Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30028994
Length (bp)1688
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30028994) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30028994) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30028994) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30028994) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028994

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028994SMESG000033598.1 SmedASXL_015992SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30028994SMESG000033598.1 dd_Smed_v4_13819_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30028994SMESG000033598.1 dd_Smed_v6_13819_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30028994SMESG000033598.1 dd_Smed_v4_13819_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1S3HM57 (uncharacterized protein LOC106156455 OS=Lingula unguis OX=7574 GN=LOC106156455 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.599e-14
Identity = 79/309 (25.57%), Postives = 147/309 (47.57%), Query Frame = 3
Query:  681 NTFHALQLISFEIIDEALEDEIVPDVLIDVFKE----IQFKEKLFYTELVPIVRSTTEQI-------MVEVIDQYIQETVLVSVLRDSKNQLQSQMILKWLLDDILPPHVVEVTKEAICDV---ANEKMIISR-CNYFFEKLIAEVIQDEIKTSENIFFREVILEASLEEFVIDPLIVETLEIFG----FNMIDYYHEKVSRINLQQVNEMAAEKPLFSLIMDHFISVGARQKSIYGTSFGGQYCFEYIVFDILLKKTFEIYDRLINTIDNQSLCRWHQNVNKSIATDILINELLEHSDADLCDLDANE 1550
            N+F   Q+   + I EALEDEIVPD+LI+V  E    +  K +L     V +   T  Q+       ++++ D Y+ E                +M  K L +DI    + EV  E I  V   A ++M+           ++A++++D I    +    EVI E   E+ V+D  I E ++         ++ +Y  ++ +  L++V + A++K + S+ +++ +S+ ARQ  ++          + ++ ++LL++ F +      T+DN  L R H+ +   +A D+L+ +L +  D D+ DLD  E
Sbjct:  325 NSF--AQVFVEDFIQEALEDEIVPDLLIEVVSEQKQTVSVKSRLLPGGAVDLYSMTAAQLRDLDRDTLMKLTDSYLME----------------RMSQKDLGEDIASALLSEVVHEGILQVVKLATQEMVSGYLAKSAGSDVMADLVEDYIAEIGHELVEEVITEVQFED-VLDEFIEEDVDELANEVAVEVLTHYDTRIQKRELREVAKYASQKFIDSMCLEYLLSLVARQGQLWTEDDHADKLLDSLMLNVLLEQFFGVSGERQRTLDNLPLRRLHEKIVTDVALDVLLTQLSQALDEDMADLDEYE 614          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2T7P268 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12678 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.594e-10
Identity = 69/302 (22.85%), Postives = 136/302 (45.03%), Query Frame = 3
Query:  681 NTFHALQLISFEIIDEALEDEIVPDVLIDVFKEIQFKEKLFYTELVPIVRSTTEQIMVEVIDQYIQETVLVSVLRDSKNQLQSQMI--------LKWLLDDILPPHVVEVTKEAICDVANEKMIISRCNYFFEKLIAEVIQDEIKTSENIFFREVILEASLEEF----VIDPLIVETLEIFGFNMIDYYHEKVSRINLQQVNEMAAEKPLFSLIMDHFISVGARQKSIYGTSFGGQYCFEYIVFDILLKKTFEIYDRLINTIDNQSLCRWHQNVNKSIATDILINELLEHSDADLCDLDANE 1550
