Inosine-5'-monophosphate dehydrogenase

Overview
NameInosine-5'-monophosphate dehydrogenase
Smed IDSMED30028961
Length (bp)1946
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Inosine-5'-monophosphate dehydrogenase (SMED30028961) t-SNE clustered cells

Violin plots show distribution of expression levels for Inosine-5'-monophosphate dehydrogenase (SMED30028961) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Inosine-5'-monophosphate dehydrogenase (SMED30028961) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Inosine-5'-monophosphate dehydrogenase (SMED30028961) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028961

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30028961SMESG000078264.1 dd_Smed_v4_4321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028961SMESG000078264.1 dd_Smed_v4_4321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
eyeSMED30028961SMESG000078264.1 Contig37052uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30028961SMESG000078264.1 Contig37052uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30028961SMESG000078264.1 Contig37052newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30028961SMESG000078264.1 Contig37052newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30028961SMESG000078264.1 dd_Smed_v6_4321_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Human
Match: IMPDH2 (inosine monophosphate dehydrogenase 2 [Source:HGNC Symbol;Acc:HGNC:6053])

HSP 1 Score: 384.03 bits (985), Expect = 4.932e-126
Identity = 192/273 (70.33%), Postives = 232/273 (84.98%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT+  D  R  ++  +G D++V+DSSQGNSI+QI+M K +K  YPNLQ+IGGNVVT  QAK+LIDAGVD LRVGMGSGSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQNVGHI KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  + SS  RYFSE DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +++  +Y+GEL+FEKRT+SAQVEGGVH+LHSYEKRLF
Sbjct:  242 KQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF 514          

HSP 2 Score: 332.028 bits (850), Expect = 5.003e-106
Identity = 165/265 (62.26%), Postives = 212/265 (80.00%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LFN   GLTYNDF++LPGYIDF +++VD+T+ +TK + LKTPLVSSPMDTVTE+ MAIAMAL+GGIG +HHNCT + QANE+R+VKKYEQGFI DPVV+S  + V +V   K ++GF GIPITD G++G +LVG+++ RDIDFL +   D  + E+MT  E+L+ AP G+ L EAN ILQRSKKGKLPI+NE+ ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAA+GTH+DD  R  +L  AGVDVVV+ ++ G S
Sbjct:   16 DGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Human
Match: IMPDH1 (inosine monophosphate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:6052])

HSP 1 Score: 380.178 bits (975), Expect = 5.806e-125
Identity = 191/273 (69.96%), Postives = 227/273 (83.15%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAAVGT   D  R  ++  +G D+IV+DSSQGNS+YQI M   +K  YP+LQ+IGGNVVT  QAK+LIDAGVDGLRVGMG GSICITQEVMA GRPQ TAV+KV+EYARR+ +PIIADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  + SS  RYFSE DKVK+AQGVSG++ DKGS+ K +PYL+AGIQHG QD+G ++L  L+  +Y+GEL+FEKRT SAQ+EGGVH LHSYEKRL+
Sbjct:  217 KQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY 489          

HSP 2 Score: 274.633 bits (701), Expect = 3.070e-84
Identity = 148/265 (55.85%), Postives = 192/265 (72.45%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTYNDF++LPG+IDF ++EVD+T+ +T+ + LKTPL+SSPMDTVTE++MAIAMA                         K+EQGFI DPVV+S  +TVG+V+  K+++GF+GIPIT+ G +G KLVG+VT RDIDFL + +    +SEVMTP   L+ AP GV L EAN ILQRSKKGKLPI+N+  ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAAVGT +DD  R  +L  AGVDV+V+ ++ G S
Sbjct:   16 DGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMA-------------------------KFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNS 255          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Human
Match: IMPDH1 (inosine monophosphate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:6052])

HSP 1 Score: 380.178 bits (975), Expect = 1.512e-124
Identity = 191/273 (69.96%), Postives = 227/273 (83.15%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAAVGT   D  R  ++  +G D+IV+DSSQGNS+YQI M   +K  YP+LQ+IGGNVVT  QAK+LIDAGVDGLRVGMG GSICITQEVMA GRPQ TAV+KV+EYARR+ +PIIADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  + SS  RYFSE DKVK+AQGVSG++ DKGS+ K +PYL+AGIQHG QD+G ++L  L+  +Y+GEL+FEKRT SAQ+EGGVH LHSYEKRL+
Sbjct:  241 KQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY 513          

HSP 2 Score: 321.242 bits (822), Expect = 7.066e-102
Identity = 164/265 (61.89%), Postives = 212/265 (80.00%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTYNDF++LPG+IDF ++EVD+T+ +T+ + LKTPL+SSPMDTVTE++MAIAMAL GGIG +HHNCT + QANE+R+VK +EQGFI DPVV+S  +TVG+V+  K+++GF+GIPIT+ G +G KLVG+VT RDIDFL + +    +SEVMTP   L+ AP GV L EAN ILQRSKKGKLPI+N+  ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAAVGT +DD  R  +L  AGVDV+V+ ++ G S
Sbjct:   16 DGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVK-FEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNS 279          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Human
Match: IMPDH1 (inosine monophosphate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:6052])

HSP 1 Score: 380.178 bits (975), Expect = 1.512e-124
Identity = 191/273 (69.96%), Postives = 227/273 (83.15%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAAVGT   D  R  ++  +G D+IV+DSSQGNS+YQI M   +K  YP+LQ+IGGNVVT  QAK+LIDAGVDGLRVGMG GSICITQEVMA GRPQ TAV+KV+EYARR+ +PIIADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  + SS  RYFSE DKVK+AQGVSG++ DKGS+ K +PYL+AGIQHG QD+G ++L  L+  +Y+GEL+FEKRT SAQ+EGGVH LHSYEKRL+
Sbjct:  241 KQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY 513          

HSP 2 Score: 321.242 bits (822), Expect = 7.066e-102
Identity = 164/265 (61.89%), Postives = 212/265 (80.00%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTYNDF++LPG+IDF ++EVD+T+ +T+ + LKTPL+SSPMDTVTE++MAIAMAL GGIG +HHNCT + QANE+R+VK +EQGFI DPVV+S  +TVG+V+  K+++GF+GIPIT+ G +G KLVG+VT RDIDFL + +    +SEVMTP   L+ AP GV L EAN ILQRSKKGKLPI+N+  ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAAVGT +DD  R  +L  AGVDV+V+ ++ G S
Sbjct:   16 DGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVK-FEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNS 279          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Human
Match: IMPDH1 (inosine monophosphate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:6052])

HSP 1 Score: 379.793 bits (974), Expect = 1.673e-124
Identity = 191/273 (69.96%), Postives = 227/273 (83.15%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAAVGT   D  R  ++  +G D+IV+DSSQGNS+YQI M   +K  YP+LQ+IGGNVVT  QAK+LIDAGVDGLRVGMG GSICITQEVMA GRPQ TAV+KV+EYARR+ +PIIADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  + SS  RYFSE DKVK+AQGVSG++ DKGS+ K +PYL+AGIQHG QD+G ++L  L+  +Y+GEL+FEKRT SAQ+EGGVH LHSYEKRL+
Sbjct:  237 KQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY 509          

HSP 2 Score: 313.538 bits (802), Expect = 5.585e-99
Identity = 162/265 (61.13%), Postives = 208/265 (78.49%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTYNDF++LPG+IDF ++EVD+T+ +T+ + LKTPL+SSPMDTVTE++MAIAMAL GGIG +HHNCT + QANE     K+EQGFI DPVV+S  +TVG+V+  K+++GF+GIPIT+ G +G KLVG+VT RDIDFL + +    +SEVMTP   L+ AP GV L EAN ILQRSKKGKLPI+N+  ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAAVGT +DD  R  +L  AGVDV+V+ ++ G S
Sbjct:   16 DGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANE-----KFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNS 275          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Celegans
Match: T22D1.3 (Inosine-5'-monophosphate dehydrogenase [Source:UniProtKB/Swiss-Prot;Acc:Q9GZH3])

HSP 1 Score: 312.383 bits (799), Expect = 3.693e-101
Identity = 163/274 (59.49%), Postives = 218/274 (79.56%), Query Frame = 2
Query:  857 QLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSD-GVRLKKYRGMGSLEAMTANQSSAVRYFS-ENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            QL+ GAAV T          ++ +G D+++IDSS G+S YQI M + +K  +P++Q+I GNVVT+ QAK LID G DGLR+GMGSGSICITQ+VMAVGR Q TAV+ V+ YA +  IPI+ADGGI++VG+I KA+ LGASA MMGG+LA T+EAPGEYF+   GVR+KKYRGMGSL+AM A+ SS  RYF+ E+D++KVAQGVS  M D+GS  K +PYL+ G+QHG+QD+GV++L + +EK+ NG ++FE+R+T+AQ+EGGVH+LHS+EKRL+
Sbjct:   65 QLLCGAAVNTRGESQYTVDRVVEAGVDVLIIDSSNGSSTYQISMLRYIKEKHPHVQVIAGNVVTRAQAKLLIDQGADGLRIGMGSGSICITQDVMAVGRAQGTAVYDVARYANQRGIPIVADGGIRDVGYITKAISLGASAVMMGGLLAATTEAPGEYFWGPGGVRVKKYRGMGSLDAMEAHASSQDRYFTAESDQIKVAQGVSATMKDRGSCHKFIPYLIRGVQHGMQDIGVRSLRDFREKVDNGIVKFERRSTNAQLEGGVHSLHSFEKRLY 338          

HSP 2 Score: 73.1738 bits (178), Expect = 1.099e-13
Identity = 35/81 (43.21%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  634 LQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWSS 876
            L+  + GKLPI+N+N EL AL+ R+DL K R+YP++S D + QL  GAAV T  +       +++AGVDV+++ +++G S+
Sbjct:   23 LKEHRLGKLPIVNDNGELCALLCRSDLLKARDYPMASYDSKGQLLCGAAVNTRGESQYTVDRVVEAGVDVLIIDSSNGSST 103          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Celegans
Match: T22D1.3 (Inosine-5'-monophosphate dehydrogenase [Source:UniProtKB/Swiss-Prot;Acc:Q9GZH3])

HSP 1 Score: 312.383 bits (799), Expect = 3.693e-101
Identity = 163/274 (59.49%), Postives = 218/274 (79.56%), Query Frame = 2
Query:  857 QLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSD-GVRLKKYRGMGSLEAMTANQSSAVRYFS-ENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            QL+ GAAV T          ++ +G D+++IDSS G+S YQI M + +K  +P++Q+I GNVVT+ QAK LID G DGLR+GMGSGSICITQ+VMAVGR Q TAV+ V+ YA +  IPI+ADGGI++VG+I KA+ LGASA MMGG+LA T+EAPGEYF+   GVR+KKYRGMGSL+AM A+ SS  RYF+ E+D++KVAQGVS  M D+GS  K +PYL+ G+QHG+QD+GV++L + +EK+ NG ++FE+R+T+AQ+EGGVH+LHS+EKRL+
Sbjct:   65 QLLCGAAVNTRGESQYTVDRVVEAGVDVLIIDSSNGSSTYQISMLRYIKEKHPHVQVIAGNVVTRAQAKLLIDQGADGLRIGMGSGSICITQDVMAVGRAQGTAVYDVARYANQRGIPIVADGGIRDVGYITKAISLGASAVMMGGLLAATTEAPGEYFWGPGGVRVKKYRGMGSLDAMEAHASSQDRYFTAESDQIKVAQGVSATMKDRGSCHKFIPYLIRGVQHGMQDIGVRSLRDFREKVDNGIVKFERRSTNAQLEGGVHSLHSFEKRLY 338          

HSP 2 Score: 73.1738 bits (178), Expect = 1.099e-13
Identity = 35/81 (43.21%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  634 LQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWSS 876
            L+  + GKLPI+N+N EL AL+ R+DL K R+YP++S D + QL  GAAV T  +       +++AGVDV+++ +++G S+
Sbjct:   23 LKEHRLGKLPIVNDNGELCALLCRSDLLKARDYPMASYDSKGQLLCGAAVNTRGESQYTVDRVVEAGVDVLIIDSSNGSST 103          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Celegans
Match: T22D1.3 (Inosine-5'-monophosphate dehydrogenase [Source:UniProtKB/Swiss-Prot;Acc:Q9GZH3])

HSP 1 Score: 312.383 bits (799), Expect = 3.693e-101
Identity = 163/274 (59.49%), Postives = 218/274 (79.56%), Query Frame = 2
Query:  857 QLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSD-GVRLKKYRGMGSLEAMTANQSSAVRYFS-ENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            QL+ GAAV T          ++ +G D+++IDSS G+S YQI M + +K  +P++Q+I GNVVT+ QAK LID G DGLR+GMGSGSICITQ+VMAVGR Q TAV+ V+ YA +  IPI+ADGGI++VG+I KA+ LGASA MMGG+LA T+EAPGEYF+   GVR+KKYRGMGSL+AM A+ SS  RYF+ E+D++KVAQGVS  M D+GS  K +PYL+ G+QHG+QD+GV++L + +EK+ NG ++FE+R+T+AQ+EGGVH+LHS+EKRL+
Sbjct:   65 QLLCGAAVNTRGESQYTVDRVVEAGVDVLIIDSSNGSSTYQISMLRYIKEKHPHVQVIAGNVVTRAQAKLLIDQGADGLRIGMGSGSICITQDVMAVGRAQGTAVYDVARYANQRGIPIVADGGIRDVGYITKAISLGASAVMMGGLLAATTEAPGEYFWGPGGVRVKKYRGMGSLDAMEAHASSQDRYFTAESDQIKVAQGVSATMKDRGSCHKFIPYLIRGVQHGMQDIGVRSLRDFREKVDNGIVKFERRSTNAQLEGGVHSLHSFEKRLY 338          

HSP 2 Score: 73.1738 bits (178), Expect = 1.099e-13
Identity = 35/81 (43.21%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  634 LQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWSS 876
            L+  + GKLPI+N+N EL AL+ R+DL K R+YP++S D + QL  GAAV T  +       +++AGVDV+++ +++G S+
Sbjct:   23 LKEHRLGKLPIVNDNGELCALLCRSDLLKARDYPMASYDSKGQLLCGAAVNTRGESQYTVDRVVEAGVDVLIIDSSNGSST 103          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Celegans
Match: T22D1.3 (Inosine-5'-monophosphate dehydrogenase [Source:UniProtKB/Swiss-Prot;Acc:Q9GZH3])

HSP 1 Score: 312.383 bits (799), Expect = 3.693e-101
Identity = 163/274 (59.49%), Postives = 218/274 (79.56%), Query Frame = 2
Query:  857 QLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSD-GVRLKKYRGMGSLEAMTANQSSAVRYFS-ENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            QL+ GAAV T          ++ +G D+++IDSS G+S YQI M + +K  +P++Q+I GNVVT+ QAK LID G DGLR+GMGSGSICITQ+VMAVGR Q TAV+ V+ YA +  IPI+ADGGI++VG+I KA+ LGASA MMGG+LA T+EAPGEYF+   GVR+KKYRGMGSL+AM A+ SS  RYF+ E+D++KVAQGVS  M D+GS  K +PYL+ G+QHG+QD+GV++L + +EK+ NG ++FE+R+T+AQ+EGGVH+LHS+EKRL+
Sbjct:   65 QLLCGAAVNTRGESQYTVDRVVEAGVDVLIIDSSNGSSTYQISMLRYIKEKHPHVQVIAGNVVTRAQAKLLIDQGADGLRIGMGSGSICITQDVMAVGRAQGTAVYDVARYANQRGIPIVADGGIRDVGYITKAISLGASAVMMGGLLAATTEAPGEYFWGPGGVRVKKYRGMGSLDAMEAHASSQDRYFTAESDQIKVAQGVSATMKDRGSCHKFIPYLIRGVQHGMQDIGVRSLRDFREKVDNGIVKFERRSTNAQLEGGVHSLHSFEKRLY 338          

HSP 2 Score: 73.1738 bits (178), Expect = 1.099e-13
Identity = 35/81 (43.21%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  634 LQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWSS 876
            L+  + GKLPI+N+N EL AL+ R+DL K R+YP++S D + QL  GAAV T  +       +++AGVDV+++ +++G S+
Sbjct:   23 LKEHRLGKLPIVNDNGELCALLCRSDLLKARDYPMASYDSKGQLLCGAAVNTRGESQYTVDRVVEAGVDVLIIDSSNGSST 103          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Celegans
Match: T22D1.3 (Inosine-5'-monophosphate dehydrogenase [Source:UniProtKB/Swiss-Prot;Acc:Q9GZH3])

HSP 1 Score: 312.383 bits (799), Expect = 3.693e-101
Identity = 163/274 (59.49%), Postives = 218/274 (79.56%), Query Frame = 2
Query:  857 QLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSD-GVRLKKYRGMGSLEAMTANQSSAVRYFS-ENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            QL+ GAAV T          ++ +G D+++IDSS G+S YQI M + +K  +P++Q+I GNVVT+ QAK LID G DGLR+GMGSGSICITQ+VMAVGR Q TAV+ V+ YA +  IPI+ADGGI++VG+I KA+ LGASA MMGG+LA T+EAPGEYF+   GVR+KKYRGMGSL+AM A+ SS  RYF+ E+D++KVAQGVS  M D+GS  K +PYL+ G+QHG+QD+GV++L + +EK+ NG ++FE+R+T+AQ+EGGVH+LHS+EKRL+
Sbjct:   65 QLLCGAAVNTRGESQYTVDRVVEAGVDVLIIDSSNGSSTYQISMLRYIKEKHPHVQVIAGNVVTRAQAKLLIDQGADGLRIGMGSGSICITQDVMAVGRAQGTAVYDVARYANQRGIPIVADGGIRDVGYITKAISLGASAVMMGGLLAATTEAPGEYFWGPGGVRVKKYRGMGSLDAMEAHASSQDRYFTAESDQIKVAQGVSATMKDRGSCHKFIPYLIRGVQHGMQDIGVRSLRDFREKVDNGIVKFERRSTNAQLEGGVHSLHSFEKRLY 338          

