR----------VSITDLQQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKKLVRQAGFPRRPPP------RGAKVPPEGPSQPKGPLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKQGAVMEVPTDKPLTEDQARFYFQDLLRGIEFLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNQFEGTDALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFVFGQCPFMDDRILSLHQKIKNQPVELAEHVDVSRDLKDLLFKMLDKNPETRITVPQIKVHSWVTRHGAEPLPSEDENCTL--IEVTEEEVENSVKHIPSLATVILVKTMLRKRSFGNPFDWGRREERGLSAPGNGLTKQES 480          
BLAST of Si:ch73-62l21.1 vs. TrEMBL
Match: W5MJ51 (Si:ch73-62l21.1 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 1.414e-120
Identity = 204/424 (48.11%), Postives = 277/424 (65.33%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPS 1625
            I P+ PYSP  SPH SP     P    ++ S+           +S+T D    V LNQY+++ +IG+GSYG+V+LAYN  D+ YYAMK LSKKKL++ +G   RPPP        + +  + P +   PL+++Y+EIA  KKL+H N+VKL+EVLDDPS++ LYMVFE V+ G VME+  D P  E +AR Y  D L G+E+LHYQKIIHRDIKP+NLL+ +   IKI+DFGVSN+F G D  L+STVG+PAF+APE++ +    F+GKALD+WA+G+TLY F+FG+ P  +     L+Q I N P+   E+  VS  + DLL KMLDKNP  RI +P IKVH W+T  G   LP+E ENC    I+V E+EV NS++ +P L TVI +K +L+++SF NP  +G       +  G  L K+ S
Sbjct:  157 IYPSLPYSPITSPHSSPRLPRRP----TVESHR----------VSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKKLVRQAGFPRRPPP------RGAKVPPEGPSQPKGPLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKQGAVMEVPTDKPLTEDQARFYFQDLLRGIEFLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNQFEGTDALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFVFGQCPFMDDRILSLHQKIKNQPVELAEHVDVSRDLKDLLFKMLDKNPETRITVPQIKVHSWVTRHGAEPLPSEDENCTL--IEVTEEEVENSVKHIPSLATVILVKTMLRKRSFGNPFDWGRREERGLSAPGNGLTKNKS 557          
BLAST of Si:ch73-62l21.1 vs. TrEMBL
Match: V4ASU6 (Protein kinase domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_104050 PE=3 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 5.454e-120
Identity = 200/403 (49.63%), Postives = 271/403 (67.25%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLR 1562
            I P+ PYSP+ SP  SP  R  P                +   +SV+ D +    LNQY+++ +IG+GSYG+V+LAY+ +D  +YAMK LSKKKLMK +G F RP P+R+                 +PL+++Y+EIA  KKL+H N+VKLIEVLDDP ++ LYM FE VE G VM +G    F E ++  Y  D +LGLEYLH+QKIIHRDIKP+NLLL+    IKI+DFGVSNEF+G D +LS+TVG+PAFMAPE++R+    + GKALDIWALGITLY FLF  VP +      L++ I+ +P+ +P++ +VS  V  L+ +MLDKNPL RI +P IK H W+TN+G+  LP+E ENC    I V E+E+ N ++ VP+L+T+I +K +LKQ+SF NP R
Sbjct:    3 IFPHLPYSPYGSPTGSPRLRRQP--------------TMETHRVSVS-DGDGYTQLNQYKLKDEIGKGSYGIVKLAYSEEDEIHYAMKILSKKKLMKKAGFFKRPLPVREGKKG---------HLPPNPLERVYREIAILKKLDHPNVVKLIEVLDDPEEDNLYMAFELVEKGAVMMVGTTQAFSEEQSGNYFRDVVLGLEYLHHQKIIHRDIKPSNLLLADDGHIKIADFGVSNEFSGGDAFLSNTVGTPAFMAPETLREDREKYGGKALDIWALGITLYCFLFANVPFKEEYILGLHKKILKDPVKFPDDVNVSDSVKKLILRMLDKNPLTRITLPEIKKHPWVTNNGEITLPSEEENCEL--ITVTEEEIMNVVKHVPKLDTLIFVKSVLKQRSFRNPYR 379          
BLAST of Si:ch73-62l21.1 vs. TrEMBL
Match: A0A3P9M6E9 (Si:ch73-62l21.1 OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.225e-119
Identity = 199/405 (49.14%), Postives = 270/405 (66.67%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFG 1568
            I P+ PYSP  SPH SP     P    ++ S+S          +S+T D    V LNQY+++ +IG+GSYG+V+LAYN  D+ YYAMK LSKKKLM+ +G   RP P        +    + P +   PL+++Y+EIA  KKL+H N+VKL+EVLDDPS++ LYMVFE V+ GPVME+  D PF E +AR Y  D L G+EYLHYQKIIHRD+KP+NLL+ +   IKI+DFGVSN+F G D  L+STVG+PAF+APE++ +    F+GKALD+WA+G+TLY F+FG  P  +     L+Q I   P++ PE   +S  + DLL KML+KNP  RI +P IKVH W+T  G   LP E +NC    I+V E+EV NS++ +P L TVI ++ +L+++SF NP  +G
Sbjct:  153 IYPSLPYSPITSPHSSPRLPRRP----TVESHS----------VSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKKLMRQAGFPRRPAP------RGARALPEGPTQPKGPLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKKGPVMEVPTDKPFGEDQARFYFQDLLRGIEYLHYQKIIHRDVKPSNLLVGEDGHIKIADFGVSNQFEGSDALLTSTVGTPAFLAPEALSETRKNFSGKALDVWAMGVTLYCFVFGVCPFMDERILSLHQKIKTQPVVIPERADISDDLKDLLFKMLEKNPETRITVPQIKVHSWVTRHGAEPLPPEDDNC-CTLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNPFDWG 535          
BLAST of Si:ch73-62l21.1 vs. TrEMBL
Match: A0A3Q3LE92 (Si:ch73-62l21.1 OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 2.069e-119
Identity = 199/405 (49.14%), Postives = 270/405 (66.67%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFG 1568
            I P+ PYSP  SPH SP     P    ++ S+S          +S+T D    V LNQY+++ +IG+GSYG+V+LAYN  D+ YYAMK LSKK+LM+ +G   RPPP        +    + P +   PL+++Y+EIA  KKL+H N+VKL+EVLDDPS++ LYMVFE V+ G VME+  D PF E +AR Y  D L G+EYLHYQ+IIHRDIKP+NLL+ +   IKI+DFGVSN+F G D  L+STVG+PAF+APE+V +    F+GKALD+WA+G+TLY F+FG  P  +     L+Q I   P+  PE+  +S  + DLL +MLDKNP  RI +P IKVH W+T  G   LP E +NC    I+V E+EV NS++ +P L TVI ++ +L+++SF NP  +G
Sbjct:  155 IYPSLPYSPITSPHSSPRLPRRP----TVESHS----------VSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLMRQAGFPRRPPP------RGAKAAPEGPLQPKGPLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKQGAVMEVPTDKPFSEDQARFYFQDLLRGIEYLHYQRIIHRDIKPSNLLVGEDGHIKIADFGVSNQFEGADALLTSTVGTPAFLAPEAVSETRKNFSGKALDVWAMGVTLYCFVFGACPFMDDRILSLHQKIKTQPVELPEHADISDDLKDLLLRMLDKNPENRITVPQIKVHPWVTRHGAEPLPLEDDNCCML-IEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNPFDWG 537          
BLAST of Si:ch73-62l21.1 vs. Ensembl Cavefish
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2-like [Source:NCBI gene;Acc:103036346])