            N    + + + ++I E LE+EI+PD L++   E + +    Y   +P + +  E +M + I + + + V  S    +++ L+ + +        L  LL D +   V E+ +EA+ ++A   M+ ++    +      V QD +K        EV  E   EEF    VI P + E         + +Y  KV+R    +V   A ++   S+++ + +SV ARQ  ++  +       + ++ +I +++ F +      T  N+ L + H+     ++ D  + +L    D DL D+D  E
Sbjct:  237 NNPRLMDVFANDLIKELLEEEIIPDTLVEALDEFE-RLPYDYPAYLPTLYA-CEDVMTDGIKELLHDIVKESASELAEDYLEEKRLQHDPLDEFLTSLLSDAVDLSVRELVREAVVEMAESHMLDTQATQIY----LGVFQDHLKEIMPDVLNEVQFELIAEEFIQEEVIAPEVEEESTSIAKETLKHYDNKVARREFSEVFRKAGQQLADSMLVGYLMSVIARQGKLHTQNDHNNKYLDNLIMNIAMEQYFNVQKMRDKTTQNRPLRKLHEKAFIDVSLDACLKQLTASLDEDLADVDEYE 532          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2C9KWF4 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055060 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.657e-10
Identity = 69/299 (23.08%), Postives = 136/299 (45.48%), Query Frame = 3
Query:  720 IDEALEDEIVPDVLIDVFKEIQ---FKEKLFYTELVPIVRSTTEQIMVEVIDQYIQETVLVSVLRDSKNQLQSQMI--------LKWLLDDILPPHVVEVTKEAICDVANEKMIISRCNYFFEKLIAEVIQD-EIKTSENIFFREVILEASLEEFVIDPLIVETLEIFGFNMIDYYHEKVSRINLQQVNEMAAEKPLFSLIMDHFISVGARQKSIYGTSFGGQYCFEYIVFDILLKKTFEIYDRLINTIDNQSLCRWHQNVNKSIATDILINELLEHSDADLCDLDANE---IDESYIP 1571
            I + L  EI+PD+LID   EI+   +   L+   L      T E ++ + + +   E    +V   + + L  +++        L  L++D++     EV +  I D+A + +     +     L+++ ++D      E + F ++I E  +   VI P + E   +     I YY +KV R   ++VN +A +K   ++I+D+ +++  +   ++  +       + ++F+  L + F I      T+ ++ L + H+ V   +A D+ +  L    D DL D+D  E    DES  P
Sbjct:  219 IQDCLNTEILPDLLIDTLNEIKHMPYHHPLYVPSLY-----TCEDLLADQVSEMATEIAREAVSELANDYLDEKLLQRDPLEDFLSDLVEDVVRQGTREVVRSTIMDMAEDHLQTEYASTIITSLVSDYLRDIAPDLLEEVTF-DIIAEDFINSQVIAPEVTEEAIVVARETIQYYDDKVLRKQFKEVNLLANDKLADAVILDYLVTLMFQHGKLWAETDHQNKFLDDMIFNTGLAQIFSIQKNREKTVKSKPLQKLHEKVVSDVALDVFLQHLTRTLDEDLADVDEYERGVTDESSHP 511          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A3S1AVF1 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_018989 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.063e-7
Identity = 62/289 (21.45%), Postives = 135/289 (46.71%), Query Frame = 3
Query:  720 IDEALEDEIVPDVLID---VFKEIQFKEKLFYTELVPIVRSTTEQIMVEVIDQYIQETVLVSVLRDSKNQLQSQMILKWLLDDILPPHVVEVTKEAICDVANEKMIISRCNYFFEKLIAEVIQD-------EIKTS--ENIFFREVILEASLEEFVIDPLIVETLEIFGFNMIDYYHEKVSRINLQQVNEMAAEKPLFSLIMDHFISVGARQKSIYGTSFGGQYCFEYIVFDILLKKTFEIYDRLINTIDNQSLCRWHQNVNKSIATDILINELLEHSDADLCDLDANE 1550