HSP 2 Score: 73.1738 bits (178), Expect = 1.099e-13
Identity = 35/81 (43.21%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  634 LQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWSS 876
            L+  + GKLPI+N+N EL AL+ R+DL K R+YP++S D + QL  GAAV T  +       +++AGVDV+++ +++G S+
Sbjct:   23 LKEHRLGKLPIVNDNGELCALLCRSDLLKARDYPMASYDSKGQLLCGAAVNTRGESQYTVDRVVEAGVDVLIIDSSNGSST 103          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Fly
Match: ras (gene:FBgn0003204 transcript:FBtr0343043)

HSP 1 Score: 355.91 bits (912), Expect = 3.818e-115
Identity = 184/277 (66.43%), Postives = 232/277 (83.75%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMT---ANQSSAVRYF-SENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+VGAA+GT   D  R ++++ +G D+I++DSSQGNS+YQ++M K +K  YP LQ+IGGNVVT+ QAK+LIDAGVDGLRVGMGSGSICITQEVMA G PQATAV++VS YAR++ +P+IADGGIQ++GHIVKA+ LGASA MMG +LAGTSEAPGEYFFSDGVRLKKYRGMGSLEAM    A  ++  RY+ +E DK+KVAQGVSG+++DKGSV++ +PYL  G+QH  QD+G  ++ +L++ IYNG+LRF KRT SAQ+EG VH L SYEKRLF
Sbjct:  261 KQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQGNSVYQVEMIKYIKETYPELQVIGGNVVTRAQAKNLIDAGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYARQFGVPVIADGGIQSIGHIVKAIALGASAVMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMERGDAKGAAMSRYYHNEMDKMKVAQGVSGSIVDKGSVLRYLPYLECGLQHSCQDIGANSINKLRDMIYNGQLRFMKRTHSAQLEGNVHGLFSYEKRLF 537          

HSP 2 Score: 295.434 bits (755), Expect = 5.271e-92
Identity = 156/265 (58.87%), Postives = 205/265 (77.36%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG S  ELF    GLTYNDF++LPGYIDF +EEVD+++ +TK++ L+ PLVSSPMDTVTES MAIAMAL GGIGI+HHNCT + QA E+ +VKKY+ GF+ DP VMS  NTVG+V+  + KNGFTG P+T+NGKLGGKL+G+VT RDIDF  ++  ++ ++++MT    L+TAP G+ L  AN IL++SKKGKLPI+N+  ELVA+I+RTDLKK R YP +SKD  KQL VGAA+GT  +D  R  +L+  GVDV+++ ++ G S
Sbjct:   38 DGLSCKELFQNGEGLTYNDFLILPGYIDFTAEEVDLSSPLTKSLTLRAPLVSSPMDTVTESEMAIAMALCGGIGIIHHNCTPEYQALEVHKVKKYKHGFMRDPSVMSPTNTVGDVLEARRKNGFTGYPVTENGKLGGKLLGMVTSRDIDF-RENQPEVLLADIMT--TELVTAPNGINLPTANAILEKSKKGKLPIVNQAGELVAMIARTDLKKARSYPNASKDSNKQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQGNS 299          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Fly
Match: ras (gene:FBgn0003204 transcript:FBtr0071495)

HSP 1 Score: 355.91 bits (912), Expect = 3.818e-115
Identity = 184/277 (66.43%), Postives = 232/277 (83.75%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMT---ANQSSAVRYF-SENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+VGAA+GT   D  R ++++ +G D+I++DSSQGNS+YQ++M K +K  YP LQ+IGGNVVT+ QAK+LIDAGVDGLRVGMGSGSICITQEVMA G PQATAV++VS YAR++ +P+IADGGIQ++GHIVKA+ LGASA MMG +LAGTSEAPGEYFFSDGVRLKKYRGMGSLEAM    A  ++  RY+ +E DK+KVAQGVSG+++DKGSV++ +PYL  G+QH  QD+G  ++ +L++ IYNG+LRF KRT SAQ+EG VH L SYEKRLF
Sbjct:  261 KQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQGNSVYQVEMIKYIKETYPELQVIGGNVVTRAQAKNLIDAGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYARQFGVPVIADGGIQSIGHIVKAIALGASAVMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMERGDAKGAAMSRYYHNEMDKMKVAQGVSGSIVDKGSVLRYLPYLECGLQHSCQDIGANSINKLRDMIYNGQLRFMKRTHSAQLEGNVHGLFSYEKRLF 537          

HSP 2 Score: 295.434 bits (755), Expect = 5.271e-92
Identity = 156/265 (58.87%), Postives = 205/265 (77.36%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG S  ELF    GLTYNDF++LPGYIDF +EEVD+++ +TK++ L+ PLVSSPMDTVTES MAIAMAL GGIGI+HHNCT + QA E+ +VKKY+ GF+ DP VMS  NTVG+V+  + KNGFTG P+T+NGKLGGKL+G+VT RDIDF  ++  ++ ++++MT    L+TAP G+ L  AN IL++SKKGKLPI+N+  ELVA+I+RTDLKK R YP +SKD  KQL VGAA+GT  +D  R  +L+  GVDV+++ ++ G S
Sbjct:   38 DGLSCKELFQNGEGLTYNDFLILPGYIDFTAEEVDLSSPLTKSLTLRAPLVSSPMDTVTESEMAIAMALCGGIGIIHHNCTPEYQALEVHKVKKYKHGFMRDPSVMSPTNTVGDVLEARRKNGFTGYPVTENGKLGGKLLGMVTSRDIDF-RENQPEVLLADIMT--TELVTAPNGINLPTANAILEKSKKGKLPIVNQAGELVAMIARTDLKKARSYPNASKDSNKQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQGNS 299          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Fly
Match: ras (gene:FBgn0003204 transcript:FBtr0332294)

HSP 1 Score: 355.91 bits (912), Expect = 3.818e-115
Identity = 184/277 (66.43%), Postives = 232/277 (83.75%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMT---ANQSSAVRYF-SENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+VGAA+GT   D  R ++++ +G D+I++DSSQGNS+YQ++M K +K  YP LQ+IGGNVVT+ QAK+LIDAGVDGLRVGMGSGSICITQEVMA G PQATAV++VS YAR++ +P+IADGGIQ++GHIVKA+ LGASA MMG +LAGTSEAPGEYFFSDGVRLKKYRGMGSLEAM    A  ++  RY+ +E DK+KVAQGVSG+++DKGSV++ +PYL  G+QH  QD+G  ++ +L++ IYNG+LRF KRT SAQ+EG VH L SYEKRLF
Sbjct:  261 KQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQGNSVYQVEMIKYIKETYPELQVIGGNVVTRAQAKNLIDAGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYARQFGVPVIADGGIQSIGHIVKAIALGASAVMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMERGDAKGAAMSRYYHNEMDKMKVAQGVSGSIVDKGSVLRYLPYLECGLQHSCQDIGANSINKLRDMIYNGQLRFMKRTHSAQLEGNVHGLFSYEKRLF 537          

HSP 2 Score: 295.434 bits (755), Expect = 5.271e-92
Identity = 156/265 (58.87%), Postives = 205/265 (77.36%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG S  ELF    GLTYNDF++LPGYIDF +EEVD+++ +TK++ L+ PLVSSPMDTVTES MAIAMAL GGIGI+HHNCT + QA E+ +VKKY+ GF+ DP VMS  NTVG+V+  + KNGFTG P+T+NGKLGGKL+G+VT RDIDF  ++  ++ ++++MT    L+TAP G+ L  AN IL++SKKGKLPI+N+  ELVA+I+RTDLKK R YP +SKD  KQL VGAA+GT  +D  R  +L+  GVDV+++ ++ G S
Sbjct:   38 DGLSCKELFQNGEGLTYNDFLILPGYIDFTAEEVDLSSPLTKSLTLRAPLVSSPMDTVTESEMAIAMALCGGIGIIHHNCTPEYQALEVHKVKKYKHGFMRDPSVMSPTNTVGDVLEARRKNGFTGYPVTENGKLGGKLLGMVTSRDIDF-RENQPEVLLADIMT--TELVTAPNGINLPTANAILEKSKKGKLPIVNQAGELVAMIARTDLKKARSYPNASKDSNKQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQGNS 299          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Fly
Match: ras (gene:FBgn0003204 transcript:FBtr0071494)

HSP 1 Score: 355.91 bits (912), Expect = 3.818e-115
Identity = 184/277 (66.43%), Postives = 232/277 (83.75%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMT---ANQSSAVRYF-SENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+VGAA+GT   D  R ++++ +G D+I++DSSQGNS+YQ++M K +K  YP LQ+IGGNVVT+ QAK+LIDAGVDGLRVGMGSGSICITQEVMA G PQATAV++VS YAR++ +P+IADGGIQ++GHIVKA+ LGASA MMG +LAGTSEAPGEYFFSDGVRLKKYRGMGSLEAM    A  ++  RY+ +E DK+KVAQGVSG+++DKGSV++ +PYL  G+QH  QD+G  ++ +L++ IYNG+LRF KRT SAQ+EG VH L SYEKRLF
Sbjct:  261 KQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQGNSVYQVEMIKYIKETYPELQVIGGNVVTRAQAKNLIDAGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYARQFGVPVIADGGIQSIGHIVKAIALGASAVMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMERGDAKGAAMSRYYHNEMDKMKVAQGVSGSIVDKGSVLRYLPYLECGLQHSCQDIGANSINKLRDMIYNGQLRFMKRTHSAQLEGNVHGLFSYEKRLF 537          

HSP 2 Score: 295.434 bits (755), Expect = 5.271e-92
Identity = 156/265 (58.87%), Postives = 205/265 (77.36%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG S  ELF    GLTYNDF++LPGYIDF +EEVD+++ +TK++ L+ PLVSSPMDTVTES MAIAMAL GGIGI+HHNCT + QA E+ +VKKY+ GF+ DP VMS  NTVG+V+  + KNGFTG P+T+NGKLGGKL+G+VT RDIDF  ++  ++ ++++MT    L+TAP G+ L  AN IL++SKKGKLPI+N+  ELVA+I+RTDLKK R YP +SKD  KQL VGAA+GT  +D  R  +L+  GVDV+++ ++ G S
Sbjct:   38 DGLSCKELFQNGEGLTYNDFLILPGYIDFTAEEVDLSSPLTKSLTLRAPLVSSPMDTVTESEMAIAMALCGGIGIIHHNCTPEYQALEVHKVKKYKHGFMRDPSVMSPTNTVGDVLEARRKNGFTGYPVTENGKLGGKLLGMVTSRDIDF-RENQPEVLLADIMT--TELVTAPNGINLPTANAILEKSKKGKLPIVNQAGELVAMIARTDLKKARSYPNASKDSNKQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQGNS 299          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Fly
Match: ras (gene:FBgn0003204 transcript:FBtr0474163)

HSP 1 Score: 355.525 bits (911), Expect = 1.974e-114
Identity = 184/277 (66.43%), Postives = 232/277 (83.75%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMT---ANQSSAVRYF-SENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+VGAA+GT   D  R ++++ +G D+I++DSSQGNS+YQ++M K +K  YP LQ+IGGNVVT+ QAK+LIDAGVDGLRVGMGSGSICITQEVMA G PQATAV++VS YAR++ +P+IADGGIQ++GHIVKA+ LGASA MMG +LAGTSEAPGEYFFSDGVRLKKYRGMGSLEAM    A  ++  RY+ +E DK+KVAQGVSG+++DKGSV++ +PYL  G+QH  QD+G  ++ +L++ IYNG+LRF KRT SAQ+EG VH L SYEKRLF
Sbjct:  261 KQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQGNSVYQVEMIKYIKETYPELQVIGGNVVTRAQAKNLIDAGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYARQFGVPVIADGGIQSIGHIVKAIALGASAVMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMERGDAKGAAMSRYYHNEMDKMKVAQGVSGSIVDKGSVLRYLPYLECGLQHSCQDIGANSINKLRDMIYNGQLRFMKRTHSAQLEGNVHGLFSYEKRLF 537          

HSP 2 Score: 295.819 bits (756), Expect = 1.710e-91
Identity = 156/265 (58.87%), Postives = 205/265 (77.36%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG S  ELF    GLTYNDF++LPGYIDF +EEVD+++ +TK++ L+ PLVSSPMDTVTES MAIAMAL GGIGI+HHNCT + QA E+ +VKKY+ GF+ DP VMS  NTVG+V+  + KNGFTG P+T+NGKLGGKL+G+VT RDIDF  ++  ++ ++++MT    L+TAP G+ L  AN IL++SKKGKLPI+N+  ELVA+I+RTDLKK R YP +SKD  KQL VGAA+GT  +D  R  +L+  GVDV+++ ++ G S
Sbjct:   38 DGLSCKELFQNGEGLTYNDFLILPGYIDFTAEEVDLSSPLTKSLTLRAPLVSSPMDTVTESEMAIAMALCGGIGIIHHNCTPEYQALEVHKVKKYKHGFMRDPSVMSPTNTVGDVLEARRKNGFTGYPVTENGKLGGKLLGMVTSRDIDFR-ENQPEVLLADIMT--TELVTAPNGINLPTANAILEKSKKGKLPIVNQAGELVAMIARTDLKKARSYPNASKDSNKQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQGNS 299          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Zebrafish
Match: impdh2 (IMP (inosine 5'-monophosphate) dehydrogenase 2 [Source:NCBI gene;Acc:317745])

HSP 1 Score: 379.407 bits (973), Expect = 1.662e-124
Identity = 190/273 (69.60%), Postives = 228/273 (83.52%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT+  D  R  ++  +G D++V+DSSQGNSI+QI+M K +K  YPN+Q+IGGNVVT  QAK+LIDAG D LRVGMGSGSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQ VGHI KAL LGAS  MMG +LA TSEAPGEYFFSDG+RLKKYRGMGSL+AM  N  S  RYFSE+DK+KVAQGVSG + DKGS+ K +PYL+ GIQH  QD+G K+L +L+  +Y+GELRFEKRT SAQ+EGGVH+LHSYEKRLF
Sbjct:  242 KQLLCGAAIGTHNDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKEKYPNVQVIGGNVVTAAQAKNLIDAGADALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQTVGHIAKALALGASTVMMGSLLAATSEAPGEYFFSDGIRLKKYRGMGSLDAMDKNLGSQTRYFSESDKIKVAQGVSGAVQDKGSIHKFVPYLLVGIQHSCQDIGAKSLTQLRAMMYSGELRFEKRTMSAQMEGGVHSLHSYEKRLF 514          

HSP 2 Score: 338.961 bits (868), Expect = 7.581e-109
Identity = 173/275 (62.91%), Postives = 217/275 (78.91%), Query Frame = 1
Query:   49 SAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            S   G V D DG +  +LFN   GLTYNDF++LPGYIDF +++VD+T+ +TK + +KTPL+SSPMDTVTES MAIAMAL+GGIG +HHNCT + QANE+R+VK+YEQGFI DPVVMS +  V +V   K ++GF GIPITDNG++GG+LVG+++ RDIDFL +S  DL +SEVMT  E+L+ AP GV L EAN ILQRSKKGKLPI+NE   LVA+I+RTDLKKNR++PL+SKD RKQL  GAA+GTH DD  R  +L  AGVDVVV+ ++ G S
Sbjct:    7 SGQTGYVPD-DGLTGQQLFNSGDGLTYNDFLILPGYIDFTADQVDLTSALTKQITMKTPLISSPMDTVTESGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKRYEQGFITDPVVMSPNERVRDVFQAKARHGFCGIPITDNGQMGGRLVGIISSRDIDFLKESEHDLPLSEVMTKREDLVVAPAGVTLKEANEILQRSKKGKLPIVNEEGCLVAIIARTDLKKNRDFPLASKDSRKQLLCGAAIGTHNDDKYRLDLLAQAGVDVVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Zebrafish
Match: impdh1b (IMP (inosine 5'-monophosphate) dehydrogenase 1b [Source:NCBI gene;Acc:338306])

HSP 1 Score: 377.867 bits (969), Expect = 7.738e-124
Identity = 189/273 (69.23%), Postives = 226/273 (82.78%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT   D  R  ++  SG D++V+DSSQGNS+YQI+M   +K  YP LQ++GGNVVT  QAK+LIDAGVD LRVGMG GSICITQEVMA GRPQ T+V+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  N SS  RYFSE DKVKVAQGVSG++ DKGS+ K +PYL+AGIQHG QD+G K+L  L+  +Y+GEL+FEKRT SAQVEGGVH LHS+EKRL+
Sbjct:  242 KQLLCGAAIGTREDDKYRLDLLTQSGVDMVVLDSSQGNSVYQINMIHYIKQKYPELQVVGGNVVTAAQAKNLIDAGVDALRVGMGCGSICITQEVMACGRPQGTSVYKVAEYARRFGVPVIADGGIQTVGHVVKALSLGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKNTSSQKRYFSEGDKVKVAQGVSGSVQDKGSIHKFVPYLIAGIQHGCQDIGAKSLSVLRSMMYSGELKFEKRTMSAQVEGGVHGLHSFEKRLY 514          