HSP 1 Score: 373.244 bits (957), Expect = 4.633e-122
Identity = 203/430 (47.21%), Postives = 277/430 (64.42%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPSLFLQRS 1643
            I P+ PYSP  SPH SP     P    ++ S+           +S+T D    V LNQY+++ +IG+GSYG+V+LAYN  D+ YYAMK LSKK+L++ +G   RPPP        +    + P +   PL+++Y+EIA  KKL+H N+VKL+EVLDDPS++ LYMVFE V+ G VME+  D P  E ++R Y  D L G+EYLHYQKIIHRDIKP+NLL+ +   +KI+DFGVSN+F G D  L+STVG+PAF+APE++ +    F+GKALD+WA+G+TLY F+FG  P  +     L+Q I   P+  PE+  VS  + DLL KMLDKNP  RI +P IKVH W+T  G   LP E +NC  + I+V E+EV NS++ +P L TVI ++ +L+++SF NP  +G     + T  G  L K  S    RS
Sbjct:  162 IYPSLPYSPITSPHSSPRLPRRP----TVESHR----------VSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLLRQAGFPRRPPP------RGAKSAPEGPPQPKGPLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKQGAVMEVPTDKPLNEDQSRFYFQDLLRGIEYLHYQKIIHRDIKPSNLLVGEDGHVKIADFGVSNQFEGADALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFIFGVCPFMDERILSLHQKIKTQPVELPEHADVSDDLKDLLFKMLDKNPETRITVPQIKVHPWVTRHGAEPLPPEDDNC-CSLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNPFDWGRREDRSPTTQGHTLAKQESGEGMRS 569          
BLAST of Si:ch73-62l21.1 vs. Ensembl Cavefish
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2-like [Source:NCBI gene;Acc:103036346])

HSP 1 Score: 372.474 bits (955), Expect = 1.616e-121
Identity = 200/421 (47.51%), Postives = 274/421 (65.08%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLK 1616
            I P+ PYSP  SPH SP     P    ++ S+           +S+T D    V LNQY+++ +IG+GSYG+V+LAYN  D+ YYAMK LSKK+L++ +G   RPPP        +    + P +   PL+++Y+EIA  KKL+H N+VKL+EVLDDPS++ LYMVFE V+ G VME+  D P  E ++R Y  D L G+EYLHYQKIIHRDIKP+NLL+ +   +KI+DFGVSN+F G D  L+STVG+PAF+APE++ +    F+GKALD+WA+G+TLY F+FG  P  +     L+Q I   P+  PE+  VS  + DLL KMLDKNP  RI +P IKVH W+T  G   LP E +NC  + I+V E+EV NS++ +P L TVI ++ +L+++SF NP  +G     + T  G  L K
Sbjct:  162 IYPSLPYSPITSPHSSPRLPRRP----TVESHR----------VSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLLRQAGFPRRPPP------RGAKSAPEGPPQPKGPLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKQGAVMEVPTDKPLNEDQSRFYFQDLLRGIEYLHYQKIIHRDIKPSNLLVGEDGHVKIADFGVSNQFEGADALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFIFGVCPFMDERILSLHQKIKTQPVELPEHADVSDDLKDLLFKMLDKNPETRITVPQIKVHPWVTRHGAEPLPPEDDNC-CSLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNPFDWGRREDRSPTTQGHTLAK 560          
BLAST of Si:ch73-62l21.1 vs. Ensembl Cavefish
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2-like [Source:NCBI gene;Acc:103036346])

HSP 1 Score: 372.474 bits (955), Expect = 1.616e-121
Identity = 200/421 (47.51%), Postives = 274/421 (65.08%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLK 1616
            I P+ PYSP  SPH SP     P    ++ S+           +S+T D    V LNQY+++ +IG+GSYG+V+LAYN  D+ YYAMK LSKK+L++ +G   RPPP        +    + P +   PL+++Y+EIA  KKL+H N+VKL+EVLDDPS++ LYMVFE V+ G VME+  D P  E ++R Y  D L G+EYLHYQKIIHRDIKP+NLL+ +   +KI+DFGVSN+F G D  L+STVG+PAF+APE++ +    F+GKALD+WA+G+TLY F+FG  P  +     L+Q I   P+  PE+  VS  + DLL KMLDKNP  RI +P IKVH W+T  G   LP E +NC  + I+V E+EV NS++ +P L TVI ++ +L+++SF NP  +G     + T  G  L K
Sbjct:  162 IYPSLPYSPITSPHSSPRLPRRP----TVESHR----------VSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLLRQAGFPRRPPP------RGAKSAPEGPPQPKGPLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKQGAVMEVPTDKPLNEDQSRFYFQDLLRGIEYLHYQKIIHRDIKPSNLLVGEDGHVKIADFGVSNQFEGADALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFIFGVCPFMDERILSLHQKIKTQPVELPEHADVSDDLKDLLFKMLDKNPETRITVPQIKVHPWVTRHGAEPLPPEDDNC-CSLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNPFDWGRREDRSPTTQGHTLAK 560          
BLAST of Si:ch73-62l21.1 vs. Ensembl Cavefish
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2-like [Source:NCBI gene;Acc:103036346])

HSP 1 Score: 370.548 bits (950), Expect = 3.822e-121
Identity = 199/419 (47.49%), Postives = 273/419 (65.16%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDL 1610
            I P+ PYSP  SPH SP     P    ++ S+           +S+T D    V LNQY+++ +IG+GSYG+V+LAYN  D+ YYAMK LSKK+L++ +G   RPPP        +    + P +   PL+++Y+EIA  KKL+H N+VKL+EVLDDPS++ LYMVFE V+ G VME+  D P  E ++R Y  D L G+EYLHYQKIIHRDIKP+NLL+ +   +KI+DFGVSN+F G D  L+STVG+PAF+APE++ +    F+GKALD+WA+G+TLY F+FG  P  +     L+Q I   P+  PE+  VS  + DLL KMLDKNP  RI +P IKVH W+T  G   LP E +NC  + I+V E+EV NS++ +P L TVI ++ +L+++SF NP  +G     + T  G  L
Sbjct:  162 IYPSLPYSPITSPHSSPRLPRRP----TVESHR----------VSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLLRQAGFPRRPPP------RGAKSAPEGPPQPKGPLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKQGAVMEVPTDKPLNEDQSRFYFQDLLRGIEYLHYQKIIHRDIKPSNLLVGEDGHVKIADFGVSNQFEGADALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFIFGVCPFMDERILSLHQKIKTQPVELPEHADVSDDLKDLLFKMLDKNPETRITVPQIKVHPWVTRHGAEPLPPEDDNC-CSLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNPFDWGRREDRSPTTQGHTL 558          
BLAST of Si:ch73-62l21.1 vs. Ensembl Cavefish
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2-like [Source:NCBI gene;Acc:103036346])