            I + ++ +I+PD LID   V K + +   L+   L      + E ++ + + + + + V  ++   + + +  + + K  L+D L   + +  +  + +   + ++    +Y  E+    +I D       EI     E+  F +++ E  +E  VI   I E L+I    ++D+Y  KV +   ++V++ A  K   S +M + +SV ++Q  I+          + ++F+  + + F +  +   T+D++ L + H+ V   +A D+ + +L    D DL D+D  E
Sbjct:  159 IQDCIDTDILPDFLIDMLKVMKHMPYDHPLYLPSLY-----SCEDLLSDHVSELVVDIVREALAEAANDYMDEKRLEKDPLEDFLNDLIEDAVRLGVRETVRDTVVHMAEDYVEEEYATTIIHDLLDDHMDEIGEELLEDTIF-DIMAEDFIEREVIASEIKEELQIVAKEVLDHYDSKVLKREFREVSQKATVKLADSFLMTYMMSVVSQQGKIWTEDDHYNRHLDDMIFNTSMLQMFSVRKQRDKTLDSKPLQKLHERVVSDVALDVFLQQLTRSLDEDLADVDEWE 441          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: R7VJB9 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_220490 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.235e-6
Identity = 64/330 (19.39%), Postives = 143/330 (43.33%), Query Frame = 3
Query:  714 EIIDEALEDEIVPDVLIDVFKE------IQFKEKLFYTELVPIVRSTTEQIMVEVIDQYIQETVLVSVLRDSKNQLQSQMILKWLLDDILPPHVVEVTKEAICDVANEKMIISRCNYFFEKLIAEVIQDEIKTSENIFFREVILEASLEEFVIDPLIVETLEIFGFNMIDYYHEKVSRINLQQVNEMAAEKPLFSLIMDHFISVGARQKSIYGTS---------------------------FGGQYCFEYIVFDILLKKTFEIYDRLINTIDNQSLCRWHQNVNKSIATDILINELLEHSDADLCDLDANE-----IDESYIPRYLENI 1589
            + I++ L D ++PDV+ID  ++      ++ +E  F TE +P+                 ++ V             ++++ + +L+D++    ++  +EA  ++ +  +  +        +++E+I +  +        E I E  +EE VI P + +  +      +     +V R  ++QV +   ++   SL++D+ +S+ ARQ +++                                 + C+  ++  +L+++ F +  R   T++N+ L R H+ +   +A D+L++EL +  D DL DLD  E     +D S  P  L+ +
Sbjct:  138 DFIEKELRDHVLPDVVIDALRDSGKTPALKSREAAFITETLPV-----------------EDRV-------------ARLLTEDILEDVVFEGSIDCVREATHEMVDNHLSQTTQMAVIHDMVSEIIAEHGQKWTREAIEEFICEEFIEEEVIGPEVYDFSKELALETLHKTSNRVRRQEIKQVEDSGGDRQTDSLVLDYLLSMVARQGNLWTEGEHANRLMDEHNFKLLSNIILEYSVYQCMQCKTCYVDMMLTVLIEQLFNVESRKKATVENEPLKRLHEKIFTDVAADVLLDELAQSLDEDLRDLDEFERGLAHVDASKAPVQLQKL 437          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO39350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC7])

HSP 1 Score: 50.0618 bits (118), Expect = 1.898e-6
Identity = 70/288 (24.31%), Postives = 132/288 (45.83%), Query Frame = 3
Query:  714 EIIDEALEDEIVPDVLIDVF--KEIQFKEKLFYTELVPIVRSTTEQIMVEVIDQ------YIQETVLVSVLRDSKNQLQSQMILKWLLDDILPPHVVEVTKEAICDVANEKMIISRCNYFFEKLIAEVIQDEIKTSENIFFREVILEASLEEFVIDPLIVETLEIFGFNMI-DYYHEKVS---RINLQQVNEMAAEKPLFSLIMDHFISVGARQK-SIYGTSFGGQYCFEYIVFDILLKKTFEIYDRLINTIDNQSLCRWHQNVNKSIATDILINELLEHSDADLCDL 1538
            ++I+E L ++I+PD+LIDV   K+       +Y     +      + +  +I+Q      Y    +      D   ++   +I + +++  LP     + K AI D+    M   + + + E+LI E I   +          V L+ +  E  +  LI E L+     +I D + E      +  L QV E+A  + L  L ++H +S+ A    S+Y   +  +   + +V   L+ +  ++YD +  T+ NQ+L  +  N++  +A D+++NEL  H D D+ DL