HSP 2 Score: 328.561 bits (841), Expect = 9.007e-105
Identity = 167/265 (63.02%), Postives = 215/265 (81.13%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG SA +LF    GLTYNDF++LPG+IDF S+EVD+T+ +TK + LKTPL+SSPMDTVTES+MAIAMAL GGIGI+HHNCT + QANE+R+VK++EQGFI DPVV+S  +TVG+V+  K+++GF+GIPIT+ GK+G KLVG+VT RDIDFL + + +  + E MT  E+L+ AP GV L EAN ILQRSKKGKLPI+N+  ELVA+I+RTDLKKNR+YPL+SKD RKQL  GAA+GT +DD  R  +L  +GVD+VV+ ++ G S
Sbjct:   16 DGLSAQQLFAVGDGLTYNDFLILPGFIDFTSDEVDLTSALTKKITLKTPLISSPMDTVTESSMAIAMALMGGIGIIHHNCTPEFQANEVRKVKRFEQGFITDPVVLSPHHTVGDVLEAKVRHGFSGIPITETGKMGSKLVGIVTSRDIDFLSEKDNNKYLEEAMTKREDLVVAPAGVTLKEANDILQRSKKGKLPIVNDKDELVAIIARTDLKKNRDYPLASKDSRKQLLCGAAIGTREDDKYRLDLLTQSGVDMVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Zebrafish
Match: impdh1b (IMP (inosine 5'-monophosphate) dehydrogenase 1b [Source:NCBI gene;Acc:338306])

HSP 1 Score: 377.867 bits (969), Expect = 1.652e-123
Identity = 189/273 (69.23%), Postives = 226/273 (82.78%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT   D  R  ++  SG D++V+DSSQGNS+YQI+M   +K  YP LQ++GGNVVT  QAK+LIDAGVD LRVGMG GSICITQEVMA GRPQ T+V+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  N SS  RYFSE DKVKVAQGVSG++ DKGS+ K +PYL+AGIQHG QD+G K+L  L+  +Y+GEL+FEKRT SAQVEGGVH LHS+EKRL+
Sbjct:  267 KQLLCGAAIGTREDDKYRLDLLTQSGVDMVVLDSSQGNSVYQINMIHYIKQKYPELQVVGGNVVTAAQAKNLIDAGVDALRVGMGCGSICITQEVMACGRPQGTSVYKVAEYARRFGVPVIADGGIQTVGHVVKALSLGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKNTSSQKRYFSEGDKVKVAQGVSGSVQDKGSIHKFVPYLIAGIQHGCQDIGAKSLSVLRSMMYSGELKFEKRTMSAQVEGGVHGLHSFEKRLY 539          

HSP 2 Score: 330.872 bits (847), Expect = 2.247e-105
Identity = 167/265 (63.02%), Postives = 217/265 (81.89%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A ELF+K  G+TYNDF++LPG+IDF S+EVD+T+ +TK + LKTPL+SSPMDTVTES+MAIAMAL GGIGI+HHNCT + QANE+R+VK++EQGFI DPVV+S  +TVG+V+  K+++GF+GIPIT+ GK+G KLVG+VT RDIDFL + + +  + E MT  E+L+ AP GV L EAN ILQRSKKGKLPI+N+  ELVA+I+RTDLKKNR+YPL+SKD RKQL  GAA+GT +DD  R  +L  +GVD+VV+ ++ G S
Sbjct:   41 DGHTAEELFSKGDGMTYNDFLILPGFIDFTSDEVDLTSALTKKITLKTPLISSPMDTVTESSMAIAMALMGGIGIIHHNCTPEFQANEVRKVKRFEQGFITDPVVLSPHHTVGDVLEAKVRHGFSGIPITETGKMGSKLVGIVTSRDIDFLSEKDNNKYLEEAMTKREDLVVAPAGVTLKEANDILQRSKKGKLPIVNDKDELVAIIARTDLKKNRDYPLASKDSRKQLLCGAAIGTREDDKYRLDLLTQSGVDMVVLDSSQGNS 305          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Zebrafish
Match: impdh1a (IMP (inosine 5'-monophosphate) dehydrogenase 1a [Source:NCBI gene;Acc:431724])

HSP 1 Score: 376.711 bits (966), Expect = 2.843e-123
Identity = 189/273 (69.23%), Postives = 226/273 (82.78%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT   D  R  +++ +G D+IV+DSSQGNS++QI M   +K  YP LQ++GGNVVT  QAK+LIDAGVD LRVGMG GSICITQEVMA GRPQ T+V+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  N SS  RYFSE DKVKVAQGVSG++ DKGS+ K +PYL+AGIQHG QD+G K+L  L+  +Y+GEL+FEKRT SAQVEGGVH LHSYEKRL+
Sbjct:  257 KQLLCGAAIGTREDDKYRLDLLMQAGVDVIVLDSSQGNSVFQISMINYIKQKYPELQVVGGNVVTAAQAKNLIDAGVDALRVGMGCGSICITQEVMACGRPQGTSVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKNNSSQKRYFSEGDKVKVAQGVSGSVQDKGSIHKFVPYLIAGIQHGCQDIGAKSLSILRSMMYSGELKFEKRTMSAQVEGGVHGLHSYEKRLY 529          

HSP 2 Score: 321.242 bits (822), Expect = 6.973e-102
Identity = 167/280 (59.64%), Postives = 217/280 (77.50%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTY---------------NDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTY               +DF++LPG+IDF S+EVD+T+ +T+ + LKTPL+SSPMDTVTES+MAIAMAL GGIGI+HHNCT + QANE+R+VKK+EQGFI DPVVMS  +TVG+V   K+++GF+GIP+T+ GK+G KLVG+VT RDIDFL + ++D  + E MT  E+L+ AP GV L EAN ILQRSKKGKLPI+N++ ELVA+I+RTDLKKNR+YPL+SKD RKQL  GAA+GT +DD  R  +L+ AGVDV+V+ ++ G S
Sbjct:   16 DGLTAQQLFAIGDGLTYKSLLLPNCAICPSPFSDFLILPGFIDFISDEVDLTSALTRKITLKTPLISSPMDTVTESSMAIAMALMGGIGIIHHNCTPEFQANEVRKVKKFEQGFITDPVVMSPRHTVGDVFEAKVRHGFSGIPVTETGKMGSKLVGIVTSRDIDFLSEKDYDRPLEESMTKREDLVVAPAGVTLKEANDILQRSKKGKLPIVNDSDELVAIIARTDLKKNRDYPLASKDSRKQLLCGAAIGTREDDKYRLDLLMQAGVDVIVLDSSQGNS 295          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Zebrafish
Match: impdh1a (IMP (inosine 5'-monophosphate) dehydrogenase 1a [Source:NCBI gene;Acc:431724])

HSP 1 Score: 376.711 bits (966), Expect = 2.843e-123
Identity = 189/273 (69.23%), Postives = 226/273 (82.78%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT   D  R  +++ +G D+IV+DSSQGNS++QI M   +K  YP LQ++GGNVVT  QAK+LIDAGVD LRVGMG GSICITQEVMA GRPQ T+V+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  N SS  RYFSE DKVKVAQGVSG++ DKGS+ K +PYL+AGIQHG QD+G K+L  L+  +Y+GEL+FEKRT SAQVEGGVH LHSYEKRL+
Sbjct:  257 KQLLCGAAIGTREDDKYRLDLLMQAGVDVIVLDSSQGNSVFQISMINYIKQKYPELQVVGGNVVTAAQAKNLIDAGVDALRVGMGCGSICITQEVMACGRPQGTSVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKNNSSQKRYFSEGDKVKVAQGVSGSVQDKGSIHKFVPYLIAGIQHGCQDIGAKSLSILRSMMYSGELKFEKRTMSAQVEGGVHGLHSYEKRLY 529          

HSP 2 Score: 321.242 bits (822), Expect = 6.973e-102
Identity = 167/280 (59.64%), Postives = 217/280 (77.50%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTY---------------NDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTY               +DF++LPG+IDF S+EVD+T+ +T+ + LKTPL+SSPMDTVTES+MAIAMAL GGIGI+HHNCT + QANE+R+VKK+EQGFI DPVVMS  +TVG+V   K+++GF+GIP+T+ GK+G KLVG+VT RDIDFL + ++D  + E MT  E+L+ AP GV L EAN ILQRSKKGKLPI+N++ ELVA+I+RTDLKKNR+YPL+SKD RKQL  GAA+GT +DD  R  +L+ AGVDV+V+ ++ G S
Sbjct:   16 DGLTAQQLFAIGDGLTYKSLLLPNCAICPSPFSDFLILPGFIDFISDEVDLTSALTRKITLKTPLISSPMDTVTESSMAIAMALMGGIGIIHHNCTPEFQANEVRKVKKFEQGFITDPVVMSPRHTVGDVFEAKVRHGFSGIPVTETGKMGSKLVGIVTSRDIDFLSEKDYDRPLEESMTKREDLVVAPAGVTLKEANDILQRSKKGKLPIVNDSDELVAIIARTDLKKNRDYPLASKDSRKQLLCGAAIGTREDDKYRLDLLMQAGVDVIVLDSSQGNS 295          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Xenopus
Match: impdh1 (IMP (inosine 5'-monophosphate) dehydrogenase 1 [Source:NCBI gene;Acc:550037])

HSP 1 Score: 377.096 bits (967), Expect = 1.521e-123
Identity = 189/273 (69.23%), Postives = 225/273 (82.42%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT   D  R  ++  +G D++V+DSSQGNS+YQI+M   +K  YP LQ++GGNVVT  QAK+LIDAGVD LRVGMG GSICITQEVMA GRPQ TAV+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  N SS  RYFSE DKVKVAQGVSG++ DKGS+ K +PYL+AGIQHG QD+G K+L  L+  +Y+GEL+ EKRT SAQVEGGVH LHSYEKRL+
Sbjct:  234 KQLLCGAAIGTREDDKYRLDLLTQAGVDVVVLDSSQGNSVYQINMIHYIKQKYPELQVVGGNVVTAAQAKNLIDAGVDALRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKNTSSQKRYFSEGDKVKVAQGVSGSIQDKGSIHKFVPYLIAGIQHGCQDIGAKSLSILRSMMYSGELKLEKRTMSAQVEGGVHGLHSYEKRLY 506          

HSP 2 Score: 309.301 bits (791), Expect = 2.436e-97
Identity = 157/247 (63.56%), Postives = 204/247 (82.59%), Query Frame = 1
Query:  133 DFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DF++LPG+IDF ++EVD+T+ +T+ + LKTPL+SSPMDTVTES+MAIAMAL G IGI+HHNCT + QANE+R+VKK+EQGFI DPVVMS+++TVG+V   K ++GF+GIP+T+ GK+G KLVG+VT RDIDFL + ++   +SEVMT  + L+ AP GV L EAN ILQRSKKGKLPI+N++ ELVA+I+RTDLKKNR+YPL+SKD RKQL  GAA+GT +DD  R  +L  AGVDVVV+ ++ G S
Sbjct:   26 DFLILPGFIDFTADEVDLTSALTRKITLKTPLISSPMDTVTESDMAIAMALMGEIGIIHHNCTPEFQANEVRKVKKFEQGFITDPVVMSLNHTVGDVFEAKNRHGFSGIPVTETGKMGSKLVGIVTSRDIDFLTEKDYSTYLSEVMTKRDELVVAPAGVTLKEANEILQRSKKGKLPIVNDSDELVAIIARTDLKKNRDYPLASKDCRKQLLCGAAIGTREDDKYRLDLLTQAGVDVVVLDSSQGNS 272          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Xenopus
Match: impdh2 (IMP (inosine 5'-monophosphate) dehydrogenase 2 [Source:NCBI gene;Acc:493428])

HSP 1 Score: 375.17 bits (962), Expect = 4.888e-123
Identity = 188/273 (68.86%), Postives = 226/273 (82.78%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT+  D  R  +++ +G D +V+DSSQGNSI+QI+M K +K  Y +LQ+I GNVVT  QAK+LIDAG D LRVGMGSGSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQ VGHI KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  N SS  RYFSE DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +++  +Y+GEL+FEKRT SAQVEGGVH LHSYEKRLF
Sbjct:  217 KQLLCGAAIGTHEDDKYRLDLLVQAGVDAVVLDSSQGNSIFQINMIKFIKEKYQDLQVIAGNVVTAAQAKNLIDAGADALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQTVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKNVSSQKRYFSEADKIKVAQGVSGAVQDKGSIHKFIPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTMSAQVEGGVHGLHSYEKRLF 489          

HSP 2 Score: 281.567 bits (719), Expect = 6.954e-87
Identity = 149/265 (56.23%), Postives = 190/265 (71.70%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTYNDF++LPGYIDF +++VD+T+ +TK + LKTP+VSSPMDTVTE++MAIAMA                         KYEQGFI DPVV+S  + V +V   K ++GF GIPIT+NGK+G KL G+++ RDIDFL     DL +SE+MT  E+L+ AP GV L EAN ILQRSKKGKLPI+N N ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAA+GTH+DD  R  +L+ AGVD VV+ ++ G S
Sbjct:   16 DGLTAQQLFGAGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPMVSSPMDTVTEASMAIAMA-------------------------KYEQGFITDPVVLSPKHRVRDVFEAKARHGFCGIPITENGKMGSKLAGIISSRDIDFLKSEEHDLALSEIMTRREDLVVAPAGVTLKEANEILQRSKKGKLPIVNGNDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLVQAGVDAVVLDSSQGNS 255          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Xenopus
Match: impdh2 (IMP (inosine 5'-monophosphate) dehydrogenase 2 [Source:NCBI gene;Acc:493428])

HSP 1 Score: 375.17 bits (962), Expect = 6.833e-123
Identity = 188/273 (68.86%), Postives = 226/273 (82.78%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT+  D  R  +++ +G D +V+DSSQGNSI+QI+M K +K  Y +LQ+I GNVVT  QAK+LIDAG D LRVGMGSGSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQ VGHI KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  N SS  RYFSE DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +++  +Y+GEL+FEKRT SAQVEGGVH LHSYEKRLF
Sbjct:  227 KQLLCGAAIGTHEDDKYRLDLLVQAGVDAVVLDSSQGNSIFQINMIKFIKEKYQDLQVIAGNVVTAAQAKNLIDAGADALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQTVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKNVSSQKRYFSEADKIKVAQGVSGAVQDKGSIHKFIPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTMSAQVEGGVHGLHSYEKRLF 499          

HSP 2 Score: 315.849 bits (808), Expect = 4.851e-100
Identity = 157/248 (63.31%), Postives = 202/248 (81.45%), Query Frame = 1
Query:  130 NDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            +DF++LPGYIDF +++VD+T+ +TK + LKTP+VSSPMDTVTE++MAIAMAL+GGIGI+HHNCT + QANE+R+VKKYEQGFI DPVV+S  + V +V   K ++GF GIPIT+NGK+G KL G+++ RDIDFL     DL +SE+MT  E+L+ AP GV L EAN ILQRSKKGKLPI+N N ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAA+GTH+DD  R  +L+ AGVD VV+ ++ G S
Sbjct:   18 SDFLILPGYIDFTADQVDLTSALTKKITLKTPMVSSPMDTVTEASMAIAMALTGGIGIMHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKHRVRDVFEAKARHGFCGIPITENGKMGSKLAGIISSRDIDFLKSEEHDLALSEIMTRREDLVVAPAGVTLKEANEILQRSKKGKLPIVNGNDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLVQAGVDAVVLDSSQGNS 265          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Xenopus
Match: impdh2 (IMP (inosine 5'-monophosphate) dehydrogenase 2 [Source:NCBI gene;Acc:493428])

HSP 1 Score: 375.17 bits (962), Expect = 1.793e-122
Identity = 188/273 (68.86%), Postives = 226/273 (82.78%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT+  D  R  +++ +G D +V+DSSQGNSI+QI+M K +K  Y +LQ+I GNVVT  QAK+LIDAG D LRVGMGSGSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQ VGHI KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  N SS  RYFSE DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +++  +Y+GEL+FEKRT SAQVEGGVH LHSYEKRLF
Sbjct:  254 KQLLCGAAIGTHEDDKYRLDLLVQAGVDAVVLDSSQGNSIFQINMIKFIKEKYQDLQVIAGNVVTAAQAKNLIDAGADALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQTVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKNVSSQKRYFSEADKIKVAQGVSGAVQDKGSIHKFIPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTMSAQVEGGVHGLHSYEKRLF 526          

HSP 2 Score: 315.464 bits (807), Expect = 1.893e-99
Identity = 164/281 (58.36%), Postives = 209/281 (74.38%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYN----------------DFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTY                 DF++LPGYIDF +++VD+T+ +TK + LKTP+VSSPMDTVTE++MAIAMAL+GGIGI+HHNCT + QANE+R+VKKYEQGFI DPVV+S  + V +V   K ++GF GIPIT+NGK+G KL G+++ RDIDFL     DL    +MT  E+L+ AP GV L EAN ILQRSKKGKLPI+N N ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAA+GTH+DD  R  +L+ AGVD VV+ ++ G S
Sbjct:   16 DGLTAQQLFGAGDGLTYKGRSAQTAAPALGIVVLDFLILPGYIDFTADQVDLTSALTKKITLKTPMVSSPMDTVTEASMAIAMALTGGIGIMHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKHRVRDVFEAKARHGFCGIPITENGKMGSKLAGIISSRDIDFLKSEEHDL----IMTRREDLVVAPAGVTLKEANEILQRSKKGKLPIVNGNDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLVQAGVDAVVLDSSQGNS 292          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Xenopus
Match: impdh2 (IMP (inosine 5'-monophosphate) dehydrogenase 2 [Source:NCBI gene;Acc:493428])

HSP 1 Score: 374.785 bits (961), Expect = 3.045e-122
Identity = 188/273 (68.86%), Postives = 226/273 (82.78%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT+  D  R  +++ +G D +V+DSSQGNSI+QI+M K +K  Y +LQ+I GNVVT  QAK+LIDAG D LRVGMGSGSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQ VGHI KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  N SS  RYFSE DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +++  +Y+GEL+FEKRT SAQVEGGVH LHSYEKRLF
Sbjct:  265 KQLLCGAAIGTHEDDKYRLDLLVQAGVDAVVLDSSQGNSIFQINMIKFIKEKYQDLQVIAGNVVTAAQAKNLIDAGADALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQTVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKNVSSQKRYFSEADKIKVAQGVSGAVQDKGSIHKFIPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTMSAQVEGGVHGLHSYEKRLF 537          