HSP 1 Score: 351.673 bits (901), Expect = 8.504e-114
Identity = 198/430 (46.05%), Postives = 272/430 (63.26%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPSLFLQRS 1643
            I P+ PYSP  SPH SP     P    ++ S+           +S+T D    V LNQY+++ +IG+GSYG+V+LAYN  D+ YYAMK LSKK+L++ +G   RPPP        +    + P +   PL+++Y+EIA  KKL+H N+VKL+EVLDDPS++ L+MV   V    VME+  D P  E ++R Y  D L G+EYLHYQKIIHRDIKP+NLL+ +   +KI+DFGVSN+F G D  L+STVG+PAF+APE++ +    F+GKALD+WA+G+TLY F+FG  P  +     L+Q I   P+  P+   VS  + DLL KMLDKNP  RI +P IKVH W+T  G   LP E +NC  + I+V E+EV NS++ +P L TVI ++ +L+++SF NP  +G     + T  G  L K  S    RS
Sbjct:  162 IYPSLPYSPITSPHSSPRLPRRP----TVESHR----------VSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLLRQAGFPRRPPP------RGAKSAPEGPPQPKGPLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLHMVCMCVYRA-VMEVPTDKPLNEDQSRFYFQDLLRGIEYLHYQKIIHRDIKPSNLLVGEDGHVKIADFGVSNQFEGADALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFIFGVCPFMDERILSLHQKIKTQPVELPDA-DVSDDLKDLLFKMLDKNPETRITVPQIKVHPWVTRHGAEPLPPEDDNC-CSLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNPFDWGRREDRSPTTQGHTLAKQESGEGMRS 567          
BLAST of Si:ch73-62l21.1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006410.1 (pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 gene:ENSPMAG00000005688.1 transcript:ENSPMAT00000006410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.561 bits (314), Expect = 1.515e-30
Identity = 98/334 (29.34%), Postives = 158/334 (47.31%), Query Frame = 3
Query:  393 HVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWI 1391
            H+S E R      +S+  N      R  SSI+  E+   + H+  Y++ + IG+G++  V+LA +                      L  R   I+    +         Q     LQK+++E+   K LNH NIVKL EV++  +++ LY+V EY   G V + +       E +AR      +  ++Y H + I+HRD+K  NLLL     IKI+DFG SNEFT  +  L +  GSP + APE  +     + G  +D+W+LG+ LY  + G +P +  N   L + ++      P    +S    +LL + L  NP++R  +  I   +W+
Sbjct:    1 HLSMEGRFDTPSSKSLRVNG----SRSRSSIACGEE---LPHIGNYRLLKTIGKGNFAKVKLARHI---------------------LTGREVAIKIIDKT---------QLNPTSLQKLFREVRIMKCLNHPNIVKLYEVIE--TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKNIVHRDLKAENLLLDVDMHIKIADFGFSNEFTLVN-KLDTFCGSPPYAAPELFQGKK--YDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELREKVLRGKYRIPF--YMSTDCENLLKRFLVLNPIKRGSLEQIMRDRWM 290          
BLAST of Si:ch73-62l21.1 vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 125.176 bits (313), Expect = 2.892e-30
Identity = 94/317 (29.65%), Postives = 152/317 (47.95%), Query Frame = 3
Query:  444 SNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWI 1391
            S S G+  R+  SI+V E  +   H+  Y++ + IG+G++  V+LA ++                     L  R   ++    +         Q     LQK+++E+   K LNH NIVKL EV++  +++ LY+V EY   G V + +       E +AR      +  ++Y H + I+HRD+K  NLLL     IKI+DFG SNEFT     L +  GSP + APE  +     + G  +D+W+LG+ LY  + G +P +  N   L + ++      P    +S    +LL + L  NP +R  +  I   +W+
Sbjct:   30 SRSSGARCRN--SITVAEVEH--AHIGTYRLLKTIGKGNFAKVKLARHT---------------------LTGREVAVKIIDKT---------QLNPSSLQKLFREVRIMKILNHPNIVKLFEVIE--TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGS-KLDTFCGSPPYAAPELFQGKK--YDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPF--YMSTDCENLLKRFLVLNPAKRGSLEQIMKDRWM 305          
BLAST of Si:ch73-62l21.1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 9.826e-30
Identity = 74/224 (33.04%), Postives = 115/224 (51.34%), Query Frame = 3
Query:  744 QKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLS---KLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILY--PENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITN 1397
            QK+ +E    + L H+NIV+L E + +    F Y+VF+ V  G + E I     + E  A   I   L  + + H   I+HRD+KP NLLL+   K   +K++DFG++ E  GD        G+P +++PE +R   +   GK +D+WA G+ LY  L G  P  + ++  LYQ I      +  PE  +V+    +L+++ML  NP +RI       H WI  
Sbjct:   56 QKLEREARICRLLKHSNIVRLHESIAEEG--FHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPY---GKPVDMWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWICQ 274          
BLAST of Si:ch73-62l21.1 vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 120.553 bits (301), Expect = 1.026e-29
Identity = 75/218 (34.40%), Postives = 116/218 (53.21%), Query Frame = 3
Query:  741 LQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWI 1391
            LQK+++E+   K LNH NIVKL EV++   ++ LY+V EY   G V + +       E +AR      +  ++Y H + I+HRD+K  NLLL     IKI+DFG SNEFT     L +  GSP + APE  +     + G  +D+W+LG+ LY  + G +P +  N   L + ++      P    +S    +LL + L  +PL+R  +  I   +W+
Sbjct:  109 LQKLFREVRIMKVLNHPNIVKLFEVIE--MEKTLYLVMEYSSGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGS-KLDTFCGSPPYAAPELFQGKK--YDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFY--MSTDCENLLKRFLVLHPLKRGSLEQIMKDRWM 319          
BLAST of Si:ch73-62l21.1 vs. Ensembl Sea Lamprey
Match: stk11 (serine/threonine kinase 11 [Source:ZFIN;Acc:ZDB-GENE-050417-383])

HSP 1 Score: 108.997 bits (271), Expect = 3.833e-28
Identity = 63/152 (41.45%), Postives = 90/152 (59.21%), Query Frame = 3
Query:  756 KEIAFHKKLNHANIVKLIEVL-DDPSQEFLYMVFEYVENG--PVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNE---FTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITL 1193
            +EI   K+L H N++ L++VL ++  Q+ +YMV EY   G   +++      FP  +A  Y    + GLEYLH Q I+H+DIKP NLLL+    +KISD GV+     F  DD   +S  GSPAF  PE + +G   F+G  +DIW+ G+TL
Sbjct:    1 REIQLLKRLKHKNVISLVDVLYNEEKQKLVYMVMEYCVCGMQEMLDSVTGKKFPIFQAHGYFSQLVDGLEYLHSQGIVHKDIKPGNLLLTTEGTLKISDLGVAEALDVFALDDTCRTSQ-GSPAFQPPE-IANGLETFSGFKVDIWSSGVTL 150          
BLAST of Si:ch73-62l21.1 vs. Ensembl Yeast
Match: TOS3 (Protein kinase; related to and functionally redundant with Elm1p and Sak1p for the phosphorylation and activation of Snf1p; functionally orthologous to LKB1, a mammalian kinase associated with Peutz-Jeghers cancer-susceptibility syndrome; TOS3 has a paralog, SAK1, that arose from the whole genome duplication [Source:SGD;Acc:S000003147])

HSP 1 Score: 156.377 bits (394), Expect = 1.548e-41
Identity = 114/333 (34.23%), Postives = 168/333 (50.45%), Query Frame = 3
Query:  519 LNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQ------KIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPV-------MEIGKDSP--FPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVS-NEFTG--------DDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPE-----NPSVSVGVMD-------LLHKMLDKNPLERIKIPNIKVHQWITNDGKN 1409
            LN ++I   +G G YG V+LA +       A+K            + NR                   +R+   LQ      ++ +EI   K+ +H N+V+L E+L+DP    +Y+V EY   GPV       MEI    P      ++RK ++D + GLEYLH Q I HRDIKP+NLL+S    +KISDFGV+ +  TG        + +  S  +G+PAF APE            A+DIW+LG+T+Y  LFGK+P    +   L+  IIN P+ +P      N + S   M+       LL K+L K+P +RIK+ +IKVH ++ + GK+
Sbjct:   47 LNNFEILATLGNGQYGKVKLARDLGTGALVAIK------------ILNR-----------------FEKRSGYSLQLKVENPRVNQEIEVMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTFQQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQSSHEQLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNANSGLELFDSIINKPLEFPSYEEMLNGATSGITMEEYTDAKDLLKKLLQKDPDKRIKLADIKVHPFMCHYGKS 350          
BLAST of Si:ch73-62l21.1 vs. Ensembl Yeast
Match: SAK1 (Upstream serine/threonine kinase for the SNF1 complex; plays a role in pseudohyphal groth; partially redundant with Elm1p and Tos3p; members of this family have functional orthology with LKB1, a mammalian kinase associated with Peutz-Jeghers cancer-susceptibility syndrome; SAK1 has a paralog, TOS3, that arose from the whole genome duplication [Source:SGD;Acc:S000000931])