Sbjct:  227 DLIEEFLIEDIIPDLLIDVLSHKKTLNPSHPWYRLASHVCTDLINEDLNLIINQLAAGVFYTHVPIQYLPSHDPLREISCDLIEEVVMETSLP-----IVKSAIGDLVTGHMTEKKRDDWLEELILETIHPMVYQ-----VACVSLDVNKYEITVSDLIDEVLDDLMRPVIKDAWREVCGAQRQTQLHQVRELAEGRLLDDLCLEHLLSLLAGNNLSLYLRDYTEE-TMDGLVCGQLIHQYLQVYDEMQKTLSNQALREFQLNLHTDLALDVILNELKAHLDEDMEDL 503          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000033598.1 (SMESG000033598.1)

HSP 1 Score: 863.603 bits (2230), Expect = 0.000e+0
Identity = 472/475 (99.37%), Postives = 474/475 (99.79%), Query Frame = 3
Query:  192 MSRSEKHWALKSSNLKRIKENGQKSVLXXXXXXXXXXXGSERPVVSSHYHHTDIRKSSYPIXXXXXXXXXXXXXXXXXITDKWEIESNNTSDYGSDTSVQRSPHLYELPNVIDNTFYHKHSXXXXXXXXXXXXXXERQSIPKQYVHKQHQRITRTSSKNRLNLNTFHALQLISFEIIDEALEDEIVPDVLIDVFKEIQFKEKLFYTELVPIVRSTTEQIMVEVIDQYIQETVLVSVLRDSKNQLQSQMILKWLLDDILPPHVVEVTKEAICDVANEKMIISRCNYFFEKLIAEVIQDEIKTSENIFFREVILEASLEEFVIDPLIVETLEIFGFNMIDYYHEKVSRINLQQVNEMAAEKPLFSLIMDHFISVGARQKSIYGTSFGGQYCFEYIVFDILLKKTFEIYDRLINTIDNQSLCRWHQNVNKSIATDILINELLEHSDADLCDLDANEIDESYIPRYLENISEMIYSKTK 1616
            MSRSEKHWALKSSNLKRIKENGQKSVLSRNISRNSSINGSERPVVSSH+HHTDIRKSSYPILPNPPFFNKLENKNNLFITDKWEIESNNTSDYGSDTSVQRSPHLYELPNVIDNTFYHKHSNKNNQNIPFNQQNNERQSIPKQYVHKQHQRITRTSSKNRLNLNTFHALQLISFEIIDEALEDEIVPDVLIDVFKEIQFKEKLFYTELVPIVRSTTEQIMVEVIDQYIQETVLVSVLRDSKNQLQSQMILKWLLDDILPPHVVEVTKEAICDVANEKMIISRCNYFFEKLIAEVIQDEIKTSENIFFREVILEASLEEFVIDPLIVETLEI GFNMIDYYHEKVSRINLQQVNEMAAEKPLFSLIMDHFISVGARQKSIYGTSFGGQYCFEYIVFDILLKKTFEIYDRLINTIDNQSLCRWHQN+NKSIATDILINELLEHSDADLCDLDANEIDESYIPRYLENISEMIYSKTK
Sbjct:    1 MSRSEKHWALKSSNLKRIKENGQKSVLSRNISRNSSINGSERPVVSSHHHHTDIRKSSYPILPNPPFFNKLENKNNLFITDKWEIESNNTSDYGSDTSVQRSPHLYELPNVIDNTFYHKHSNKNNQNIPFNQQNNERQSIPKQYVHKQHQRITRTSSKNRLNLNTFHALQLISFEIIDEALEDEIVPDVLIDVFKEIQFKEKLFYTELVPIVRSTTEQIMVEVIDQYIQETVLVSVLRDSKNQLQSQMILKWLLDDILPPHVVEVTKEAICDVANEKMIISRCNYFFEKLIAEVIQDEIKTSENIFFREVILEASLEEFVIDPLIVETLEIVGFNMIDYYHEKVSRINLQQVNEMAAEKPLFSLIMDHFISVGARQKSIYGTSFGGQYCFEYIVFDILLKKTFEIYDRLINTIDNQSLCRWHQNINKSIATDILINELLEHSDADLCDLDANEIDESYIPRYLENISEMIYSKTK 475          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HM571.599e-1425.57uncharacterized protein LOC106156455 OS=Lingula un... [more]
A0A2T7P2681.594e-1022.85Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2C9KWF42.657e-1023.08Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A3S1AVF13.063e-721.45Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
R7VJB91.235e-619.39Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO393501.898e-624.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000033598.10.000e+099.37SMESG000033598.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028994 ID=SMED30028994|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1688bp