HSP 2 Score: 322.013 bits (824), Expect = 7.809e-102
Identity = 166/288 (57.64%), Postives = 213/288 (73.96%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTY-----------------------NDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTY                       +DF++LPGYIDF +++VD+T+ +TK + LKTP+VSSPMDTVTE++MAIAMAL+GGIGI+HHNCT + QANE+R+VKKYEQGFI DPVV+S  + V +V   K ++GF GIPIT+NGK+G KL G+++ RDIDFL     DL +SE+MT  E+L+ AP GV L EAN ILQRSKKGKLPI+N N ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAA+GTH+DD  R  +L+ AGVD VV+ ++ G S
Sbjct:   16 DGLTAQQLFGAGDGLTYKDALLLLYFSLSITYGFLFLPYPSDFLILPGYIDFTADQVDLTSALTKKITLKTPMVSSPMDTVTEASMAIAMALTGGIGIMHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKHRVRDVFEAKARHGFCGIPITENGKMGSKLAGIISSRDIDFLKSEEHDLALSEIMTRREDLVVAPAGVTLKEANEILQRSKKGKLPIVNGNDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLVQAGVDAVVLDSSQGNS 303          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Mouse
Match: Impdh1 (inosine monophosphate dehydrogenase 1 [Source:MGI Symbol;Acc:MGI:96567])

HSP 1 Score: 380.563 bits (976), Expect = 2.676e-125
Identity = 191/273 (69.96%), Postives = 228/273 (83.52%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAAVGT   D  R  ++  +GAD+IV+DSSQGNS+YQI M   +K  YP+LQ+IGGNVVT  QAK+LIDAGVDGLRVGMG GSICITQEVMA GRPQ TAV+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  + SS  RYFSE DKVK+AQGVSG++ DKGS+ K +PYL+AGIQHG QD+G ++L  L+  +Y+GEL+FEKRT SAQ+EGGVH LHSYEKRL+
Sbjct:  217 KQLLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGAQSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY 489          

HSP 2 Score: 273.478 bits (698), Expect = 5.281e-84
Identity = 148/265 (55.85%), Postives = 189/265 (71.32%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTYNDF++LPG+IDF ++EVD+T+ +T+ + LKTPL+SSPMDTVTE++MAIAMA                         K+EQGFI DPVV+S  +TVG+V+  KI++GF+GIPIT  G +G KLVG+VT RDIDFL + +    +SEVMTP   L+ AP GV L EAN ILQRSKKGKLPI+N+  ELVA+I+RTDLKKNR+YPL+SKD  KQL  GAAVGT +DD  R  +L  AG DV+V+ ++ G S
Sbjct:   16 DGLTAQQLFANADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMA-------------------------KFEQGFITDPVVLSPSHTVGDVLEAKIQHGFSGIPITATGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRVELVVAPAGVTLKEANEILQRSKKGKLPIVNDQDELVAIIARTDLKKNRDYPLASKDSHKQLLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNS 255          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Mouse
Match: Impdh2 (inosine monophosphate dehydrogenase 2 [Source:MGI Symbol;Acc:MGI:109367])

HSP 1 Score: 380.948 bits (977), Expect = 4.290e-125
Identity = 191/273 (69.96%), Postives = 232/273 (84.98%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT+  D  R  ++  +G D++V+DSSQGNSI+QI+M K +K  YP+LQ+IGGNVVT  QAK+LIDAGVD LRVGMGSGSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQNVGHI KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  + SS  RYFSE DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +++  +Y+GEL+FEKRT+SAQVEGGVH+LHSYEKRLF
Sbjct:  242 KQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNSIFQINMIKYIKEKYPSLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF 514          

HSP 2 Score: 332.413 bits (851), Expect = 2.440e-106
Identity = 167/265 (63.02%), Postives = 212/265 (80.00%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LFN   GLTYNDF++LPGYIDF +++VD+T+ +TK + LKTPLVSSPMDTVTE+ MAIAMAL+GGIG +HHNCT + QANE+R+VKKYEQGFI DPVV+S  + V +V   K ++GF GIPITD G++G +LVG+++ RDIDFL +   D  + E+MT  E+L+ AP GV L EAN ILQRSKKGKLPI+NEN ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAA+GTH+DD  R  +L  AGVDVVV+ ++ G S
Sbjct:   16 DGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDRFLEEIMTKREDLVVAPAGVTLKEANEILQRSKKGKLPIVNENDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Mouse
Match: Impdh1 (inosine monophosphate dehydrogenase 1 [Source:MGI Symbol;Acc:MGI:96567])

HSP 1 Score: 380.563 bits (976), Expect = 6.319e-125
Identity = 191/273 (69.96%), Postives = 228/273 (83.52%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAAVGT   D  R  ++  +GAD+IV+DSSQGNS+YQI M   +K  YP+LQ+IGGNVVT  QAK+LIDAGVDGLRVGMG GSICITQEVMA GRPQ TAV+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  + SS  RYFSE DKVK+AQGVSG++ DKGS+ K +PYL+AGIQHG QD+G ++L  L+  +Y+GEL+FEKRT SAQ+EGGVH LHSYEKRL+
Sbjct:  242 KQLLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGAQSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY 514          

HSP 2 Score: 326.635 bits (836), Expect = 5.194e-104
Identity = 165/265 (62.26%), Postives = 210/265 (79.25%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTYNDF++LPG+IDF ++EVD+T+ +T+ + LKTPL+SSPMDTVTE++MAIAMAL GGIG +HHNCT + QANE+R+VKK+EQGFI DPVV+S  +TVG+V+  KI++GF+GIPIT  G +G KLVG+VT RDIDFL + +    +SEVMTP   L+ AP GV L EAN ILQRSKKGKLPI+N+  ELVA+I+RTDLKKNR+YPL+SKD  KQL  GAAVGT +DD  R  +L  AG DV+V+ ++ G S
Sbjct:   16 DGLTAQQLFANADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKIQHGFSGIPITATGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRVELVVAPAGVTLKEANEILQRSKKGKLPIVNDQDELVAIIARTDLKKNRDYPLASKDSHKQLLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Mouse
Match: Impdh1 (inosine monophosphate dehydrogenase 1 [Source:MGI Symbol;Acc:MGI:96567])

HSP 1 Score: 380.563 bits (976), Expect = 6.319e-125
Identity = 191/273 (69.96%), Postives = 228/273 (83.52%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAAVGT   D  R  ++  +GAD+IV+DSSQGNS+YQI M   +K  YP+LQ+IGGNVVT  QAK+LIDAGVDGLRVGMG GSICITQEVMA GRPQ TAV+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  + SS  RYFSE DKVK+AQGVSG++ DKGS+ K +PYL+AGIQHG QD+G ++L  L+  +Y+GEL+FEKRT SAQ+EGGVH LHSYEKRL+
Sbjct:  242 KQLLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGAQSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY 514          

HSP 2 Score: 326.635 bits (836), Expect = 5.194e-104
Identity = 165/265 (62.26%), Postives = 210/265 (79.25%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTYNDF++LPG+IDF ++EVD+T+ +T+ + LKTPL+SSPMDTVTE++MAIAMAL GGIG +HHNCT + QANE+R+VKK+EQGFI DPVV+S  +TVG+V+  KI++GF+GIPIT  G +G KLVG+VT RDIDFL + +    +SEVMTP   L+ AP GV L EAN ILQRSKKGKLPI+N+  ELVA+I+RTDLKKNR+YPL+SKD  KQL  GAAVGT +DD  R  +L  AG DV+V+ ++ G S
Sbjct:   16 DGLTAQQLFANADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKIQHGFSGIPITATGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRVELVVAPAGVTLKEANEILQRSKKGKLPIVNDQDELVAIIARTDLKKNRDYPLASKDSHKQLLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Mouse
Match: Impdh1 (inosine monophosphate dehydrogenase 1 [Source:MGI Symbol;Acc:MGI:96567])

HSP 1 Score: 380.563 bits (976), Expect = 6.319e-125
Identity = 191/273 (69.96%), Postives = 228/273 (83.52%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAAVGT   D  R  ++  +GAD+IV+DSSQGNS+YQI M   +K  YP+LQ+IGGNVVT  QAK+LIDAGVDGLRVGMG GSICITQEVMA GRPQ TAV+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  + SS  RYFSE DKVK+AQGVSG++ DKGS+ K +PYL+AGIQHG QD+G ++L  L+  +Y+GEL+FEKRT SAQ+EGGVH LHSYEKRL+
Sbjct:  242 KQLLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGAQSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY 514          

HSP 2 Score: 326.635 bits (836), Expect = 5.194e-104
Identity = 165/265 (62.26%), Postives = 210/265 (79.25%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTYNDF++LPG+IDF ++EVD+T+ +T+ + LKTPL+SSPMDTVTE++MAIAMAL GGIG +HHNCT + QANE+R+VKK+EQGFI DPVV+S  +TVG+V+  KI++GF+GIPIT  G +G KLVG+VT RDIDFL + +    +SEVMTP   L+ AP GV L EAN ILQRSKKGKLPI+N+  ELVA+I+RTDLKKNR+YPL+SKD  KQL  GAAVGT +DD  R  +L  AG DV+V+ ++ G S
Sbjct:   16 DGLTAQQLFANADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKIQHGFSGIPITATGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRVELVVAPAGVTLKEANEILQRSKKGKLPIVNDQDELVAIIARTDLKKNRDYPLASKDSHKQLLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|P12268|IMDH2_HUMAN (Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2)

HSP 1 Score: 384.03 bits (985), Expect = 2.368e-125
Identity = 192/273 (70.33%), Postives = 232/273 (84.98%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT+  D  R  ++  +G D++V+DSSQGNSI+QI+M K +K  YPNLQ+IGGNVVT  QAK+LIDAGVD LRVGMGSGSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQNVGHI KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  + SS  RYFSE DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +++  +Y+GEL+FEKRT+SAQVEGGVH+LHSYEKRLF
Sbjct:  242 KQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF 514          

HSP 2 Score: 332.028 bits (850), Expect = 2.402e-105
Identity = 165/265 (62.26%), Postives = 212/265 (80.00%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LFN   GLTYNDF++LPGYIDF +++VD+T+ +TK + LKTPLVSSPMDTVTE+ MAIAMAL+GGIG +HHNCT + QANE+R+VKKYEQGFI DPVV+S  + V +V   K ++GF GIPITD G++G +LVG+++ RDIDFL +   D  + E+MT  E+L+ AP G+ L EAN ILQRSKKGKLPI+NE+ ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAA+GTH+DD  R  +L  AGVDVVV+ ++ G S
Sbjct:   16 DGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|E9PU28|IMDH2_RAT (Inosine-5'-monophosphate dehydrogenase 2 OS=Rattus norvegicus OX=10116 GN=Impdh2 PE=1 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 1.034e-124
Identity = 192/273 (70.33%), Postives = 231/273 (84.62%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT+  D  R  ++  +G D++V+DSSQGNSI+QI+M K +K  YPNLQ+IGGNVVT  QAK+LIDAGVD LRVGMGSGSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQNVGHI KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  + SS  RYFSE DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +++  +Y+GEL+FEKRT+SAQVEGGVH LHSYEKRLF
Sbjct:  242 KQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNSIFQINMIKYIKEKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHGLHSYEKRLF 514          

HSP 2 Score: 330.487 bits (846), Expect = 9.841e-105
Identity = 166/265 (62.64%), Postives = 212/265 (80.00%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LFN   GLTYNDF++LPGYIDF +++VD+T+ +TK + LKTPLVSSPMDTVTE+ MAIAMAL+GGIG +HHNCT + QANE+R+VKKYEQGFI DPVV+S  + V +V   K ++GF GIPITD G++G +LVG+++ RDIDFL +   D  + E+MT  E+L+ AP GV L EAN ILQRSKKGKLPI+NE+ ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAA+GTH+DD  R  +L  AGVDVVV+ ++ G S
Sbjct:   16 DGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDRFLEEIMTKREDLVVAPAGVTLKEANEILQRSKKGKLPIVNESDELVAIIARTDLKKNRDYPLASKDTKKQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|P12269|IMDH2_CRIGR (Inosine-5'-monophosphate dehydrogenase 2 OS=Cricetulus griseus OX=10029 GN=IMPDH2 PE=1 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 1.507e-124
Identity = 191/273 (69.96%), Postives = 231/273 (84.62%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT+  D  R  ++  +G D++V+DSSQGNSI+QI+M K +K  YPNLQ+IGGNVVT  QAK+LIDAGVD LRVGMG GSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQNVGHI KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  + SS  RYFSE DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +++  +Y+GEL+FEKRT+SAQVEGGVH+LHSYEKRLF
Sbjct:  242 KQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNSIFQINMIKYMKEKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGCGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF 514          

HSP 2 Score: 332.028 bits (850), Expect = 2.790e-105
Identity = 166/265 (62.64%), Postives = 212/265 (80.00%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LFN   GLTYNDF++LPGYIDF +++VD+T+ +TK + LKTPLVSSPMDTVTE+ MAIAMAL+GGIG +HHNCT + QANE+R+VKKYEQGFI DPVV+S  + V +V   K ++GF GIPITD G++G +LVG+++ RDIDFL +   D  + E+MT  E+L+ AP G+ L EAN ILQRSKKGKLPI+NEN ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAA+GTH+DD  R  +L  AGVDVVV+ ++ G S
Sbjct:   16 DGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDRFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNENDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|P24547|IMDH2_MOUSE (Inosine-5'-monophosphate dehydrogenase 2 OS=Mus musculus OX=10090 GN=Impdh2 PE=1 SV=2)

HSP 1 Score: 380.948 bits (977), Expect = 3.001e-124
Identity = 191/273 (69.96%), Postives = 232/273 (84.98%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT+  D  R  ++  +G D++V+DSSQGNSI+QI+M K +K  YP+LQ+IGGNVVT  QAK+LIDAGVD LRVGMGSGSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQNVGHI KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  + SS  RYFSE DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +++  +Y+GEL+FEKRT+SAQVEGGVH+LHSYEKRLF
Sbjct:  242 KQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNSIFQINMIKYIKEKYPSLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF 514          

HSP 2 Score: 332.413 bits (851), Expect = 1.707e-105
Identity = 167/265 (63.02%), Postives = 212/265 (80.00%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LFN   GLTYNDF++LPGYIDF +++VD+T+ +TK + LKTPLVSSPMDTVTE+ MAIAMAL+GGIG +HHNCT + QANE+R+VKKYEQGFI DPVV+S  + V +V   K ++GF GIPITD G++G +LVG+++ RDIDFL +   D  + E+MT  E+L+ AP GV L EAN ILQRSKKGKLPI+NEN ELVA+I+RTDLKKNR+YPL+SKD +KQL  GAA+GTH+DD  R  +L  AGVDVVV+ ++ G S
Sbjct:   16 DGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDRFLEEIMTKREDLVVAPAGVTLKEANEILQRSKKGKLPIVNENDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|A0JNA3|IMDH1_BOVIN (Inosine-5'-monophosphate dehydrogenase 1 OS=Bos taurus OX=9913 GN=IMPDH1 PE=2 SV=2)

HSP 1 Score: 380.563 bits (976), Expect = 4.326e-124
Identity = 191/273 (69.96%), Postives = 228/273 (83.52%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAAVGT   D  R  ++  +GAD+IV+DSSQGNS+YQI M   +K  YP+LQ+IGGNVVT  QAK+LIDAGVDGLRVGMG GSICITQEVMA GRPQ TAV+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  + SS  RYFSE DKVK+AQGVSG++ DKGS+ K +PYL+AGIQHG QD+G ++L  L+  +Y+GEL+FEKRT SAQ+EGGVH LHSYEKRL+
Sbjct:  242 KQLLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY 514          

HSP 2 Score: 328.561 bits (841), Expect = 5.151e-104
Identity = 165/265 (62.26%), Postives = 211/265 (79.62%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTYNDF++LPG+IDF ++EVD+T+ +T+ + LKTPL+SSPMDTVTE++MAIAMAL GGIG +HHNCT + QANE+R+VKK+EQGFI DPVV+S  +TVG+V+  KI++GF+GIPIT+ G +G KLVG+VT RDIDFL + +    +SEVMTP   L+ AP GV L EAN ILQRSKKGKLPI+N+  ELVA+I+RTDLKKNR+YPL+SKD  KQL  GAAVGT +DD  R  +L  AG DV+V+ ++ G S
Sbjct:   16 DGLTAQQLFANADGLTYNDFLILPGFIDFTADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKIRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRNELVVAPAGVTLKEANEILQRSKKGKLPIVNDRDELVAIIARTDLKKNRDYPLASKDSHKQLLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. TrEMBL
Match: A0A1I8HSL6 (Inosine-5'-monophosphate dehydrogenase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 0.000e+0
Identity = 188/302 (62.25%), Postives = 238/302 (78.81%), Query Frame = 2
Query:  860 LMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTA------------------------NQSSAV-------RYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            L+VGAA+GT+  D+ R S ++ +G D++V+DSSQGNSIYQIDM   LK+ +P+LQI+GGNVVT  QAK+LIDAGVD LRVGMGSGSICITQEVMAVGRPQATAV+KV+EYARR+ +P+IADGGIQ+VGH+ KAL LGAS  MMG MLAG++EAPGEYFF+DGVRLKKYRGMGSL+AM                           +  AV       RY+ E+D+V+VAQGVSGN++DKGSV++L PYL+AG+QH  QD+G K+L E++ ++Y+G+L+FE+RT S+Q+EGGVH+LHSYEKRLF
Sbjct:  283 LLVGAAIGTHEDDFARLSALVSAGVDVVVLDSSQGNSIYQIDMIHRLKSAHPDLQIVGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVMAVGRPQATAVYKVAEYARRFSVPVIADGGIQSVGHVTKALALGASTVMMGSMLAGSTEAPGEYFFADGVRLKKYRGMGSLDAMETGGAAGGAVAGSGGVAGGGNAAAVGGRPPAVVASAGQQRYYYESDRVRVAQGVSGNIVDKGSVLQLAPYLIAGLQHACQDIGAKSLAEMRSRMYSGQLKFERRTASSQIEGGVHSLHSYEKRLF 584          