HSP 1 Score: 149.443 bits (376), Expect = 2.840e-38
Identity = 122/361 (33.80%), Postives = 181/361 (50.14%), Query Frame = 3
Query:  468 RDVSSISVTED--SNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPV-------MEIGKDSPFPEI----KARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVS----------NEFTGDDVYLSSTVGSPAFMAPESVRDGD----------HCFTGKA----LDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYP-----ENPSVSVGVMDLLHKML--------DKNPLERIKIPNIKVHQWITND 1400
            ++ + IS+T D  S R V LN Y+I +++G G +G V+LA +       A+K +                  R               + S+   KI +EIA  KK +H ++V+LIEVLDD     +Y+V EY   G V       ME   D+  P +    + R+ +   +LGLEYLHYQ IIHRDIKPANLL+S    +KISDFGVS          +  + D++ L+ TVG+PAF APE     D          + F G      +DIWA+G+TLY  LFG +P  +     L++ I+N+P+ +P     ++  VS    +  ++M         +KNP +R+ IP IK H +++ D
Sbjct:  112 KETNRISLTYDPVSKRKV-LNTYEIIKELGHGQHGKVKLARDILSKQLVAIKIVD-----------------RHEKKQRKFFTFIKSSKISEN-DKIKREIAIMKKCHHKHVVQLIEVLDDLKSRKIYLVLEYCSRGEVKWCPPDCME--SDAKGPSLLSFQETREILRGVVLGLEYLHYQGIIHRDIKPANLLISGDGTVKISDFGVSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFRGSCISFMIDIWAVGVTLYCLLFGMLPFFSDFELKLFEKIVNDPLKFPTFKEIQSNKVSKVSCEEEYEMAKDLLLKLLEKNPQKRMTIPAIKKHPFVSWD 451          
BLAST of Si:ch73-62l21.1 vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 136.732 bits (343), Expect = 1.500e-34
Identity = 92/296 (31.08%), Postives = 150/296 (50.68%), Query Frame = 3
Query:  513 VHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITND 1400
             H+  YQI + +G+GS+G V+LAY++      A+K            + N+    +                 SD   +I +EI++ + L H +I+KL +V+   S++ + MV EY  N     I +     E +AR++    +  +EY H  KI+HRD+KP NLLL +   +KI+DFG+SN  T D  +L ++ GSP + APE +      + G  +D+W+ G+ LY  L  ++P ++ +  +L++ I N     P+   +S G   L+ +ML  NPL RI I  I    W   D
Sbjct:   50 AHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALK------------IINKKVLAK-----------------SDMQGRIEREISYLRLLRHPHIIKLYDVI--KSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMT-DGNFLKTSCGSPNYAAPEVI--SGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPK--FLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVD 309          
BLAST of Si:ch73-62l21.1 vs. Ensembl Yeast
Match: KIN4 (Serine/threonine protein kinase; inhibits the mitotic exit network (MEN) when the spindle position checkpoint is activated; localized asymmetrically to mother cell cortex, spindle pole body and bud neck; KIN4 has a paralog, FRK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005759])

HSP 1 Score: 131.339 bits (329), Expect = 1.813e-32
Identity = 77/231 (33.33%), Postives = 124/231 (53.68%), Query Frame = 3
Query:  723 QRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNR-------FLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWI 1391
            ++ +D   KIY+EI   K L H NI+ L EVL +   +++ +V E+V  G   + I +     E  A +     + G+ Y+HY+ ++HRD+K  NLLL K + + I+DFG  NEF  D+  + ++ GSP + APE V      +  +  D+W+ G+ LYA L G +P ++ +          LY+ I   P+ +PE   ++    DLL ++L  NP  RI +  IK H W+
Sbjct:   88 KKDADKEIKIYREINALKHLTHPNIIYLEEVLQN--SKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMKTSCGSPCYAAPELVV-STKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYKYITQTPLKFPE--YITPIPRDLLRRILVPNPRRRINLQTIKRHVWL 313          
BLAST of Si:ch73-62l21.1 vs. Ensembl Yeast
Match: FRK1 (Protein kinase of unknown cellular role; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; interacts with rRNA transcription and ribosome biogenesis factors and the long chain fatty acyl-CoA synthetase Faa3p; FRK1 has a paralog, KIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000006062])

HSP 1 Score: 129.798 bits (325), Expect = 6.568e-32
Identity = 78/223 (34.98%), Postives = 120/223 (53.81%), Query Frame = 3
Query:  747 KIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPL-------ENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWI 1391
            KIY+EI   K L+H NIVKL EVL +    ++ +V EY   G   + I K     E+ A +     + G+ Y+H + ++HRD+K  NLLL K + + I+DFG  NEF   +  + ++ GSP + APE V   +  +  +  DIW+ G+ LYA L G +P        E  +   LY  I + P+ +P+   +     DLL +ML  +P +RI +  IK H+W+
Sbjct:   96 KIYREINALKHLSHPNIVKLEEVLQN--SRYIGIVLEYACGGEFYKYIQKKRRLKEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKTSCGSPCYAAPELVISAE-PYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYNYINSTPLKFPD--YILPIPRDLLRRMLVSDPKKRINLKQIKKHEWL 313          
BLAST of Si:ch73-62l21.1 vs. Ensembl Nematostella
Match: EDO35522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL93])

HSP 1 Score: 291.197 bits (744), Expect = 1.498e-93
Identity = 163/383 (42.56%), Postives = 247/383 (64.49%), Query Frame = 3
Query:  543 QIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDP-LQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPSLFLQRSS----FDALSLVPDD 1676
            +IG+GSYG+V+L Y+  D + YAMK +SKK++MK +GL  RP                   R  +P L+ + +EIA  KK++H N+V+L EVLDDP+++ LY+VFE ++ G VME+    P  +  AR +  + +LG+EYLH+ KI+HRDIKP+NLL+S+   IKI+DFGV++ F GDD  LS T GSPAFMAPES++     ++GKA+D+WA+GITLY F+FGK P E+ NR  LY+ I    +++   P ++  + DLL +ML KNP ERI IP IK H W+T  G + LP+  ENC  + I++ ++++ANS+R +P+++T+I +K +L+ K+F +  +   + R +   N   +++   L  QR+      D+  L P D
Sbjct:    3 EIGKGSYGVVRLCYSDFDQSSYAMKIISKKRIMKKAGL-RRPG-----------------DRGKNPGLENLQREIAILKKVDHPNVVRLNEVLDDPAEDNLYLVFELMDKGDVMEV-PGPPLQQETARTHFRELVLGVEYLHHHKIVHRDIKPSNLLVSESGSIKIADFGVADVFEGDDALLSKTAGSPAFMAPESLQTSRDKYSGKAVDVWAMGITLYCFVFGKCPFEDENRMGLYEKIRTKDVVFCNRPVLNPKLEDLLLRMLTKNPKERITIPEIKEHPWVTRGGSDPLPSTQENC--SHIEITDEDIANSVRTIPKIKTLILVKSMLRYKTFGSHSKLQRL-RSHSQPNIASIVEQKRLQEQRAKTNLQIDSQELQPHD 363          
BLAST of Si:ch73-62l21.1 vs. Ensembl Nematostella
Match: EDO45439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTB4])

HSP 1 Score: 147.132 bits (370), Expect = 3.324e-39
Identity = 87/230 (37.83%), Postives = 132/230 (57.39%), Query Frame = 3
Query:  723 QRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYV--ENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDI--KPANLLLSKLDVIKISDFGVSNE---FTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWI 1391
            +R  +  Q + +EI   K+LNH N+++L +V+ D  ++ +YM+FEY   E   ++E   D  FP  +A  Y    + GL+YLH Q ++H+DI  +P+NLLLS    +KISD GV+     F+ DD   +S  GSPAF  PE + +G   F+G  +DIWA G+TLY    GK P E  N + L++ I       P+   V   + DLL  ML+ +P +R+ I  I+ H+W+
Sbjct:  110 RRIPNGEQNVKREIRLLKRLNHKNVIQLYDVIYDEVKQKMYMIFEYCVGELQEMLESVDDRKFPISQAHGYFCQLMDGLKYLHCQGVVHKDILFQPSNLLLSTDGTLKISDLGVAERLSPFSADDTCRTSQ-GSPAFQPPE-IANGLETFSGFKVDIWAAGVTLYNITTGKYPFEGDNIYRLFENIGKGEFSIPD--EVDDSLSDLLKGMLNPDPEKRLTIEQIRNHRWV 335          
BLAST of Si:ch73-62l21.1 vs. Ensembl Nematostella
Match: EDO36169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJE6])

HSP 1 Score: 132.88 bits (333), Expect = 3.759e-33
Identity = 82/232 (35.34%), Postives = 127/232 (54.74%), Query Frame = 3
Query:  726 RASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLP 1418
            ++ D + KI +EI   K   H +I+KL +V+  P+   ++MV EYV  G + E I K     E  AR++    + G++Y H   ++HRD+KP NLLL     IKI+DFG+SN  T D  +L ++ GSP + APE +      + G  +DIW+ G+ LYA L G +P ++ +   L++ I       P  P +S G   LL+ ML+ +P++R  +  IK   W     K +LP
Sbjct:   57 KSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTD--IFMVMEYVSGGELFEYILKHGKLEEKDARRFFQQIISGVDYCHRHMVVHRDLKPENLLLDSQLNIKIADFGLSNIMT-DGEFLQTSCGSPNYAAPEVI--SGKLYAGPEVDIWSAGVILYALLCGTLPFDDEHIPTLFRKIKGGVFHVP--PHLSSGPASLLNAMLNVDPIKRATVQFIKEDDWF----KTELP 277          
BLAST of Si:ch73-62l21.1 vs. Ensembl Nematostella
Match: EDO46035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR22])