TTTGGCATTATATTAAATATTTTTTTTAAAAAATCAAAATATTAAAATGA
TTATTCTTTGATTTCTCAAATAATTTCAACTATAAATTGAAATTTTAAAT
AAACTAGAAATGAAAATATCTGCAGCTCAATTGTTTAAACAAGTTGTATA
GTAATTAAGATACATTATTTCTATGGCAAATATATAAATCTATGTCAAGA
AGTGAAAAACATTGGGCGTTAAAAAGTTCAAATTTAAAAAGAATTAAAGA
AAATGGTCAAAAATCTGTACTTTCAAGAAATATATCGAGAAATTCGTCGA
TAAATGGATCAGAAAGACCTGTTGTATCATCTCATTATCATCATACTGAT
ATTAGAAAATCCAGTTACCCAATTTTACCAAATCCGCCTTTCTTCAACAA
ATTGGAAAATAAAAACAATTTGTTCATTACTGATAAATGGGAAATCGAAT
CTAATAATACCTCAGATTATGGTTCGGATACATCAGTCCAAAGGTCTCCA
CATTTGTATGAGCTTCCTAATGTGATAGATAATACATTCTATCACAAGCA
TTCAAACAAAAACAACCAAAATATACCATTTAATCAACAAAACAATGAAC
GACAAAGTATTCCTAAACAATACGTTCACAAGCAGCATCAACGGATTACT
CGAACATCCTCAAAGAACAGGCTTAACCTGAATACATTTCATGCATTGCA
ACTCATATCATTCGAAATAATCGACGAAGCTTTGGAAGACGAAATTGTTC
CAGATGTTTTAATAGATGTCTTTAAGGAGATTCAGTTCAAAGAAAAATTA
TTTTATACAGAATTAGTTCCTATTGTTCGATCCACCACTGAGCAGATCAT
GGTAGAAGTCATAGATCAGTATATCCAGGAAACGGTTTTAGTGAGTGTGC
TTAGAGACTCAAAAAACCAACTACAGTCCCAAATGATACTAAAATGGCTT
TTGGATGATATTTTACCGCCTCATGTAGTCGAGGTCACAAAAGAGGCTAT
TTGCGATGTGGCAAATGAAAAAATGATTATTAGCAGGTGCAACTATTTTT
TCGAAAAGTTGATTGCTGAAGTCATTCAAGACGAAATTAAAACTTCGGAG
AATATTTTCTTTAGAGAAGTGATTCTAGAGGCATCACTGGAAGAGTTTGT
CATAGATCCTTTGATTGTTGAAACTCTTGAAATCTTTGGTTTCAACATGA
TAGATTATTATCATGAAAAGGTCAGCCGTATAAATTTACAACAAGTAAAC
GAAATGGCGGCAGAGAAACCTTTATTTAGTCTAATAATGGACCATTTTAT
AAGTGTCGGTGCTCGTCAGAAGTCAATTTATGGCACAAGTTTTGGAGGGC
AATATTGCTTTGAATATATAGTCTTTGATATTCTTTTGAAGAAAACATTT
GAAATCTATGATCGATTAATTAATACAATTGATAATCAATCATTATGTCG
GTGGCACCAAAATGTCAATAAATCAATCGCAACAGATATTCTCATCAATG
AATTGTTGGAGCATTCTGATGCTGATCTATGTGATCTCGATGCCAATGAA
ATCGACGAGTCATATATACCCAGATATTTGGAAAATATCAGTGAAATGAT
TTATTCGAAGACCAAGTAACTGACTTTCACATGCTTACGTAATATGAAAG
TGTTCCGCAAACTTTTTTCTGTTCAAGGTATAAGATCG
back to top

protein sequence of SMED30028994-orf-1

>SMED30028994-orf-1 ID=SMED30028994-orf-1|Name=SMED30028994-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=476bp
MSRSEKHWALKSSNLKRIKENGQKSVLSRNISRNSSINGSERPVVSSHYH
HTDIRKSSYPILPNPPFFNKLENKNNLFITDKWEIESNNTSDYGSDTSVQ
RSPHLYELPNVIDNTFYHKHSNKNNQNIPFNQQNNERQSIPKQYVHKQHQ
RITRTSSKNRLNLNTFHALQLISFEIIDEALEDEIVPDVLIDVFKEIQFK
EKLFYTELVPIVRSTTEQIMVEVIDQYIQETVLVSVLRDSKNQLQSQMIL
KWLLDDILPPHVVEVTKEAICDVANEKMIISRCNYFFEKLIAEVIQDEIK
TSENIFFREVILEASLEEFVIDPLIVETLEIFGFNMIDYYHEKVSRINLQ
QVNEMAAEKPLFSLIMDHFISVGARQKSIYGTSFGGQYCFEYIVFDILLK
KTFEIYDRLINTIDNQSLCRWHQNVNKSIATDILINELLEHSDADLCDLD
ANEIDESYIPRYLENISEMIYSKTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head