HSP 2 Score: 326.25 bits (835), Expect = 0.000e+0
Identity = 168/260 (64.62%), Postives = 210/260 (80.77%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLI--DAGVDVVVM 852
            DG S  ELFN   GLTYND I+LPG+IDF +  VD+T+ +TK + +KTP VSSPMDTVTESNMAIA+ALSGGIG++HHNCT++ QANEIR+VK+Y+QGFIVDP V+  D+TV +V+  K ++GF+GIPITD+G++ GKLVGLVT RD DFLP+S     V+EVMTP   LITAP GV+L +A+ +LQ+SKKGKLPI++ +  LVALI+RTDLKKNREYPLSSKDD+ +L VGAAV TH   C+R KVL+  DA  DVVV+
Sbjct:   23 DGISGRELFNNGDGLTYNDLIILPGFIDFPASIVDLTSPLTKTLSMKTPFVSSPMDTVTESNMAIALALSGGIGVVHHNCTLEFQANEIRKVKRYKQGFIVDPFVLRPDSTVADVVRAKAQHGFSGIPITDSGRINGKLVGLVTFRDFDFLPESEHGRPVAEVMTPRSELITAPAGVSLSKAHEVLQKSKKGKLPIVDSDDNLVALIARTDLKKNREYPLSSKDDKSRLLVGAAVSTHSSGCDRLKVLMQADAQPDVVVL 282          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. TrEMBL
Match: A0A1I8I1M0 (Inosine-5'-monophosphate dehydrogenase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 0.000e+0
Identity = 186/303 (61.39%), Postives = 237/303 (78.22%), Query Frame = 2
Query:  860 LMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAV--------------------------------RYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            L+VGAA+GT+  D+ R S ++ +G D++V+DSSQGNSIYQIDM   LK+ +P+LQI+GGNVVT  QAK+LIDAGVD LRVGMGSGSICITQEVMAVGRPQATAV+KV+EYARR+ +P+IADGGIQ+VGH+ KAL LGAS  MMG MLAG++EAPGEYFF+DGVRLKKYRGMGSL+AM    ++                                  RY+ E+D+V+VAQGVSGN++DKGSV++L PYL+AG+QH  QD+G K+L E++ ++Y+G+L+FE+RT S+Q+EGGVH+LHSYEKRLF
Sbjct:  283 LLVGAAIGTHEDDFARLSALVSAGVDVVVLDSSQGNSIYQIDMIHRLKSAHPDLQIVGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVMAVGRPQATAVYKVAEYARRFSVPVIADGGIQSVGHVTKALALGASTVMMGSMLAGSTEAPGEYFFADGVRLKKYRGMGSLDAMETGGAAGGAVAGSGGVTGGGNAAAVGGGPPAVVVASAGQQRYYYESDRVRVAQGVSGNIVDKGSVLQLAPYLIAGLQHACQDIGAKSLAEMRSRMYSGQLKFERRTASSQIEGGVHSLHSYEKRLF 585          

HSP 2 Score: 324.324 bits (830), Expect = 0.000e+0
Identity = 168/260 (64.62%), Postives = 209/260 (80.38%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLI--DAGVDVVVM 852
            DG S  ELFN   GLTYND I+LPG+IDF +  VD+T+ +TK + +KTP VSSPMDTVTESNMAIA+ALSGGIG++HHNCT + QANEIR+VK+Y+QGFIVDP V+  D+TV +V+  K ++GF+GIPITD+G++ GKLVGLVT RD DFLP+S     V+EVMTP   LITAP GV+L +A+ +LQ+SKKGKLPI++ +  LVALI+RTDLKKNREYPLSSKDD+ +L VGAAV TH   C+R KVL+  DA  DVVV+
Sbjct:   23 DGISGRELFNNGDGLTYNDLIILPGFIDFPASIVDLTSPLTKTLSMKTPFVSSPMDTVTESNMAIALALSGGIGVVHHNCTPEFQANEIRKVKRYKQGFIVDPFVLRPDSTVADVVRAKAQHGFSGIPITDSGRINGKLVGLVTFRDFDFLPESEHGRPVAEVMTPRSELITAPAGVSLSKAHEVLQKSKKGKLPIVDSDDNLVALIARTDLKKNREYPLSSKDDKSRLLVGAAVSTHSSGCDRLKVLMQADAQPDVVVL 282          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. TrEMBL
Match: A0A183SHZ6 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS3844 PE=4 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.105e-150
Identity = 172/273 (63.00%), Postives = 227/273 (83.15%), Query Frame = 2
Query:  860 LMVGAAVGTNLSDYDR--ASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            L++  A     ++  R  + ++  +  D++++DSSQGNSI+Q++M KN+K+ YP++++I GNVVT  QAK+LIDAG D LRVGMGSGSICITQEV AVGR QATAV+ V+++A+RY++P+IADGGI   GHIVKAL LGAS+ MMG +LAGT+EAPGEYFFS+GVRLKKYRGMGSL+AM+AN SS +RYFSE D+VKVAQGVSGN++D+GS+ +L+PYL+AG+QHG+Q +G K+L +L  ++ +GELRFE+R+  AQVEG VH LHSYEKRLF
Sbjct:  263 LLIACASAEVFAEQSRRVSELLTKTSLDVLLLDSSQGNSIFQLNMLKNIKSAYPHIEVIAGNVVTCAQAKNLIDAGADALRVGMGSGSICITQEVTAVGRSQATAVYTVADFAKRYNVPVIADGGISTAGHIVKALSLGASSVMMGALLAGTTEAPGEYFFSNGVRLKKYRGMGSLDAMSANPSSQMRYFSETDRVKVAQGVSGNIVDRGSIHQLVPYLMAGVQHGMQQIGAKSLSQLWHQMESGELRFERRSVCAQVEGSVHGLHSYEKRLF 535          

HSP 2 Score: 219.55 bits (558), Expect = 1.105e-150
Identity = 133/277 (48.01%), Postives = 172/277 (62.09%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSN---WDLKVSEVMTPFENLITAPY----------------GVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVM 852
            DG SA ELF++ +G+TY+DFI+LPGY+DF + +V+++TR+T+N+ +K P VSSPMDTVTE+NMAIAM                          KYEQGFI+DP+V+  D+TV +V  I+  +GF+GIPIT  GK+GG+L+GLVTLRDIDFLP+ +     L      T     I A Y                             S  GKLPI+NEN ELVALISRTDLKKN ++PLSSKD+RK+L VG AV TH D  ERA  L  AGVD++++
Sbjct:   12 DGLSAKELFSENSGITYSDFIILPGYLDFMASDVNLSTRLTRNINIKLPFVSSPMDTVTEANMAIAMG-------------------------KYEQGFILDPIVLGPDDTVDDVNRIRADHGFSGIPITSTGKIGGRLLGLVTLRDIDFLPEESRHCRSLSSQRSQTYLSRSINAVYISHNLCACWLVPCSSIISRSSLLTRFPTVSNSGKLPIVNENNELVALISRTDLKKNTQHPLSSKDERKRLMVGGAVSTHADGLERAVALEQAGVDILLL 263          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. TrEMBL
Match: A0A1I8C567 (Inosine-5'-monophosphate dehydrogenase OS=Rhabditophanes sp. KR3021 OX=114890 PE=3 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 6.672e-133
Identity = 158/287 (55.05%), Postives = 199/287 (69.34%), Query Frame = 2
Query:  848 LWRQLMVGAAVGTNLSDYDRASMIIHSGAD----------------LIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFF-SDGVRLKKYRGMGSLEAMTANQSSAVRYF-SENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHS 1654
            LW Q++ G     N+    +A M+I  GAD                +  +  +QG ++Y    T      +P  QI+ GNVVT +QAK LID G D LRVGMGSGSICITQEV AVGR Q TAV+ VS YAR   IP+IADGGI++VG+I KAL LGAS+ MMGG+LAGT+EAPGEYF+   GVRLKKYRGMGSL+AM A+  S  RYF +E+D VK+AQGVS  M D+GS+ K +PYL  G+QHG QD+GVK++ EL+ K Y+GE+ FE+R+ SAQ EGGVH+L+S
Sbjct:  319 LWPQIVAG-----NVVTMKQAKMLIDVGADALRVGMGSGSICITQEVCAVGRAQGTAVYNAFGT----XLWP--QIVAGNVVTMKQAKMLIDVGADALRVGMGSGSICITQEVCAVGRAQGTAVYNVSRYARSRGIPVIADGGIRDVGYITKALALGASSVMMGGLLAGTNEAPGEYFWGPSGVRLKKYRGMGSLDAMEAHSVSQDRYFTTESDTVKIAQGVSATMRDRGSIHKYVPYLFRGVQHGFQDIGVKSITELQMKAYSGEIHFERRSPSAQTEGGVHSLYS 594          

HSP 2 Score: 243.432 bits (620), Expect = 6.672e-133
Identity = 131/268 (48.88%), Postives = 189/268 (70.52%), Query Frame = 1
Query:   76 YDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHN-CTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLK-VSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            +DG +  +LF+   GLTYND  +LPG+IDF  ++V++   +TK++ LK+P +SSPMDTVTE+ MAIAMAL GGIG++H N  T   Q +E+ +VK+Y+QGFI +P  +   +T+ ++M+IK+K GFTG P+TD G +GGK +GLVT RDIDF+ ++ +    + +VM P E LIT    + + EA  IL++ KKGKLPI+N   ELVALI+RTDLKK R++PLSS D   +L+VGAA+ T     +    L  AGVDV+++ +++G S
Sbjct:   36 HDGLTIKQLFSDNVGLTYNDINILPGFIDFGVKDVNLDAHLTKHIELKSPFISSPMDTVTEAEMAIAMALHGGIGVIHGNFATPQDQVSEVLKVKRYKQGFITEPQCIKPTDTIKDLMDIKVKYGFTGTPVTDTGNVGGKFLGLVTSRDIDFIKEAVYQTTFIHDVMIPSERLITGDEHLKIEEAYDILEKEKKGKLPIVNSKGELVALIARTDLKKARDFPLSSYDHIGRLRVGAAISTRPGSIDHVHKLAKAGVDVIIIDSSNGSS 303          

HSP 3 Score: 123.635 bits (309), Expect = 8.939e-26
Identity = 62/107 (57.94%), Postives = 78/107 (72.90%), Query Frame = 2
Query:  857 QLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNL-QIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVF 1174
            +L VGAA+ T     D    +  +G D+I+IDSS G+S+YQ+D+ K++K +YP   QI+ GNVVT +QAK LID G D LRVGMGSGSICITQEV AVGR Q TAV+
Sbjct:  266 RLRVGAAISTRPGSIDHVHKLAKAGVDVIIIDSSNGSSMYQVDLLKDIKKSYPLWPQIVAGNVVTMKQAKMLIDVGADALRVGMGSGSICITQEVCAVGRAQGTAVY 372          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. TrEMBL
Match: A7RG06 (Inosine-5'-monophosphate dehydrogenase OS=Nematostella vectensis OX=45351 GN=v1g177384 PE=3 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 3.097e-128
Identity = 198/273 (72.53%), Postives = 234/273 (85.71%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+VGAA+GT   D  R   ++ +G D++VIDSSQGNSIYQ+ +  ++K NYPNLQI+GGNVVT  QAK+LIDAGVD LRVGMGSGSICITQEVMAVGRPQ TAV+KV+EYARR+ +P++ADGGIQNVGHI KAL LGAS  MMG +LAGTSEAPGEYFF+DGVRLKKYRGMGSL AM  N SSA RYFSENDKVKVAQGVSG+++DKGS+ K +PYL AGIQHG QD+G K+L  L+  +Y+GEL+FE+RTTS+Q+EGGVH LHSYEKRLF
Sbjct:  242 KQLLVGAAIGTREDDKARLHALVEAGVDVVVIDSSQGNSIYQLSLISHIKENYPNLQIVGGNVVTASQAKNLIDAGVDALRVGMGSGSICITQEVMAVGRPQGTAVYKVAEYARRFGVPVLADGGIQNVGHITKALSLGASTVMMGSLLAGTSEAPGEYFFADGVRLKKYRGMGSLSAMEKNSSSASRYFSENDKVKVAQGVSGSVVDKGSIHKFVPYLTAGIQHGCQDLGAKSLTSLRSMMYSGELKFERRTTSSQIEGGVHGLHSYEKRLF 514          

HSP 2 Score: 315.464 bits (807), Expect = 2.133e-96
Identity = 162/265 (61.13%), Postives = 214/265 (80.75%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF +  GLTY+DFI+LPG+IDF + +VD+T+ +T+ + +KTPLVSSPMDTVTES +A AMAL+GGIGI+HHNC+I+ QANEIR+VKK+EQGFI+ P+V+S  NTV +V++ K ++GF+GIPIT+NG+LGG L G+VT RDIDFL       ++ EVMT  E+L+ A  G+ L+EAN ILQ SKKGKLPI+NE  ELV+LI+RTDLKKNR+YPL+SKD+ KQL VGAA+GT +DD  R   L++AGVDVVV+ ++ G S
Sbjct:   17 DGMTAGQLF-QSDGLTYSDFIILPGFIDFPATDVDLTSPLTRRITIKTPLVSSPMDTVTESALATAMALNGGIGIIHHNCSIEFQANEIRKVKKFEQGFIMAPLVLSATNTVADVIDAKQRHGFSGIPITENGQLGGILQGIVTSRDIDFLHGVENHKQLGEVMTRLEDLVVAKAGITLNEANKILQMSKKGKLPIVNEKGELVSLIARTDLKKNRDYPLASKDENKQLLVGAAIGTREDDKARLHALVEAGVDVVVIDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Cavefish
Match: impdh1b (inosine-5'-monophosphate dehydrogenase 1b [Source:NCBI gene;Acc:103043802])

HSP 1 Score: 374.785 bits (961), Expect = 8.119e-123
Identity = 188/273 (68.86%), Postives = 227/273 (83.15%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT   D  R  +++ SG D++V+DSSQGNS+YQI+M   +K  +P LQ++GGNVVT  QAK+LIDAGVD LRVGMG GSICITQEVMA GRPQ T+V+KV+EYARR+ +P+IADGGIQ VGHIVKAL LGAS  MMG +LA T+EAPGEY+FSDGVRLKKYRGMGSL+AM  + SS  RYFSE DKVKVAQGVSG++ DKGS+ K +PYL+AGIQHG QD+G K+L  L+  +Y+GEL+FEKRT SAQVEGGVH LHSYEKRL+
Sbjct:  242 KQLLCGAAIGTREDDKYRLDLLVQSGVDMVVLDSSQGNSVYQINMIHYIKQKHPELQVVGGNVVTAAQAKNLIDAGVDALRVGMGCGSICITQEVMACGRPQGTSVYKVAEYARRFGVPVIADGGIQTVGHIVKALSLGASTVMMGSLLAATTEAPGEYYFSDGVRLKKYRGMGSLDAMEKSTSSQKRYFSEGDKVKVAQGVSGSVQDKGSIHKFVPYLIAGIQHGCQDIGAKSLSLLRSMMYSGELKFEKRTMSAQVEGGVHGLHSYEKRLY 514          

HSP 2 Score: 333.569 bits (854), Expect = 9.069e-107
Identity = 167/265 (63.02%), Postives = 217/265 (81.89%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG SA +LF+   GLTYNDF++LPG+IDF S+EVD+T+ +T+ + LKTPL+SSPMDTVTES+MAIAMAL GGIGI+HHNCT + QANE+R+VK++EQGFI DPVVMS  +TVG+V   K+++GF+GIPIT+ GK+G KLVG+VT RDIDFL + + +  + E MT  ++L+ AP GV L EAN ILQRSKKGKLPI+N+N ELVA+I+RTDLKKNR+YPL+SKD RKQL  GAA+GT +DD  R  +L+ +GVD+VV+ ++ G S
Sbjct:   16 DGLSAQQLFSVGDGLTYNDFLILPGFIDFTSDEVDLTSALTRKITLKTPLISSPMDTVTESSMAIAMALMGGIGIIHHNCTPEFQANEVRKVKRFEQGFITDPVVMSPQHTVGDVFQAKVRHGFSGIPITETGKMGSKLVGIVTSRDIDFLSEKDHNRSLEEAMTKRDDLVIAPAGVTLKEANDILQRSKKGKLPIVNDNDELVAIIARTDLKKNRDYPLASKDSRKQLLCGAAIGTREDDKYRLDLLVQSGVDMVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Cavefish
Match: impdh1b (inosine-5'-monophosphate dehydrogenase 1b [Source:NCBI gene;Acc:103043802])