HSP 1 Score: 124.02 bits (310), Expect = 2.197e-31
Identity = 94/326 (28.83%), Postives = 153/326 (46.93%), Query Frame = 3
Query:  510 IVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWIT------NDGKNQLPTEAENCGFASIDVNED 1466
            +V +  Y I + IG+G++ +V+LA +    +  A+K + K                               Q   D L K+ +E+   KKL H +I+KL EV++  ++  LY+V EY   G + + +       E +A+      +  +EY H   I+HRD+K  NLLL +   IKI+DFG SN F  D   L +  GSP + APE     +  + G  +DIW+LG+ LY  + G +P +      L   +++     P    +S     L+  ML ++P++R  IP I+ H+W+       N  +N L    E+C    +D+ ED
Sbjct:   14 VVRIGFYNIEKTIGKGNFAVVKLATHCITKSKVAVKIIDK------------------------------SQLDDDNLTKVKREVKVMKKLAHPHIIKLHEVME--TERMLYLVTEYASKGEIFDYLVAHGRMQEKEAKNTFNQIVSAIEYCHKMNIVHRDLKAENLLLDEDMNIKIADFGFSNIFQADK-KLKTWCGSPPYAAPELFEGKE--YLGPEVDIWSLGVVLYVLVCGALPFDGSTLQSLRSRVLDGRFRIP--FFMSTECEHLIRHMLVRDPVKRFTIPQIRQHKWMAEVTGKKNKEENPLYIH-ESC--QDVDIRED 299          
BLAST of Si:ch73-62l21.1 vs. Ensembl Nematostella
Match: EDO30768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZV3])

HSP 1 Score: 122.479 bits (306), Expect = 2.629e-29
Identity = 87/294 (29.59%), Postives = 141/294 (47.96%), Query Frame = 3
Query:  513 VHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWI 1391
            VH+ +Y++ + IG+G++  V+LA +       A+K + K                               Q     LQK+++E+   K L+H NIVKL EV++  + + LY+V EY   G V + +       E +AR      +  ++Y H + +IHRD+K  NLLL     IKI+DFG SNEFT  +  L +  GSP + APE  +     + G  +D+W+LG+ LY  + G +P +  N   L + ++      P    +S    +LL K L  NP +R ++      +W+
Sbjct:   33 VHIGRYRLIKTIGKGNFAKVKLAKHVPTGKEVAIKIIDKT------------------------------QLNPSSLQKLFREVRIMKFLDHPNIVKLYEVIE--TDKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHVIHRDLKAENLLLDADMNIKIADFGFSNEFTPGN-KLDTFCGSPPYAAPELFQGKK--YDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPF--YMSTDCENLLKKFLVLNPQKRARLEQTMTDKWM 289          
BLAST of Si:ch73-62l21.1 vs. Ensembl Medaka
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2 [Source:NCBI gene;Acc:101173723])

HSP 1 Score: 370.548 bits (950), Expect = 4.174e-121
Identity = 198/405 (48.89%), Postives = 268/405 (66.17%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFG 1568
            I P+ PYSP  SPH SP     P    ++ S+S          +S+T D    V LNQY+++ +IG+GSYG+V+LAYN  D+ YYAMK LSKKKLM+ +G   RP P        +    + P +   PL+++Y+EIA  KKL+H N+VKL+EVLDDPS++ LYMVFE V+ G VME+  D PF E +AR Y  D L G+EYLHYQKIIHRD+KP+NLL+ +   IKI+DFGVSN+F G D  L+STVG+PAF+APE++ +    F+GKALD+WA+G+TLY F+FG  P  +     L+Q I   P+  PE   +S  + DLL KML+KNP  RI +P IKVH W+T  G   LP E +NC    I+V E+EV NS++ +P L TVI ++ +L+++SF NP  +G
Sbjct:  153 IYPSLPYSPITSPHSSPRLPRRP----TVESHS----------VSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKKLMRQAGFPRRPAP------RGARALPEGPTQPKGPLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKKGAVMEVPTDKPFGEDQARFYFQDLLRGIEYLHYQKIIHRDVKPSNLLVGEDGHIKIADFGVSNQFEGSDALLTSTVGTPAFLAPEALSETRKNFSGKALDVWAMGVTLYCFVFGVCPFMDERILSLHQKIKTQPVGIPERADISDDLKDLLFKMLEKNPETRITVPQIKVHSWVTRHGAEPLPPEDDNC-CTLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNPFDWG 535          
BLAST of Si:ch73-62l21.1 vs. Ensembl Medaka
Match: camkk1a (calcium/calmodulin dependent protein kinase kinase 1 [Source:NCBI gene;Acc:101171272])

HSP 1 Score: 347.821 bits (891), Expect = 2.166e-113
Identity = 191/406 (47.04%), Postives = 256/406 (63.05%), Query Frame = 3
Query:  372 YSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINE 1589
            Y P    H+SP     P            +++    SIS   DS   + LNQY+++ +IG+GSYG+V+LAYN  D  +YAMK  SKKKLMK  G         +              +   PL+++Y+EIA  KKL+H NIVKL+EVLDDPS + L+MVFE +  GPVME+  + PF E +AR Y  D +LG+EYLHYQKIIHRDIKP+NLLL     +KI+DFGVSN+F G+D  LSST G+PAFMAPE++ +    F+GKALD+WA+G+TLY F+FGK P  +     L+  I   P+ +PE P +S  +  L+ +MLDKNP  RI IP IKV QW+T  G   LP E E+C    ++V E+E+ NS++FVP L  VI +K +L+++SF+NP  F S SR  E
Sbjct:   78 YPPSGQMHISPRVSHRP------------TVESKRVSIS---DSQDCIQLNQYKLKSEIGKGSYGVVKLAYNEDDDKHYAMKVFSKKKLMKQCGFPR------RPPPRGPKAAQGEQPKILGPLERVYQEIAILKKLDHVNIVKLVEVLDDPSDDNLHMVFELMPKGPVMEVPAEHPFSEEQARLYFRDIILGIEYLHYQKIIHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLSEKHKSFSGKALDVWAMGVTLYCFVFGKCPFIDEYILALHNKIKTKPVDFPETPEISEALRTLILRMLDKNPDTRITIPEIKVDQWVTKGGTEPLPLEEEHCSV--VEVTEEEIQNSVKFVPSLSAVILVKAMLRKRSFSNP--FESPSRREE 458          
BLAST of Si:ch73-62l21.1 vs. Ensembl Medaka
Match: camkk1a (calcium/calmodulin dependent protein kinase kinase 1 [Source:NCBI gene;Acc:101171272])

HSP 1 Score: 347.821 bits (891), Expect = 2.994e-113
Identity = 191/406 (47.04%), Postives = 256/406 (63.05%), Query Frame = 3
Query:  372 YSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINE 1589
            Y P    H+SP     P            +++    SIS   DS   + LNQY+++ +IG+GSYG+V+LAYN  D  +YAMK  SKKKLMK  G         +              +   PL+++Y+EIA  KKL+H NIVKL+EVLDDPS + L+MVFE +  GPVME+  + PF E +AR Y  D +LG+EYLHYQKIIHRDIKP+NLLL     +KI+DFGVSN+F G+D  LSST G+PAFMAPE++ +    F+GKALD+WA+G+TLY F+FGK P  +     L+  I   P+ +PE P +S  +  L+ +MLDKNP  RI IP IKV QW+T  G   LP E E+C    ++V E+E+ NS++FVP L  VI +K +L+++SF+NP  F S SR  E
Sbjct:   78 YPPSGQMHISPRVSHRP------------TVESKRVSIS---DSQDCIQLNQYKLKSEIGKGSYGVVKLAYNEDDDKHYAMKVFSKKKLMKQCGFPR------RPPPRGPKAAQGEQPKILGPLERVYQEIAILKKLDHVNIVKLVEVLDDPSDDNLHMVFELMPKGPVMEVPAEHPFSEEQARLYFRDIILGIEYLHYQKIIHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLSEKHKSFSGKALDVWAMGVTLYCFVFGKCPFIDEYILALHNKIKTKPVDFPETPEISEALRTLILRMLDKNPDTRITIPEIKVDQWVTKGGTEPLPLEEEHCSV--VEVTEEEIQNSVKFVPSLSAVILVKAMLRKRSFSNP--FESPSRREE 458          
BLAST of Si:ch73-62l21.1 vs. Ensembl Medaka
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2 [Source:NCBI gene;Acc:101173723])

HSP 1 Score: 338.191 bits (866), Expect = 4.970e-109
Identity = 189/405 (46.67%), Postives = 258/405 (63.70%), Query Frame = 3
Query:  354 ILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFG 1568
            I P+ PYSP  SPH SP     P    ++ S+S          +S+T D    V LNQY+++ +IG+GSYG+V+LAYN  D+ YYAMK LSKKKLM+ +G   RP P        +    + P +   PL+++Y+EIA  KKL+H N+VKL+EV        L M  + V+ G VME+  D PF E +AR Y  D L G+EYLHYQKIIHRD+KP+NLL+ +   IKI+DFGVSN+F G D  L+STVG+PAF+APE++ +    F+GKALD+WA+G+TLY F+FG  P  +     L+Q I   P+  PE   +S  + DLL KML+KNP  RI +P IKVH W+T  G   LP E +NC    I+V E+EV NS++ +P L TVI ++ +L+++SF NP  +G
Sbjct:  118 IYPSLPYSPITSPHSSPRLPRRP----TVESHS----------VSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKKLMRQAGFPRRPAP------RGARALPEGPTQPKGPLERVYQEIAILKKLDHPNVVKLVEV------SHLTM-LKLVKKGAVMEVPTDKPFGEDQARFYFQDLLRGIEYLHYQKIIHRDVKPSNLLVGEDGHIKIADFGVSNQFEGSDALLTSTVGTPAFLAPEALSETRKNFSGKALDVWAMGVTLYCFVFGVCPFMDERILSLHQKIKTQPVGIPERADISDDLKDLLFKMLEKNPETRITVPQIKVHSWVTRHGAEPLPPEDDNC-CTLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNPFDWG 493          
BLAST of Si:ch73-62l21.1 vs. Ensembl Medaka
Match: camkk1b (calcium/calmodulin-dependent protein kinase kinase 1-like [Source:NCBI gene;Acc:101160011])

HSP 1 Score: 311.997 bits (798), Expect = 5.204e-100
Identity = 172/364 (47.25%), Postives = 241/364 (66.21%), Query Frame = 3
Query:  471 DVSSISVTE-DSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPL 1559
            +   +S+T+ D    V +NQY+++++IG+GSYG+V+LAY+     YYAMK +SKKKLM+  G    PP         +      P +   PL KIY+EIA  KKL+H N+V L+EVLDDP ++ L+M FE +   PVMEI  D P  E +AR Y  D +LG+EY HY KIIHRDIKP+NLLL     +KI+DFGVSNEF G D  LS+T G+PAFMAPE++ +    F+GKALD+WA+G+TLY F+FGK P  +     L+  I N P+ +PE P +S  +  L+ +MLDKNP  RI +P IK+H W+T +  N LP E E+C   +++V E++V NS++ +P L  VI +K +L+++SF+NP 
Sbjct:   75 ETKRVSITDADLQDCVQMNQYKLKKEIGKGSYGVVKLAYDEGSEQYYAMKVVSKKKLMRQCGFLRLPP--------ANLQQDGYP-KGMLPLDKIYREIAILKKLDHHNVVNLVEVLDDPDEDGLHM-FELMTR-PVMEIPTDEPLKEGQARFYFRDLVLGIEY-HYHKIIHRDIKPSNLLLGDDGHLKIADFGVSNEFEGTDDLLSTTAGTPAFMAPETMTEHFQFFSGKALDVWAMGVTLYCFVFGKCPFYDEYIVSLHNKIKNKPVEFPE-PEISDELKHLIERMLDKNPATRITVPEIKLHPWVTENSLNPLPLEEEHC--KAVEVTEEDVQNSVKLIPSLSAVILVKAMLRKRSFSNPF 423          
BLAST of Si:ch73-62l21.1 vs. Planmine SMEST
Match: SMESG000067484.1 (SMESG000067484.1)

HSP 1 Score: 1055.82 bits (2729), Expect = 0.000e+0
Identity = 545/550 (99.09%), Postives = 547/550 (99.45%), Query Frame = 3
Query:   66 MGIGCYSIDREKSGFRKQIVDGIETSYQSYTISKVLDIPSVKTFPINQDFETDKIIENYNSTNSLSSAFPNHSDSCGKLAQLNWQNSEENKFGLPSILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPSLFLQRSSFDALSLVPDDRQFAKSFKIDEVN 1715
            MGIGCYSIDREKSGFRKQIVDGIETSYQSYTIS+VLDIPSVKTFPINQDFETDKIIENYNSTNSLSSAFPNHSDSCGKLAQLNWQNSEENKFGL SILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAMKSLSKKKLMKSSGLFNRPPPIRKSTSSMSSMGTKSPQRASDPLQKIYKEIAFHKKLNH NIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPSLFLQRSSFDALS VPDDRQFAK+FKIDEVN
Sbjct:    1 MGIGCYSIDREKSGFRKQIVDGIETSYQSYTISRVLDIPSVKTFPINQDFETDKIIENYNSTNSLSSAFPNHSDSCGKLAQLNWQNSEENKFGLRSILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAMKSLSKKKLMKSSGLFNRPPPIRKSTSSMSSMGTKSPQRASDPLQKIYKEIAFHKKLNHTNIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPSLFLQRSSFDALSPVPDDRQFAKNFKIDEVN 550          
BLAST of Si:ch73-62l21.1 vs. Planmine SMEST
Match: SMESG000067484.1 (SMESG000067484.1)

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 527/553 (95.30%), Postives = 531/553 (96.02%), Query Frame = 3
Query:   66 MGIGCYSIDREKSGFRKQI---VDGIETSYQSYTISKVLDIPSVKTFPINQDFETDKIIENYNSTNSLSSAFPNHSDSCGKLAQLNWQNSEENKFGLPSILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPSLFLQRSSFDALSLVPDDRQFAKSFKIDEVN 1715
            MGIGCYSIDREKSGFRKQI       E ++ S+     L     KTFPINQDFETDKIIENYNSTNSLSSAFPNHSDSCGKLAQLNWQNSEENKFGL SILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAMKSLSKKKLMKSSGLFNRPPPIRKSTSSMSSMGTKSPQRASDPLQKIYKEIAFHKKLNH NIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPSLFLQRSSFDALS VPDDRQFAK+FKIDEVN
Sbjct:    1 MGIGCYSIDREKSGFRKQISFRYSICENTFASWMYRYYL-----KTFPINQDFETDKIIENYNSTNSLSSAFPNHSDSCGKLAQLNWQNSEENKFGLRSILPNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAMKSLSKKKLMKSSGLFNRPPPIRKSTSSMSSMGTKSPQRASDPLQKIYKEIAFHKKLNHTNIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRFGSVSRINETKNGTDLLKDPSLFLQRSSFDALSPVPDDRQFAKNFKIDEVN 548          
BLAST of Si:ch73-62l21.1 vs. Planmine SMEST
Match: SMESG000070678.1 (SMESG000070678.1)

HSP 1 Score: 300.827 bits (769), Expect = 3.453e-95
Identity = 169/395 (42.78%), Postives = 250/395 (63.29%), Query Frame = 3
Query:  468 RDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXX----------------------XXXXXXXPQRAS-----------------DPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLK 1535
            R+ S +S TED   +V +NQY++ + +G+G+YG V+L  + +D N YA+K +SK+KLMKSSG F RPPP+R +++S                       S    +SPQR +                 DPL++IY+E+A +KKL++ +IVKL EV+D+   + +YM+FE++E GPVM +G   P  E   RKY  D + GL+YLH+ KI+HRDIKP+NLL+ K  ++K+ DFGVS +FTGDD++L  T+GSPAF+APE V+D    FTGKALDIWALG+TL+ FLFGKV  ++ N+  LY  I   PI+ P+ P +S  V DLL KML+K P ERI + +IK H W+T +G    P + ++     I+V+++E+ +      R++T++   M+ +
Sbjct:  109 RESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVED-RDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSCQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQTPEISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQH-NSQQIEVSDNEIDHCTVKPVRIQTIVSALMMAR 501          
BLAST of Si:ch73-62l21.1 vs. Planmine SMEST
Match: SMESG000055720.1 (SMESG000055720.1)