HSP 1 Score: 374.4 bits (960), Expect = 2.511e-121
Identity = 188/273 (68.86%), Postives = 227/273 (83.15%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT   D  R  +++ SG D++V+DSSQGNS+YQI+M   +K  +P LQ++GGNVVT  QAK+LIDAGVD LRVGMG GSICITQEVMA GRPQ T+V+KV+EYARR+ +P+IADGGIQ VGHIVKAL LGAS  MMG +LA T+EAPGEY+FSDGVRLKKYRGMGSL+AM  + SS  RYFSE DKVKVAQGVSG++ DKGS+ K +PYL+AGIQHG QD+G K+L  L+  +Y+GEL+FEKRT SAQVEGGVH LHSYEKRL+
Sbjct:  337 KQLLCGAAIGTREDDKYRLDLLVQSGVDMVVLDSSQGNSVYQINMIHYIKQKHPELQVVGGNVVTAAQAKNLIDAGVDALRVGMGCGSICITQEVMACGRPQGTSVYKVAEYARRFGVPVIADGGIQTVGHIVKALSLGASTVMMGSLLAATTEAPGEYYFSDGVRLKKYRGMGSLDAMEKSTSSQKRYFSEGDKVKVAQGVSGSVQDKGSIHKFVPYLIAGIQHGCQDIGAKSLSLLRSMMYSGELKFEKRTMSAQVEGGVHGLHSYEKRLY 609          

HSP 2 Score: 330.872 bits (847), Expect = 1.119e-104
Identity = 167/265 (63.02%), Postives = 217/265 (81.89%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A EL +K  GLTYNDF++LPG+IDF S+EVD+T+ +T+ + LKTPL+SSPMDTVTES+MAIAMAL GGIGI+HHNCT + QANE+R+VK++EQGFI DPVVMS  +TVG+V   K+++GF+GIPIT+ GK+G KLVG+VT RDIDFL + + +  + E MT  ++L+ AP GV L EAN ILQRSKKGKLPI+N+N ELVA+I+RTDLKKNR+YPL+SKD RKQL  GAA+GT +DD  R  +L+ +GVD+VV+ ++ G S
Sbjct:  111 DGLTAEELCSKGDGLTYNDFLILPGFIDFTSDEVDLTSALTRKITLKTPLISSPMDTVTESSMAIAMALMGGIGIIHHNCTPEFQANEVRKVKRFEQGFITDPVVMSPQHTVGDVFQAKVRHGFSGIPITETGKMGSKLVGIVTSRDIDFLSEKDHNRSLEEAMTKRDDLVIAPAGVTLKEANDILQRSKKGKLPIVNDNDELVAIIARTDLKKNRDYPLASKDSRKQLLCGAAIGTREDDKYRLDLLVQSGVDMVVLDSSQGNS 375          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Cavefish
Match: impdh1a (inosine-5'-monophosphate dehydrogenase 1a [Source:NCBI gene;Acc:103030146])

HSP 1 Score: 370.548 bits (950), Expect = 3.359e-121
Identity = 187/273 (68.50%), Postives = 226/273 (82.78%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT   D  R  +++ +G D++V+DSSQGNS+++I M   +K  YP LQ++GGNVVT  QAK+LIDAGVD LRVGMG GSICITQEVMA GRPQ T+V+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  N SS  RYFSE DKVKVAQGVSG++ DKGS+ K +PYL+AGIQHG QD+G K+L  L+  +Y+GEL+FEKRT SAQVEGGVH LHSYEKRL+
Sbjct:  232 KQLLCGAAIGTREDDKYRLDLLMQAGVDVVVLDSSQGNSVFEISMINYIKQKYPELQVVGGNVVTAAQAKNLIDAGVDALRVGMGCGSICITQEVMACGRPQGTSVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAM-ENSSSQKRYFSEGDKVKVAQGVSGSVQDKGSIHKFVPYLIAGIQHGCQDIGAKSLSILRSMMYSGELKFEKRTMSAQVEGGVHGLHSYEKRLY 503          

HSP 2 Score: 292.352 bits (747), Expect = 4.525e-91
Identity = 159/265 (60.00%), Postives = 205/265 (77.36%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF+       +D     GY+ F   + D+T+ +T+ + LKTPL+SSPMDTVTES+MAIAMAL GGIGI+HHNCT + QANE+R+VKK+EQGFI DPVVMS  +TVG+V   KI++GF+GIPIT+ GK+G KLVG+VT RDIDFL + ++D  + E MT  E+L+ AP GV L EAN ILQRSKKGKLPI+N++ ELVA+I+RTDLKKNR+YPL+SKD RKQL  GAA+GT +DD  R  +L+ AGVDVVV+ ++ G S
Sbjct:   16 DGLTAQQLFS-----IGDD----NGYLFFDITQ-DLTSALTRKITLKTPLISSPMDTVTESSMAIAMALMGGIGIIHHNCTPEFQANEVRKVKKFEQGFITDPVVMSPRHTVGDVFEAKIRHGFSGIPITETGKMGSKLVGIVTSRDIDFLSEKDYDRPLEEAMTKREDLVVAPAGVTLKEANDILQRSKKGKLPIVNDSDELVAIIARTDLKKNRDYPLASKDSRKQLLCGAAIGTREDDKYRLDLLMQAGVDVVVLDSSQGNS 270          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Cavefish
Match: impdh1a (inosine-5'-monophosphate dehydrogenase 1a [Source:NCBI gene;Acc:103030146])

HSP 1 Score: 369.007 bits (946), Expect = 1.509e-119
Identity = 187/273 (68.50%), Postives = 226/273 (82.78%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT   D  R  +++ +G D++V+DSSQGNS+++I M   +K  YP LQ++GGNVVT  QAK+LIDAGVD LRVGMG GSICITQEVMA GRPQ T+V+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  N SS  RYFSE DKVKVAQGVSG++ DKGS+ K +PYL+AGIQHG QD+G K+L  L+  +Y+GEL+FEKRT SAQVEGGVH LHSYEKRL+
Sbjct:  323 KQLLCGAAIGTREDDKYRLDLLMQAGVDVVVLDSSQGNSVFEISMINYIKQKYPELQVVGGNVVTAAQAKNLIDAGVDALRVGMGCGSICITQEVMACGRPQGTSVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAM-ENSSSQKRYFSEGDKVKVAQGVSGSVQDKGSIHKFVPYLIAGIQHGCQDIGAKSLSILRSMMYSGELKFEKRTMSAQVEGGVHGLHSYEKRLY 594          

HSP 2 Score: 336.65 bits (862), Expect = 5.159e-107
Identity = 171/265 (64.53%), Postives = 218/265 (82.26%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF+   GLTYNDF++LPG+IDF S+EVD+T+ +T+ + LKTPL+SSPMDTVTES+MAIAMAL GGIGI+HHNCT + QANE+R+VKK+EQGFI DPVVMS  +TVG+V   KI++GF+GIPIT+ GK+G KLVG+VT RDIDFL + ++D  + E MT  E+L+ AP GV L EAN ILQRSKKGKLPI+N++ ELVA+I+RTDLKKNR+YPL+SKD RKQL  GAA+GT +DD  R  +L+ AGVDVVV+ ++ G S
Sbjct:   97 DGLTAQQLFSIGDGLTYNDFLILPGFIDFTSDEVDLTSALTRKITLKTPLISSPMDTVTESSMAIAMALMGGIGIIHHNCTPEFQANEVRKVKKFEQGFITDPVVMSPRHTVGDVFEAKIRHGFSGIPITETGKMGSKLVGIVTSRDIDFLSEKDYDRPLEEAMTKREDLVVAPAGVTLKEANDILQRSKKGKLPIVNDSDELVAIIARTDLKKNRDYPLASKDSRKQLLCGAAIGTREDDKYRLDLLMQAGVDVVVLDSSQGNS 361          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Cavefish
Match: impdh2 (inosine monophosphate dehydrogenase 2 [Source:NCBI gene;Acc:103033376])

HSP 1 Score: 369.392 bits (947), Expect = 3.323e-119
Identity = 190/293 (64.85%), Postives = 231/293 (78.84%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF*SLETKLANFTAKNCFQLCL 1732
            +QL+ GAA+GT+  D  R  +++ +G D++V+DSSQGNSI+QI+M K +K  YPNLQ++GGNVVT  QAK+LIDAG D LRVGMGSGSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQ VGHI KAL L AS  MMG +LA TSEAPGEYFFSDG+RLKKYRGMGSL+AM  N  S  RYFSE+DK+KVAQGVSG + DKGSV K +PYL AGIQH  QD+G K+L +L+  +Y+G+L+FEKRT SAQ+EGGVH+LH Y   L+ +L     N  A N   L L
Sbjct:  230 KQLLCGAAIGTHNDDKYRLDLLVQAGVDVVVLDSSQGNSIFQINMIKYIKEKYPNLQVVGGNVVTAAQAKNLIDAGADALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQTVGHIAKALALRASTVMMGSLLAATSEAPGEYFFSDGIRLKKYRGMGSLDAMDKNLGSQTRYFSESDKIKVAQGVSGAVQDKGSVHKFVPYLHAGIQHSCQDIGAKSLTQLRAMMYSGDLKFEKRTLSAQMEGGVHSLHRYALNLY-ALNLYTLNLYALNQHALNL 521          

HSP 2 Score: 326.25 bits (835), Expect = 9.818e-103
Identity = 165/252 (65.48%), Postives = 204/252 (80.95%), Query Frame = 1
Query:  118 GLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            GLTYNDF++LPGYIDF S++VD+T+ +TK + LKTPLVSSPMDTVTES MAIAMAL+GGIG +HHNCT + QANE+R+VK+YEQGFI DPVVMS    V +V   K ++GF GIPITDNG++GG+LVG+++ RDIDFL     DL +SEVMT  E+L+ AP GV L EAN ILQRSKKGKLPI+N+   LVA+I+RTDLKKNR++PL+SKD RKQL  GAA+GTH DD  R  +L+ AGVDVVV+ ++ G S
Sbjct:   17 GLTYNDFLILPGYIDFTSDQVDLTSALTKQITLKTPLVSSPMDTVTESGMAIAMALTGGIGFMHHNCTPEFQANEVRKVKRYEQGFITDPVVMSPREQVRDVFQAKARHGFCGIPITDNGQMGGRLVGIISSRDIDFLKGEEHDLPLSEVMTKREDLVVAPAGVTLKEANEILQRSKKGKLPIVNKEGCLVAIIARTDLKKNRDFPLASKDSRKQLLCGAAIGTHNDDKYRLDLLVQAGVDVVVLDSSQGNS 268          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Sea Lamprey
Match: impdh1a (IMP (inosine 5'-monophosphate) dehydrogenase 1a [Source:NCBI gene;Acc:431724])

HSP 1 Score: 280.796 bits (717), Expect = 5.748e-90
Identity = 142/231 (61.47%), Postives = 188/231 (81.39%), Query Frame = 1
Query:  181 DITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            D+T+ +TK + LKTPLVSSPMDTVTES+MAIAMAL GGIG +HHNCT ++QA+E+ +VKKYEQGFI DPVV+S  +TVG+V+  K ++GF+GIPIT+ G++GG+L G++T RDIDFL + +  + + +VMT  E+L+ AP+GV L EAN ILQRSKKGKLPI+NE  ELVA+++RTDLKKNR++PL+SKD  KQL  GAAVGT  DD  R ++L+ AGVDVV++ ++ G S
Sbjct:    1 DLTSALTKKITLKTPLVSSPMDTVTESDMAIAMALMGGIGFIHHNCTPESQAHEVHQVKKYEQGFITDPVVLSPAHTVGDVLEAKARHGFSGIPITETGRMGGRLAGVITSRDIDFLTEKDHGIPLHQVMTRKEDLVVAPFGVTLKEANDILQRSKKGKLPIVNEAGELVAIMARTDLKKNRDFPLASKDAHKQLLCGAAVGTRPDDQHRLELLVKAGVDVVILDSSQGNS 231          

HSP 2 Score: 129.798 bits (325), Expect = 1.157e-33
Identity = 58/95 (61.05%), Postives = 76/95 (80.00%), Query Frame = 2
Query:  851 WRQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQE 1135
             +QL+ GAAVGT   D  R  +++ +G D++++DSSQGNS++QI+M + +K  YP LQ+IGGNVVT  QAK+LIDAGVD LRVGMG+GSICITQE
Sbjct:  192 HKQLLCGAAVGTRPDDQHRLELLVKAGVDVVILDSSQGNSVFQINMIRYIKQTYPELQVIGGNVVTAAQAKNLIDAGVDALRVGMGAGSICITQE 286          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Sea Lamprey
Match: gmpr (guanosine monophosphate reductase [Source:ZFIN;Acc:ZDB-GENE-050522-48])

HSP 1 Score: 55.0694 bits (131), Expect = 4.611e-9
Identity = 54/172 (31.40%), Postives = 84/172 (48.84%), Query Frame = 2
Query: 1061 KSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEK 1576
            + L+ AG D ++VG+G GS+C T+    VG PQ +AV +  + A      II+DGG    G + KA   GA   M+GGMLAG  ++ G     DG ++K + GM S  AM         Y       + ++G S  +  +G V   +  ++ G++     +G   L EL  +
Sbjct:    3 EELLLAGADIIKVGIGPGSVCTTRTKTGVGYPQLSAVLECGDAAHGLGGHIISDGGCTCPGDVAKAFGAGADFVMLGGMLAGHIQSGGTLTERDGKQVKTFYGMSSGTAMEKYAGGVAEY-------RASEGKSVEVPYRGDVSDTVRDILGGVRSTCTYVGAAKLKELSRR 167          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Yeast
Match: IMD4 (Inosine monophosphate dehydrogenase; catalyzes the rate-limiting step in the de novo synthesis of GTP; member of a four-gene family in S. cerevisiae, constitutively expressed; IMD4 has a paralog, IMD3, that arose from the whole genome duplication [Source:SGD;Acc:S000004520])

HSP 1 Score: 337.035 bits (863), Expect = 6.125e-109
Identity = 168/277 (60.65%), Postives = 223/277 (80.51%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAM--TANQ--SSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT  +D +R  +++ +G D++++DSSQGNS++Q++M K +K  +P+L+II GNV T++QA +LI AG DGLR+GMGSGSICITQEVMA GRPQ TAV+ V ++A ++ +P +ADGG+QN+GHI KAL LG+S  MMGGMLAGT+E+PGEYF+ DG RLK YRGMGS++AM  T N+  +S  RYFSE+D V VAQGVSG ++DKGS+ K +PYL  G+QH  QD+G ++L  LKE + NGE+RFE RT SAQ+EGGVHNLHSYEKRL+
Sbjct:  247 KQLLCGAAIGTIEADKERLRLLVEAGLDVVILDSSQGNSVFQLNMIKWIKETFPDLEIIAGNVATREQAANLIAAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVCQFANQFGVPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTESPGEYFYKDGKRLKAYRGMGSIDAMQKTGNKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDIGCESLTSLKENVQNGEVRFEFRTASAQLEGGVHNLHSYEKRLY 523          

HSP 2 Score: 245.743 bits (626), Expect = 3.689e-74
Identity = 142/268 (52.99%), Postives = 192/268 (71.64%), Query Frame = 1
Query:   79 DGFSASELFNKKT--GLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKD-DRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG S  EL +  T  GLTYNDF++LPG ++F S  V + T++TK + L TP VSSPMDTVTE++MAI MAL GGIG +HHNCT   QA+ +++VK +E GFI  P+V+S   TVGEV  +K K GF+G P+T++GK  GKLVGLVT RDI FL   +  L VSEVMT  +N +T   G+ L E N IL+++KKGKL I+++N  LV+++SR DL KN+ YPL+SK    KQL  GAA+GT + D ER ++L++AG+DVV++ ++ G S
Sbjct:   22 DGLSVQELMDSTTRGGLTYNDFLVLPGLVNFPSSAVSLQTKLTKKITLNTPFVSSPMDTVTEADMAIYMALLGGIGFIHHNCTPKEQASMVKKVKMFENGFINSPIVISPTTTVGEVKVMKRKFGFSGFPVTEDGKCPGKLVGLVTSRDIQFLEDDS--LVVSEVMT--KNPVTGIKGITLKEGNEILKQTKKGKLLIVDDNGNLVSMLSRADLMKNQNYPLASKSATTKQLLCGAAIGTIEADKERLRLLVEAGLDVVILDSSQGNS 285          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Yeast
Match: IMD3 (Inosine monophosphate dehydrogenase; catalyzes the rate-limiting step in the de novo synthesis of GTP; member of a four-gene family in S. cerevisiae, constitutively expressed; IMD3 has a paralog, IMD4, that arose from the whole genome duplication [Source:SGD;Acc:S000004424])

HSP 1 Score: 333.569 bits (854), Expect = 1.291e-107
Identity = 169/276 (61.23%), Postives = 220/276 (79.71%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAM----TANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRL 1669
            +QL+ GAA+GT  +D +R  +++ +G D++++DSSQGNSI+Q++M K +K  +P+L+II GNV T++QA +LI AG DGLR+GMGSGSICITQEVMA GRPQ TAV+ V E+A ++ IP +ADGG+QN+GHI KAL LG+S  MMGGMLAGT+E+PGEYF+ DG RLK YRGMGS++AM    T   +S  RYFSE+D V VAQGVSG ++DKGS+ K +PYL  G+QH  QD+G K+L  LKE + +G++RFE RT SAQ+EGGVHNLHSYEKRL
Sbjct:  246 KQLLCGAAIGTIDADKERLRLLVEAGLDVVILDSSQGNSIFQLNMIKWIKETFPDLEIIAGNVATREQAANLIAAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVCEFANQFGIPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTESPGEYFYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDIGYKSLTLLKENVQSGKVRFEFRTASAQLEGGVHNLHSYEKRL 521          