HSP 1 Score: 135.191 bits (339), Expect = 1.675e-33
Identity = 92/290 (31.72%), Postives = 147/290 (50.69%), Query Frame = 3
Query:  726 RASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASID------------VNEDEV-ANSIRFVPRLETVIKIKMLLKQKSFAN 1553
            +A D   K+ +EI       H +I+KL +V+  P+   ++M+ EYV  G + + I K     E  ARK+    + G++Y H  K++HRD+KP NLLL     +KI+DFG+SN    D  +L ++ GSP + APE +      + G  +D+W+ G+ LYA L G +P ++ +   L++ I +     P+   +S  V DLL KML  +P++R+ +  I+ H W   D  N L  +  +   + ID            V E EV A  I   P  + VI   ++   K F +
Sbjct:   60 KALDVAGKLRREIQNLWLFRHPHIIKLYQVISTPTD--IFMIMEYVSGGELFDHIVKSGKLNEKDARKFFQQIVSGVDYCHRHKVVHRDLKPENLLLDSQKNVKIADFGLSN-IMQDGEFLRTSCGSPNYAAPEVI--SGKLYAGPEVDVWSCGVILYALLCGTLPFDDEHIPNLFKKIKSGLFHMPD--YLSSNVKDLLKKMLTVDPVKRVTVEEIRKHPWFIIDLPNYLFPQERDEDASIIDKEAVYEVCRACNVTEREVFAALIAHDPSDQLVIAYSLITDNKRFGS 342          
BLAST of Si:ch73-62l21.1 vs. Planmine SMEST
Match: SMESG000042362.1 (SMESG000042362.1)