HSP 2 Score: 237.654 bits (605), Expect = 4.430e-71
Identity = 143/268 (53.36%), Postives = 195/268 (72.76%), Query Frame = 1
Query:   79 DGFSASELFNKKT--GLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKD-DRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG S  EL + KT  GLTYNDF++LPG +DF S EV + T++T+N+ L TP VSSPMDTVTES MAI MAL GGIG +HHNCT + QA+ +RRVK YE GFI +P+V+S   TVGE  ++K + GF+G P+T++GK  GKL+G+VT RDI F+  ++  L V +VMT  +N +T   G+ L E N IL++ KKGKL I+++N  LV+++SRTDL KN+ YPL+SK    KQL  GAA+GT   D ER ++L++AG+DVV++ ++ G S
Sbjct:   21 DGLSVQELMDSKTRGGLTYNDFLVLPGLVDFPSSEVSLQTKLTRNITLNTPFVSSPMDTVTESEMAIFMALLGGIGFIHHNCTPEDQADMVRRVKNYENGFINNPIVISPTTTVGEAKSMKERFGFSGFPVTEDGKRNGKLMGIVTSRDIQFVEDNS--LLVQDVMT--KNPVTGAQGITLSEGNEILKKIKKGKLLIVDDNGNLVSMLSRTDLMKNQNYPLASKSATTKQLLCGAAIGTIDADKERLRLLVEAGLDVVILDSSQGNS 284          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Yeast
Match: IMD2 (Inosine monophosphate dehydrogenase; catalyzes the rate-limiting step in GTP biosynthesis, expression is induced by mycophenolic acid resulting in resistance to the drug, expression is repressed by nutrient limitation; IMD2 has a paralog, YAR073W/YAR075W, that arose from a segmental duplication [Source:SGD;Acc:S000001259])

HSP 1 Score: 326.635 bits (836), Expect = 6.943e-105
Identity = 163/276 (59.06%), Postives = 219/276 (79.35%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAM----TANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRL 1669
            +QL+ GA++GT  +D +R  +++ +G D++++DSSQGNSI++++M K +K ++P L++I GNVVT++QA +LI AG DGLR+GMG+GSICITQEVMA GRPQ TAV+ V E+A ++ +P +ADGG+QN+GHI KAL LG+S  MMGGMLAGT+E+PGEYF+ DG RLK YRGMGS++AM    T   +S  RYFSE+D V VAQGVSG ++DKGS+ K +PYL  G+QH  QD+G ++L  LK  +  G++RFE RT SAQ+EGGVHNLHSYEKRL
Sbjct:  246 KQLLCGASIGTMDADKERLRLLVKAGLDVVILDSSQGNSIFELNMLKWVKESFPGLEVIAGNVVTREQAANLIAAGADGLRIGMGTGSICITQEVMACGRPQGTAVYNVCEFANQFGVPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTESPGEYFYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDIGCRSLTLLKNNVQRGKVRFEFRTASAQLEGGVHNLHSYEKRL 521          

HSP 2 Score: 248.44 bits (633), Expect = 3.446e-75
Identity = 138/268 (51.49%), Postives = 189/268 (70.52%), Query Frame = 1
Query:   79 DGFSASELFNKKT--GLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKD-DRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG S  EL + K   GLTYNDF++LPG +DF S EV + T++T+N+ L  PLVSSPMDTVTES MA  MAL GGIG +HHNCT + QA+ +RRVK YE GFI +P+V+S   TVGE  ++K K GF G P+T +GK   KLVG++T RDI F+  ++  L V +VMT  +N +T   G+ L E N IL++ KKG+L +++E   LV+++SRTDL KN+ YPL+SK  + KQL  GA++GT   D ER ++L+ AG+DVV++ ++ G S
Sbjct:   21 DGLSVQELMDSKIRGGLTYNDFLILPGLVDFASSEVSLQTKLTRNITLNIPLVSSPMDTVTESEMATFMALLGGIGFIHHNCTPEDQADMVRRVKNYENGFINNPIVISPTTTVGEAKSMKEKYGFAGFPVTTDGKRNAKLVGVITSRDIQFVEDNS--LLVQDVMT--KNPVTGAQGITLSEGNEILKKIKKGRLLVVDEKGNLVSMLSRTDLMKNQNYPLASKSANTKQLLCGASIGTMDADKERLRLLVKAGLDVVILDSSQGNS 284          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Yeast
Match: IMD1 (Nonfunctional protein with homology to IMP dehydrogenase; blocked reading frame, located close to the telomere; not expressed at detectable levels; YAR073W and YAR075W comprise a continuous reading frame in most strains of S. cerevisiae; YAR073W/YAR075W together have a paralog, IMD2, that arose from a segmental duplication [Source:SGD;Acc:S000000095])

HSP 1 Score: 242.662 bits (618), Expect = 2.438e-74
Identity = 135/266 (50.75%), Postives = 186/266 (69.92%), Query Frame = 1
Query:   79 DGFSASELFNKKT--GLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKD-DRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDG 867
            DG S  EL + K   GL YNDF++LPG +DF S EV + T++T+N+ L  PLVSSPMDTVTES MA  MAL  GIG +HHNCT + QA+ +RRVK YE GFI +P+V+S   TVGE  ++K K GF G P+T +GK   KLVG +T RDI F+  ++  L V +VMT  +N +T   G+ L E N IL++ KKG+L +++E   LV+++SRTDL KN++YPL+SK  + KQL  GA++GT   D ER ++L+ AG+DVV++ ++ G
Sbjct:   21 DGLSVQELMDSKIRGGLAYNDFLILPGLVDFASSEVSLQTKLTRNITLNIPLVSSPMDTVTESEMATFMALLDGIGFIHHNCTPEDQADMVRRVKNYENGFINNPIVISPTTTVGEAKSMKEKYGFAGFPVTADGKRNAKLVGAITSRDIQFVEDNS--LLVQDVMT--KNPVTGAQGITLSEGNEILKKIKKGRLLVVDEKGNLVSMLSRTDLMKNQKYPLASKSANTKQLLWGASIGTMDADKERLRLLVKAGLDVVILDSSQG 282          

HSP 2 Score: 163.696 bits (413), Expect = 4.417e-45
Identity = 70/127 (55.12%), Postives = 104/127 (81.89%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQ 1234
            +QL+ GA++GT  +D +R  +++ +G D++++DSSQGNSI+Q++M K +K  +P+L+II GNVVT++QA +LI AG DGLR+GMG+GSICITQ+VMA GRPQ TAV+ V E+A ++ +P +ADGG+Q
Sbjct:  246 KQLLWGASIGTMDADKERLRLLVKAGLDVVILDSSQGNSIFQLNMIKWIKETFPDLEIIAGNVVTKEQAANLIAAGADGLRIGMGTGSICITQKVMACGRPQGTAVYNVCEFANQFGVPCMADGGVQ 372          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Yeast
Match: YAR075W_mRNA (Non-functional protein with homology IMP dehydrogenase; YAR073W/IMD1 and YAR075W comprise a continuous reading frame in most strains of S. cerevisiae; YAR073W/YAR075W together have a paralog, IMD2, that arose from a segmental duplication [Source:SGD;Acc:S000002145])

HSP 1 Score: 160.614 bits (405), Expect = 8.446e-47
Identity = 93/152 (61.18%), Postives = 118/152 (77.63%), Query Frame = 2
Query: 1229 IQNVGHIV-KXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAM----TANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRL 1669
             +N+GHI+ KAL LG+S  MMGGMLAGT+E+PGEY + DG RLK YRGMGS++AM    T   +S  RYFSE+D V VAQGVSG ++DKGS+ K +PYL  G+QH  QD+G ++L  LKE + +G++RFE RT SAQ+EGGV+NLHSYEKRL
Sbjct:    4 FKNIGHIITKALALGSSTVMMGGMLAGTTESPGEYLYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDIGCRSLTLLKENVQSGKVRFEFRTASAQLEGGVNNLHSYEKRL 155          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO49812 (Inosine-5'-monophosphate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7RG06])

HSP 1 Score: 397.512 bits (1020), Expect = 4.282e-132
Identity = 198/273 (72.53%), Postives = 234/273 (85.71%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+VGAA+GT   D  R   ++ +G D++VIDSSQGNSIYQ+ +  ++K NYPNLQI+GGNVVT  QAK+LIDAGVD LRVGMGSGSICITQEVMAVGRPQ TAV+KV+EYARR+ +P++ADGGIQNVGHI KAL LGAS  MMG +LAGTSEAPGEYFF+DGVRLKKYRGMGSL AM  N SSA RYFSENDKVKVAQGVSG+++DKGS+ K +PYL AGIQHG QD+G K+L  L+  +Y+GEL+FE+RTTS+Q+EGGVH LHSYEKRLF
Sbjct:  242 KQLLVGAAIGTREDDKARLHALVEAGVDVVVIDSSQGNSIYQLSLISHIKENYPNLQIVGGNVVTASQAKNLIDAGVDALRVGMGSGSICITQEVMAVGRPQGTAVYKVAEYARRFGVPVLADGGIQNVGHITKALSLGASTVMMGSLLAGTSEAPGEYFFADGVRLKKYRGMGSLSAMEKNSSSASRYFSENDKVKVAQGVSGSVVDKGSIHKFVPYLTAGIQHGCQDLGAKSLTSLRSMMYSGELKFERRTTSSQIEGGVHGLHSYEKRLF 514          

HSP 2 Score: 315.464 bits (807), Expect = 2.950e-100
Identity = 162/265 (61.13%), Postives = 214/265 (80.75%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF +  GLTY+DFI+LPG+IDF + +VD+T+ +T+ + +KTPLVSSPMDTVTES +A AMAL+GGIGI+HHNC+I+ QANEIR+VKK+EQGFI+ P+V+S  NTV +V++ K ++GF+GIPIT+NG+LGG L G+VT RDIDFL       ++ EVMT  E+L+ A  G+ L+EAN ILQ SKKGKLPI+NE  ELV+LI+RTDLKKNR+YPL+SKD+ KQL VGAA+GT +DD  R   L++AGVDVVV+ ++ G S
Sbjct:   17 DGMTAGQLF-QSDGLTYSDFIILPGFIDFPATDVDLTSPLTRRITIKTPLVSSPMDTVTESALATAMALNGGIGIIHHNCSIEFQANEIRKVKKFEQGFIMAPLVLSATNTVADVIDAKQRHGFSGIPITENGQLGGILQGIVTSRDIDFLHGVENHKQLGEVMTRLEDLVVAKAGITLNEANKILQMSKKGKLPIVNEKGELVSLIARTDLKKNRDYPLASKDENKQLLVGAAIGTREDDKARLHALVEAGVDVVVIDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO49872 (Inosine-5'-monophosphate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7REY1])

HSP 1 Score: 363.229 bits (931), Expect = 1.305e-118
Identity = 183/274 (66.79%), Postives = 232/274 (84.67%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFS-DGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+VGAA+GT   D  R   +IH+G D+I++DSSQGNS YQIDM KN+K   P LQ++ GNVVT  QAK+LIDAG D LRVGMGSGSICITQEVMAVGRPQATAVFKV+EYARR+ IP+IADGGI+ VGHI KAL +GAS  MMG +LAGTSEAPGEY+FS DGVRLKKYRGMGSL+A+  N+SS  RYF E++++KVAQGVSG ++DKGS+ + +PYL++G+QHG QDMG ++L  L+  +Y+G+L+FEKR+++A++EGG+H+LHSYEKRL+
Sbjct:  252 KQLLVGAAIGTRAEDKLRVEALIHAGVDVIILDSSQGNSAYQIDMIKNIKELCPRLQVVAGNVVTACQAKNLIDAGADALRVGMGSGSICITQEVMAVGRPQATAVFKVAEYARRFGIPVIADGGIRTVGHITKALSVGASTVMMGSLLAGTSEAPGEYYFSNDGVRLKKYRGMGSLDALE-NKSSQSRYFIESERIKVAQGVSGAVVDKGSIHRFVPYLLSGLQHGCQDMGCQSLSVLRSMMYSGQLKFEKRSSAARIEGGIHSLHSYEKRLY 524          

HSP 2 Score: 307.76 bits (787), Expect = 3.329e-97
Identity = 153/266 (57.52%), Postives = 208/266 (78.20%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWSS 876
            DG +A+ LF    GLTY+DF++LPG+IDF ++ V++ + +T+ + LKTP VSSPMDTVTES MA+AMAL GGIGI+HHNC+I+ QA+E+++VKKY+QGFI DP+V+S  +TV +V+ IK KNGF+GIP+T+NG +GG L G++T RDIDFL     D  +SE MTP  +L+ A     L EAN ILQ+SKKGKLPI+NEN ELV+LI+ +DL+KNRE+PL+SKD +KQL VGAA+GT  +D  R + LI AGVDV+++ ++ G S+
Sbjct:   26 DGLTANALFGGGQGLTYDDFLILPGFIDFSADVVELNSALTREITLKTPFVSSPMDTVTESAMAVAMALHGGIGIIHHNCSIEFQADEVKKVKKYKQGFINDPLVLSPRHTVKDVIEIKKKNGFSGIPLTENGCMGGVLAGIITSRDIDFLGPEQIDEPLSEFMTPLNDLVVAKDDCTLQEANRILQQSKKGKLPIVNENGELVSLIAYSDLRKNREFPLASKDSKKQLLVGAAIGTRAEDKLRVEALIHAGVDVIILDSSQGNSA 291          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO31825 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWU4])

HSP 1 Score: 80.8777 bits (198), Expect = 7.427e-17
Identity = 60/160 (37.50%), Postives = 87/160 (54.37%), Query Frame = 2
Query:  941 IVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRY 1420
            I +D + G S + +D  K +++ +P   II GNVVT +  + LI +G D ++VG+G GS+C T+    VG PQ +AV +  + A      II+DGG    G + KA   GA   M+GGMLAG  ++ GE    DG + K + GM S  AM  +      Y
Sbjct:  128 ICLDVANGYSEHFVDFVKKVRSMFPEHIIIAGNVVTGEMVEQLILSGADIVKVGIGPGSVCTTRRQTGVGYPQISAVLECGDAAHGLKGHIISDGGCTCPGDVSKAFGAGADFVMLGGMLAGHDQSGGEIIERDGKKYKIFYGMSSNTAMRKHAGGVAEY 287          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO47408 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLX0])

HSP 1 Score: 55.4546 bits (132), Expect = 1.107e-8
Identity = 25/29 (86.21%), Postives = 26/29 (89.66%), Query Frame = 1
Query:  214 LKTPLVSSPMDTVTESNMAIAMALSGGIG 300
            LKTP VSSPMDTVTES MA+AMAL GGIG
Sbjct:  155 LKTPFVSSPMDTVTESAMAVAMALHGGIG 183          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Medaka
Match: impdh1b (inosine-5'-monophosphate dehydrogenase 1b [Source:NCBI gene;Acc:101168830])

HSP 1 Score: 379.022 bits (972), Expect = 4.731e-123
Identity = 188/273 (68.86%), Postives = 227/273 (83.15%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT   D  R  +++ +G D++V+DSSQGNS+YQI+M   +K  YP LQ++GGNVVT  QAK+LIDAGVD LRVGMG GSICITQEVMA GRPQ T+V+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  N SS  RYFSE DKVKVAQGVSG++ DKGS+ K +PYL+AGIQHG QD+G K+L  L+  +Y+GEL+FEKRT SAQVEGG+H LHSYEKRL+
Sbjct:  341 KQLLCGAAIGTREDDKYRLDLLVQAGVDVVVLDSSQGNSVYQINMISYIKQKYPELQVVGGNVVTAAQAKNLIDAGVDALRVGMGCGSICITQEVMACGRPQGTSVYKVAEYARRFGVPVIADGGIQTVGHVVKALSLGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKNTSSQKRYFSEGDKVKVAQGVSGSVQDKGSIHKFVPYLIAGIQHGCQDIGAKSLCVLRSMMYSGELKFEKRTMSAQVEGGIHGLHSYEKRLY 613          

HSP 2 Score: 335.88 bits (860), Expect = 1.724e-106
Identity = 170/266 (63.91%), Postives = 217/266 (81.58%), Query Frame = 1
Query:   76 YDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            +DG +A EL +K  GLTYNDF++LPG+IDF S+EVD+T+ +T+ + LKTPL+SSPMDTVTES MAIAMAL GGIGI+HHNCT + QANE+R+VK++EQGFI DPVVMS  +TVG+V   K+++GF+GIP+T+ GK+GGKL+G+VT RDIDFL +   D  + E MT  E+L+ AP GV L EAN ILQRSKKGKLPI+N+N ELVA+I+RTDLKKNR+YPL+SKD RKQL  GAA+GT +DD  R  +L+ AGVDVVV+ ++ G S
Sbjct:  114 WDGHTAEELCSKGDGLTYNDFLILPGFIDFTSDEVDLTSALTRKITLKTPLISSPMDTVTESAMAIAMALMGGIGIIHHNCTPEFQANEVRKVKRFEQGFITDPVVMSPRHTVGDVFEAKVRHGFSGIPVTETGKMGGKLMGIVTSRDIDFLSEKEHDKYLEEAMTKREDLVVAPAGVTLKEANDILQRSKKGKLPIVNDNDELVAIIARTDLKKNRDYPLASKDSRKQLLCGAAIGTREDDKYRLDLLVQAGVDVVVLDSSQGNS 379          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Medaka
Match: impdh2 (inosine monophosphate dehydrogenase 2 [Source:NCBI gene;Acc:110015337])

HSP 1 Score: 367.851 bits (943), Expect = 9.494e-120
Identity = 188/297 (63.30%), Postives = 233/297 (78.45%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQE------------------------VMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL+ GAA+GT+  D  R  +++ SG D++V+DSSQGNSI+QI+M K +K  YP+LQ+IGGNVVT  QAK+LIDAGVD LRVGMGSGSICITQE                        ++A GRPQATAV+KVSEYARR+ +P+IADGGIQNVGH+ KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  N  S  RYFSE+DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +L+  +Y+G+L+FE+RTTSAQ+EGG+H+LHSYEKRLF
Sbjct:  242 KQLLCGAAIGTHNDDKYRLDLLVQSGVDVVVLDSSQGNSIFQINMIKYIKEKYPDLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEAPLSVPPALKLHSPKTPTTVTGYSMLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHVAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKNLGSQNRYFSESDKIKVAQGVSGAVQDKGSIHKFVPYLLAGIQHSCQDIGAKSLTQLRAMMYSGDLKFERRTTSAQMEGGIHSLHSYEKRLF 538          