HSP 1 Score: 130.954 bits (328), Expect = 2.059e-31
Identity = 108/359 (30.08%), Postives = 169/359 (47.08%), Query Frame = 3
Query:  360 PNFPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIVHLN-----QYQIRQQIGQGSYGLVQLAYNSKDSNYYAXXXXXXXXXXXXXGLFNRPPPIRXXXXXXXXXXXXXPQRASDPLQKIYKEIAFHKKLNHANIVKLIEVLDDPSQEFLYMVFEYVENGPVME-IGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLP 1418
            P+F   P N P      R +P+G       S GS +  VSS   + +++ +   N     +Y++ ++IG+G++  V+LA +       A+K + K K        N P                        LQK+ +E+   K+LNH NIV+L EV+   ++  LY+V E  +NG V E + K+    E  AR      +  ++Y H + I+HRD+K  NLLL K   IKI+DFG SN F+     L++  GSP + APE  +     + G  +D+W+LG+ LY  + G +P +      L + ++      P    +S     LL KML  NP  R+ + +I    WI N G  + P
Sbjct:   84 PHFNTQPINGP------RSYPNGT------SAGSTRSSVSSRGASGNNSSMSERNGPTFGKYKLIREIGKGNFAKVKLAQHLITGKEVAVKIIDKTK-------LNAPA-----------------------LQKLTREVKIMKELNHPNIVRLYEVIQ--TERSLYLVMENAQNGEVFEYLVKNGRMKEKDARAKFRQIVSAVQYCHQKMIVHRDLKAENLLLDKDLSIKIADFGFSNHFSRQS-KLNTFCGSPPYAAPELFQ--GRRYEGPEVDVWSLGVILYTLISGSLPFDGGTLRELRERVLRGKYRIPF--YMSSDCEALLRKMLVLNPQRRLPLTDIMKDTWI-NVGYEECP 392          
The following BLAST results are available for this feature:
BLAST of Si:ch73-62l21.1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAMKK18.662e-11446.85calcium/calmodulin dependent protein kinase kinase... [more]
CAMKK11.487e-11347.61calcium/calmodulin dependent protein kinase kinase... [more]
CAMKK11.876e-10642.76calcium/calmodulin dependent protein kinase kinase... [more]
CAMKK22.875e-10347.12calcium/calmodulin dependent protein kinase kinase... [more]
CAMKK26.331e-10347.38calcium/calmodulin dependent protein kinase kinase... [more]
back to top
BLAST of Si:ch73-62l21.1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ckk-11.819e-11447.63Calcium/calmodulin-dependent protein kinase kinase... [more]
ckk-15.198e-11446.32Calcium/calmodulin-dependent protein kinase kinase... [more]
par-43.900e-3332.60Serine/threonine-protein kinase par-4 [Source:Uni... [more]
aak-26.530e-3331.605'-AMP-activated protein kinase catalytic subunit ... [more]
aak-26.530e-3331.605'-AMP-activated protein kinase catalytic subunit ... [more]
back to top
BLAST of Si:ch73-62l21.1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG176981.013e-10744.85gene:FBgn0040056 transcript:FBtr0333912[more]
CG176987.060e-10342.72gene:FBgn0040056 transcript:FBtr0333914[more]
CG176988.089e-9147.90gene:FBgn0040056 transcript:FBtr0111166[more]
CG176987.743e-5843.97gene:FBgn0040056 transcript:FBtr0333913[more]
AMPKalpha1.517e-3431.48gene:FBgn0023169 transcript:FBtr0070216[more]
back to top
BLAST of Si:ch73-62l21.1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camkk1a2.023e-11248.06calcium/calmodulin-dependent protein kinase kinase... [more]
camkk1a3.351e-11248.06calcium/calmodulin-dependent protein kinase kinase... [more]
camkk1b1.513e-10747.53calcium/calmodulin-dependent protein kinase kinase... [more]
camkk1b2.145e-10749.15calcium/calmodulin-dependent protein kinase kinase... [more]
camkk1b2.145e-10749.15calcium/calmodulin-dependent protein kinase kinase... [more]
back to top
BLAST of Si:ch73-62l21.1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam13b2.618e-12048.56family with sequence similarity 13 member B [Sourc... [more]
fam13b9.885e-12050.13family with sequence similarity 13 member B [Sourc... [more]
ENSXETT00000001514.12.527e-11444.56calcium/calmodulin-dependent protein kinase kinase... [more]
ENSXETT00000001488.13.386e-11447.76calcium/calmodulin-dependent protein kinase kinase... [more]
fam13b1.278e-11145.43family with sequence similarity 13 member B [Sourc... [more]
back to top
BLAST of Si:ch73-62l21.1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Camkk11.249e-11347.10calcium/calmodulin-dependent protein kinase kinase... [more]
Camkk21.592e-10248.00calcium/calmodulin-dependent protein kinase kinase... [more]
Camkk23.545e-10246.24calcium/calmodulin-dependent protein kinase kinase... [more]
Camkk13.694e-9552.41calcium/calmodulin-dependent protein kinase kinase... [more]
Camkk21.900e-9348.99calcium/calmodulin-dependent protein kinase kinase... [more]
back to top
BLAST of Si:ch73-62l21.1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N5S9|KKCC1_HUMAN4.160e-11346.85Calcium/calmodulin-dependent protein kinase kinase... [more]
sp|Q3Y416|KKCC_CAEEL6.612e-11346.32Calcium/calmodulin-dependent protein kinase kinase... [more]
sp|Q8VBY2|KKCC1_MOUSE8.734e-11347.10Calcium/calmodulin-dependent protein kinase kinase... [more]
sp|P97756|KKCC1_RAT5.488e-11247.10Calcium/calmodulin-dependent protein kinase kinase... [more]
sp|O88831|KKCC2_RAT2.570e-10247.04Calcium/calmodulin-dependent protein kinase kinase... [more]
back to top
BLAST of Si:ch73-62l21.1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W5MJ654.645e-12247.88Si:ch73-62l21.1 OS=Lepisosteus oculatus OX=7918 PE... [more]
W5MJ511.414e-12048.11Si:ch73-62l21.1 OS=Lepisosteus oculatus OX=7918 PE... [more]
V4ASU65.454e-12049.63Protein kinase domain-containing protein (Fragment... [more]
A0A3P9M6E91.225e-11949.14Si:ch73-62l21.1 OS=Oryzias latipes OX=8090 PE=4 SV... [more]
A0A3Q3LE922.069e-11949.14Si:ch73-62l21.1 OS=Mastacembelus armatus OX=205130... [more]
back to top
BLAST of Si:ch73-62l21.1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-62l21.14.633e-12247.21calcium/calmodulin-dependent protein kinase kinase... [more]
si:ch73-62l21.11.616e-12147.51calcium/calmodulin-dependent protein kinase kinase... [more]
si:ch73-62l21.11.616e-12147.51calcium/calmodulin-dependent protein kinase kinase... [more]
si:ch73-62l21.13.822e-12147.49calcium/calmodulin-dependent protein kinase kinase... [more]
si:ch73-62l21.18.504e-11446.05calcium/calmodulin-dependent protein kinase kinase... [more]
back to top
BLAST of Si:ch73-62l21.1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006410.11.515e-3029.34pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 ... [more]
MARK32.892e-3029.65microtubule affinity regulating kinase 3 [Source:H... [more]
ENSPMAT00000008748.19.826e-3033.04pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
MARK31.026e-2934.40microtubule affinity regulating kinase 3 [Source:H... [more]
stk113.833e-2841.45serine/threonine kinase 11 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Si:ch73-62l21.1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TOS31.548e-4134.23Protein kinase; related to and functionally redund... [more]
SAK12.840e-3833.80Upstream serine/threonine kinase for the SNF1 comp... [more]
SNF11.500e-3431.08AMP-activated S/T protein kinase; forms a complex ... [more]
KIN41.813e-3233.33Serine/threonine protein kinase; inhibits the mito... [more]
FRK16.568e-3234.98Protein kinase of unknown cellular role; green flu... [more]
back to top
BLAST of Si:ch73-62l21.1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO355221.498e-9342.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454393.324e-3937.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361693.759e-3335.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460352.197e-3128.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307682.629e-2929.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:ch73-62l21.1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-62l21.14.174e-12148.89calcium/calmodulin-dependent protein kinase kinase... [more]
camkk1a2.166e-11347.04calcium/calmodulin dependent protein kinase kinase... [more]
camkk1a2.994e-11347.04calcium/calmodulin dependent protein kinase kinase... [more]
si:ch73-62l21.14.970e-10946.67calcium/calmodulin-dependent protein kinase kinase... [more]
camkk1b5.204e-10047.25calcium/calmodulin-dependent protein kinase kinase... [more]
back to top
BLAST of Si:ch73-62l21.1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067484.10.000e+099.09SMESG000067484.1[more]
SMESG000067484.10.000e+095.30SMESG000067484.1[more]
SMESG000070678.13.453e-9542.78SMESG000070678.1[more]
SMESG000055720.11.675e-3331.72SMESG000055720.1[more]
SMESG000042362.12.059e-3130.08SMESG000042362.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028997 ID=SMED30028997|Name=Si:ch73-62l21.1|organism=Schmidtea mediterranea sexual|type=transcript|length=1762bp
ATAATTTTAGTAATAAATCTTAAAATAATTGCTAAATTTTAACTTGAAAT
GTATCAAATTTTAAAATGGGAATAGGATGTTATTCAATTGACAGGGAAAA
ATCCGGATTCCGCAAACAAATAGTTGATGGAATTGAAACGAGTTACCAAA
GTTATACCATTTCCAAAGTTTTAGATATTCCATCTGTGAAAACCTTTCCA
ATTAACCAGGACTTCGAAACAGATAAAATTATTGAAAATTACAATTCAAC
GAATTCTTTATCCAGCGCATTTCCAAATCATTCGGATTCTTGTGGCAAAT
TAGCACAGTTAAATTGGCAGAATTCAGAAGAAAACAAATTTGGGCTTCCA
TCAATATTACCAAATTTTCCATATTCTCCTTTCAATTCTCCCCATGTTTC
TCCAGAACATAGACTTCATCCACATGGCTTACAGTCCATTTATTCCAATA
GTTATGGTTCACTGCAAAGAGACGTAAGCTCTATTTCTGTCACCGAGGAC
TCAAATAGAATTGTTCATTTAAATCAGTATCAAATTCGGCAACAAATAGG
GCAGGGGTCTTATGGTCTTGTCCAGTTAGCTTATAATTCTAAAGACTCAA
ATTATTACGCAATGAAAAGTCTGTCAAAGAAAAAACTGATGAAATCGTCT
GGATTATTTAATCGGCCTCCTCCAATCAGGAAGTCTACCTCATCTATGTC
ATCAATGGGAACCAAATCTCCGCAACGTGCCTCTGATCCATTGCAAAAGA
TTTATAAAGAAATAGCTTTCCATAAGAAACTTAATCATGCCAATATTGTA
AAATTAATAGAAGTTTTAGATGATCCATCTCAAGAATTTCTTTACATGGT
ATTCGAGTACGTAGAAAATGGGCCTGTTATGGAAATTGGCAAAGATTCTC
CGTTTCCAGAGATCAAAGCTAGAAAATATATTATTGATACTTTGCTCGGA
TTGGAATATCTTCATTATCAAAAGATAATTCACCGCGACATTAAACCGGC
CAACTTGCTACTCAGCAAACTTGATGTTATAAAAATATCAGATTTTGGAG
TAAGTAATGAATTTACCGGAGATGATGTTTATCTTTCGTCAACTGTTGGG
TCCCCTGCATTCATGGCCCCAGAAAGTGTTCGCGATGGTGATCATTGTTT
TACGGGCAAGGCTTTAGACATTTGGGCACTTGGTATTACTCTTTATGCGT
TCTTGTTTGGAAAAGTCCCTCTTGAAAACTGCAACAGATTTCTACTATAC
CAGATGATAATTAACAACCCGATTTTATATCCAGAAAATCCTTCAGTGTC
TGTAGGCGTAATGGATCTTCTACATAAAATGTTAGACAAGAATCCGTTGG
AAAGAATCAAAATACCGAATATTAAAGTACACCAATGGATAACTAATGAT
GGTAAAAACCAGCTACCGACTGAAGCAGAAAACTGCGGATTTGCTTCTAT
TGATGTTAACGAAGACGAAGTTGCCAATTCCATTAGATTTGTTCCACGAT
TAGAAACCGTTATTAAAATCAAAATGCTTTTGAAACAAAAGTCATTTGCT
AATCCTCTCAGGTTCGGAAGTGTTTCAAGAATAAACGAAACGAAAAATGG
AACAGATTTGCTCAAAGATCCAAGTTTATTTCTTCAACGATCATCTTTTG
ATGCACTGAGTCTAGTGCCTGATGACAGGCAATTCGCAAAAAGTTTTAAA
ATTGATGAAGTCAATTAAATCTGTTTTTTTAAATTTTATTATTACTTTTA
TACATATGCTCG
back to top

protein sequence of SMED30028997-orf-1

>SMED30028997-orf-1 ID=SMED30028997-orf-1|Name=SMED30028997-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=551bp
MGIGCYSIDREKSGFRKQIVDGIETSYQSYTISKVLDIPSVKTFPINQDF
ETDKIIENYNSTNSLSSAFPNHSDSCGKLAQLNWQNSEENKFGLPSILPN
FPYSPFNSPHVSPEHRLHPHGLQSIYSNSYGSLQRDVSSISVTEDSNRIV
HLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAMKSLSKKKLMKSSGLFNR
PPPIRKSTSSMSSMGTKSPQRASDPLQKIYKEIAFHKKLNHANIVKLIEV
LDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLH
YQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFM
APESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIIN
NPILYPENPSVSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQL
PTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLRF
GSVSRINETKNGTDLLKDPSLFLQRSSFDALSLVPDDRQFAKSFKIDEVN
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004683calmodulin-dependent protein kinase activity
GO:0005515protein binding
GO:0005516calmodulin binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0018107peptidyl-threonine phosphorylation
GO:0035556intracellular signal transduction
GO:0045860positive regulation of protein kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 155..442
e-value: 2.2E-84
score: 296.3
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 223..442
e-value: 1.1E-52
score: 179.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 155..442
score: 44.075
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 266..444
e-value: 4.5E-54
score: 184.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 202..222
NoneNo IPR availablePANTHERPTHR43895FAMILY NOT NAMEDcoord: 139..502
NoneNo IPR availablePANTHERPTHR43895:SF26CALCIUM/CALMODULIN DEPENDENT PROTEIN KINASE KINASE 1coord: 139..502
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 304..316
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 161..184
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 146..451