HSP 2 Score: 326.25 bits (835), Expect = 9.410e-104
Identity = 168/275 (61.09%), Postives = 214/275 (77.82%), Query Frame = 1
Query:   49 SAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            S   G V D DG S  +LFN   GLTYNDF++LPGYIDF +++VD+T+ +TK + +KTP VSSPMDTVTE+NMAIAMAL+GGIG +HHNCT + QANE+ +VK+YEQGFI DPVVMS +  V +V   K + GF GIPIT+NGK+GGKLVG+++ RDIDFL +    L ++EVMT  E+L+ AP GV L +AN ILQRSKKGKLPI+NE   LV++I+RTDLKKNR++PL+SKD RKQL  GAA+GTH DD  R  +L+ +GVDVVV+ ++ G S
Sbjct:    7 SGQTGYVPD-DGLSGQQLFNGGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITMKTPFVSSPMDTVTEANMAIAMALTGGIGFIHHNCTPEFQANEVHKVKRYEQGFITDPVVMSPNERVRDVFQAKARYGFCGIPITENGKMGGKLVGIISSRDIDFLKEDEHSLLLNEVMTKKEDLVVAPAGVTLKQANEILQRSKKGKLPIVNEEGSLVSIIARTDLKKNRDFPLASKDSRKQLLCGAAIGTHNDDKYRLDLLVQSGVDVVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Medaka
Match: ENSORLT00000012176.2 (inosine-5'-monophosphate dehydrogenase 1b-like [Source:NCBI gene;Acc:101157210])

HSP 1 Score: 358.221 bits (918), Expect = 2.222e-116
Identity = 181/268 (67.54%), Postives = 219/268 (81.72%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSY 1657
            +QL+ GAA+GT   D  R  +++ +G D++V+DSSQGNS+YQI M   +K  +P++Q+IGGNVVT  QAK+LIDAG D LRVGMG GSICITQEVMA GRPQ T+V+KV+EYARR+ +P+IADGGIQ VGH+VKAL LGAS  MMG +LA T+EAPGEYFFSDGVRLKKYRGMGSL+AM  N S   RYFSE DKVKVAQGVSG++ DKGS+ K +PYL+AGIQHG QD G K+L  L+  +Y+GEL+FEKRT SAQ+EGGVH LHSY
Sbjct:  242 KQLLCGAAIGTREDDKYRLDLLVQAGVDVVVLDSSQGNSVYQISMINYIKQKHPDIQVIGGNVVTAAQAKNLIDAGADALRVGMGCGSICITQEVMACGRPQGTSVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKNNSQK-RYFSEGDKVKVAQGVSGSVQDKGSIQKFVPYLIAGIQHGCQDTGAKSLSILRSMMYSGELKFEKRTMSAQMEGGVHGLHSY 508          

HSP 2 Score: 332.028 bits (850), Expect = 2.414e-106
Identity = 169/265 (63.77%), Postives = 215/265 (81.13%), Query Frame = 1
Query:   79 DGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            DG +A +LF    GLTYNDF++LPG+IDF ++EVD+T+ +TK + LKTPL+SSPMDTVTES MAIAMAL GGIGI+HHNCT + QANE+ +VKK+EQGFI DPVVMS  +TVG+V+  KI++GF+GIP+T+ GK+G KLVG+VT RDIDFL +   +  + EVMT  E+L+ AP GV L EAN ILQRSKKGKLPI+N++ ELVA+I+RTDLKKNR+YPL+SKD RKQL  GAA+GT +DD  R  +L+ AGVDVVV+ ++ G S
Sbjct:   16 DGLTAQQLFVNCDGLTYNDFLILPGFIDFTADEVDLTSALTKKITLKTPLISSPMDTVTESFMAIAMALMGGIGIIHHNCTAEFQANEVHKVKKFEQGFITDPVVMSPTHTVGDVLEAKIRHGFSGIPVTETGKMGSKLVGIVTSRDIDFLSEKEHNRPLEEVMTKREDLVVAPAGVTLKEANDILQRSKKGKLPIVNDSDELVAIIARTDLKKNRDYPLASKDSRKQLLCGAAIGTREDDKYRLDLLVQAGVDVVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Medaka
Match: impdh2 (inosine monophosphate dehydrogenase 2 [Source:NCBI gene;Acc:110015337])

HSP 1 Score: 353.599 bits (906), Expect = 3.710e-114
Identity = 181/293 (61.77%), Postives = 227/293 (77.47%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQE------------------------VMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYE 1660
            +QL+ GAA+GT+  D  R  +++ SG D++V+DSSQGNSI+QI+M K +K  YP+LQ+IGGNVVT  QAK+LIDAGVD LRVGMGSGSICITQE                        ++A GRPQATAV+KVSEYARR+ +P+IADGGIQNVGH+ KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  N  S  RYFSE+DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +L+  +Y+G+L+FE+RTTSAQ+EGG+H+LH + 
Sbjct:  242 KQLLCGAAIGTHNDDKYRLDLLVQSGVDVVVLDSSQGNSIFQINMIKYIKEKYPDLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEAPLSVPPALKLHSPKTPTTVTGYSMLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHVAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKNLGSQNRYFSESDKIKVAQGVSGAVQDKGSIHKFVPYLLAGIQHSCQDIGAKSLTQLRAMMYSGDLKFERRTTSAQMEGGIHSLHRFR 534          

HSP 2 Score: 326.25 bits (835), Expect = 1.161e-103
Identity = 168/275 (61.09%), Postives = 214/275 (77.82%), Query Frame = 1
Query:   49 SAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            S   G V D DG S  +LFN   GLTYNDF++LPGYIDF +++VD+T+ +TK + +KTP VSSPMDTVTE+NMAIAMAL+GGIG +HHNCT + QANE+ +VK+YEQGFI DPVVMS +  V +V   K + GF GIPIT+NGK+GGKLVG+++ RDIDFL +    L ++EVMT  E+L+ AP GV L +AN ILQRSKKGKLPI+NE   LV++I+RTDLKKNR++PL+SKD RKQL  GAA+GTH DD  R  +L+ +GVDVVV+ ++ G S
Sbjct:    7 SGQTGYVPD-DGLSGQQLFNGGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITMKTPFVSSPMDTVTEANMAIAMALTGGIGFIHHNCTPEFQANEVHKVKRYEQGFITDPVVMSPNERVRDVFQAKARYGFCGIPITENGKMGGKLVGIISSRDIDFLKEDEHSLLLNEVMTKKEDLVVAPAGVTLKQANEILQRSKKGKLPIVNEEGSLVSIIARTDLKKNRDFPLASKDSRKQLLCGAAIGTHNDDKYRLDLLVQSGVDVVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Medaka
Match: impdh2 (inosine monophosphate dehydrogenase 2 [Source:NCBI gene;Acc:110015337])

HSP 1 Score: 326.635 bits (836), Expect = 9.182e-104
Identity = 165/241 (68.46%), Postives = 202/241 (83.82%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEK 1576
            +QL+ GAA+GT+  D  R  +++ SG D++V+DSSQGNSI+QI+M K +K  YP+LQ+IGGNVVT  QAK+LIDAGVD LRVGMGSGSICITQEV+A GRPQATAV+KVSEYARR+ +P+IADGGIQNVGH+ KAL LGAS  MMG +LA T+EAPGEYFFSDG+RLKKYRGMGSL+AM  N  S  RYFSE+DK+KVAQGVSG + DKGS+ K +PYL+AGIQH  QD+G K+L +L+ +
Sbjct:  242 KQLLCGAAIGTHNDDKYRLDLLVQSGVDVVVLDSSQGNSIFQINMIKYIKEKYPDLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHVAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKNLGSQNRYFSESDKIKVAQGVSGAVQDKGSIHKFVPYLLAGIQHSCQDIGAKSLTQLRYR 482          

HSP 2 Score: 326.25 bits (835), Expect = 1.238e-103
Identity = 168/275 (61.09%), Postives = 214/275 (77.82%), Query Frame = 1
Query:   49 SAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            S   G V D DG S  +LFN   GLTYNDF++LPGYIDF +++VD+T+ +TK + +KTP VSSPMDTVTE+NMAIAMAL+GGIG +HHNCT + QANE+ +VK+YEQGFI DPVVMS +  V +V   K + GF GIPIT+NGK+GGKLVG+++ RDIDFL +    L ++EVMT  E+L+ AP GV L +AN ILQRSKKGKLPI+NE   LV++I+RTDLKKNR++PL+SKD RKQL  GAA+GTH DD  R  +L+ +GVDVVV+ ++ G S
Sbjct:    7 SGQTGYVPD-DGLSGQQLFNGGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITMKTPFVSSPMDTVTEANMAIAMALTGGIGFIHHNCTPEFQANEVHKVKRYEQGFITDPVVMSPNERVRDVFQAKARYGFCGIPITENGKMGGKLVGIISSRDIDFLKEDEHSLLLNEVMTKKEDLVVAPAGVTLKQANEILQRSKKGKLPIVNEEGSLVSIIARTDLKKNRDFPLASKDSRKQLLCGAAIGTHNDDKYRLDLLVQSGVDVVVLDSSQGNS 280          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000078264.1 (SMESG000078264.1)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 280/280 (100.00%), Postives = 280/280 (100.00%), Query Frame = 1
Query:   43 MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWSSRG 882
            MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNGKLGGKLVGLVTLRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWSSRG
Sbjct:    1 MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNGKLGGKLVGLVTLRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWSSRG 280          

HSP 2 Score: 481.485 bits (1238), Expect = 3.058e-164
Identity = 261/290 (90.00%), Postives = 267/290 (92.07%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSG-----------------ADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL VGAAVGT+  D +RA ++I +G                 ADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKALCLGASAAMMGGMLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF
Sbjct:  239 KQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWSSRGGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKALCLGASAAMMGGMLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 528          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000078264.1 (SMESG000078264.1)

HSP 1 Score: 530.406 bits (1365), Expect = 0.000e+0
Identity = 272/277 (98.19%), Postives = 274/277 (98.92%), Query Frame = 1
Query:   43 MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNGKLGGKLVGLVTLRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVM ++ G S
Sbjct:    1 MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNGKLGGKLVGLVTLRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMDSSQGNS 277          

HSP 2 Score: 474.167 bits (1219), Expect = 2.018e-161
Identity = 251/267 (94.01%), Postives = 260/267 (97.38%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHS 1654
            +QL VGAAVGT+  D +RA ++I +G D++V+DSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKALCLGASAAMMGGMLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHS
Sbjct:  239 KQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKALCLGASAAMMGGMLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHS 505          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000078264.1 (SMESG000078264.1)

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 272/277 (98.19%), Postives = 274/277 (98.92%), Query Frame = 1
Query:   43 MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMAATDGWS 873
            MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNGKLGGKLVGLVTLRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVM ++ G S
Sbjct:    1 MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNGKLGGKLVGLVTLRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMDSSQGNS 277          

HSP 2 Score: 486.878 bits (1252), Expect = 1.313e-166
Identity = 257/273 (94.14%), Postives = 266/273 (97.44%), Query Frame = 2
Query:  854 RQLMVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL VGAAVGT+  D +RA ++I +G D++V+DSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKALCLGASAAMMGGMLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF
Sbjct:  239 KQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKALCLGASAAMMGGMLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 511          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000078264.1 (SMESG000078264.1)

HSP 1 Score: 511.531 bits (1316), Expect = 4.577e-180
Identity = 270/270 (100.00%), Postives = 270/270 (100.00%), Query Frame = 2
Query:  863 MVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            MVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKALCLGASAAMMGGMLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF
Sbjct:    1 MVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKALCLGASAAMMGGMLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 270          
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000078264.1 (SMESG000078264.1)

HSP 1 Score: 514.227 bits (1323), Expect = 4.893e-177
Identity = 263/263 (100.00%), Postives = 263/263 (100.00%), Query Frame = 1
Query:   43 MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNXXXXXXXXXXXXXRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDA 831
            MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNGKLGGKLVGLVTLRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDA
Sbjct:    1 MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITTRITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANEIRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNGKLGGKLVGLVTLRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQRSKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTHKDDCERAKVLIDA 263          

HSP 2 Score: 498.434 bits (1282), Expect = 7.337e-171
Identity = 271/299 (90.64%), Postives = 272/299 (90.97%), Query Frame = 2
Query:  854 RQLMVGAAVGT--------------------------NLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKXXXXXXXXXXXXXXXXXTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 1672
            +QL VGAAVGT                          NLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKALCLGASAAMMGGMLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF
Sbjct:  239 KQLKVGAAVGTHKDDCERAKVLIDAGVDVVVMVTVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANYPNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQATAVFKVSEYARRYDIPIIADGGIQNVGHIVKALCLGASAAMMGGMLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVSGNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRTTSAQVEGGVHNLHSYEKRLF 537          
The following BLAST results are available for this feature:
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IMPDH24.932e-12670.33inosine monophosphate dehydrogenase 2 [Source:HGNC... [more]
IMPDH15.806e-12569.96inosine monophosphate dehydrogenase 1 [Source:HGNC... [more]
IMPDH11.512e-12469.96inosine monophosphate dehydrogenase 1 [Source:HGNC... [more]
IMPDH11.512e-12469.96inosine monophosphate dehydrogenase 1 [Source:HGNC... [more]
IMPDH11.673e-12469.96inosine monophosphate dehydrogenase 1 [Source:HGNC... [more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T22D1.33.693e-10159.49Inosine-5'-monophosphate dehydrogenase [Source:Un... [more]
T22D1.33.693e-10159.49Inosine-5'-monophosphate dehydrogenase [Source:Un... [more]
T22D1.33.693e-10159.49Inosine-5'-monophosphate dehydrogenase [Source:Un... [more]
T22D1.33.693e-10159.49Inosine-5'-monophosphate dehydrogenase [Source:Un... [more]
T22D1.33.693e-10159.49Inosine-5'-monophosphate dehydrogenase [Source:Un... [more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ras3.818e-11566.43gene:FBgn0003204 transcript:FBtr0343043[more]
ras3.818e-11566.43gene:FBgn0003204 transcript:FBtr0071495[more]
ras3.818e-11566.43gene:FBgn0003204 transcript:FBtr0332294[more]
ras3.818e-11566.43gene:FBgn0003204 transcript:FBtr0071494[more]
ras1.974e-11466.43gene:FBgn0003204 transcript:FBtr0474163[more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
impdh21.662e-12469.60IMP (inosine 5'-monophosphate) dehydrogenase 2 [So... [more]
impdh1b7.738e-12469.23IMP (inosine 5'-monophosphate) dehydrogenase 1b [S... [more]
impdh1b1.652e-12369.23IMP (inosine 5'-monophosphate) dehydrogenase 1b [S... [more]
impdh1a2.843e-12369.23IMP (inosine 5'-monophosphate) dehydrogenase 1a [S... [more]
impdh1a2.843e-12369.23IMP (inosine 5'-monophosphate) dehydrogenase 1a [S... [more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
impdh11.521e-12369.23IMP (inosine 5'-monophosphate) dehydrogenase 1 [So... [more]
impdh24.888e-12368.86IMP (inosine 5'-monophosphate) dehydrogenase 2 [So... [more]
impdh26.833e-12368.86IMP (inosine 5'-monophosphate) dehydrogenase 2 [So... [more]
impdh21.793e-12268.86IMP (inosine 5'-monophosphate) dehydrogenase 2 [So... [more]
impdh23.045e-12268.86IMP (inosine 5'-monophosphate) dehydrogenase 2 [So... [more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Impdh12.676e-12569.96inosine monophosphate dehydrogenase 1 [Source:MGI ... [more]
Impdh24.290e-12569.96inosine monophosphate dehydrogenase 2 [Source:MGI ... [more]
Impdh16.319e-12569.96inosine monophosphate dehydrogenase 1 [Source:MGI ... [more]
Impdh16.319e-12569.96inosine monophosphate dehydrogenase 1 [Source:MGI ... [more]
Impdh16.319e-12569.96inosine monophosphate dehydrogenase 1 [Source:MGI ... [more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P12268|IMDH2_HUMAN2.368e-12570.33Inosine-5'-monophosphate dehydrogenase 2 OS=Homo s... [more]
sp|E9PU28|IMDH2_RAT1.034e-12470.33Inosine-5'-monophosphate dehydrogenase 2 OS=Rattus... [more]
sp|P12269|IMDH2_CRIGR1.507e-12469.96Inosine-5'-monophosphate dehydrogenase 2 OS=Cricet... [more]
sp|P24547|IMDH2_MOUSE3.001e-12469.96Inosine-5'-monophosphate dehydrogenase 2 OS=Mus mu... [more]
sp|A0JNA3|IMDH1_BOVIN4.326e-12469.96Inosine-5'-monophosphate dehydrogenase 1 OS=Bos ta... [more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HSL60.000e+062.25Inosine-5'-monophosphate dehydrogenase OS=Macrosto... [more]
A0A1I8I1M00.000e+061.39Inosine-5'-monophosphate dehydrogenase OS=Macrosto... [more]
A0A183SHZ61.105e-15063.00Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A1I8C5676.672e-13355.05Inosine-5'-monophosphate dehydrogenase OS=Rhabdito... [more]
A7RG063.097e-12872.53Inosine-5'-monophosphate dehydrogenase OS=Nematost... [more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
impdh1b8.119e-12368.86inosine-5'-monophosphate dehydrogenase 1b [Source:... [more]
impdh1b2.511e-12168.86inosine-5'-monophosphate dehydrogenase 1b [Source:... [more]
impdh1a3.359e-12168.50inosine-5'-monophosphate dehydrogenase 1a [Source:... [more]
impdh1a1.509e-11968.50inosine-5'-monophosphate dehydrogenase 1a [Source:... [more]
impdh23.323e-11964.85inosine monophosphate dehydrogenase 2 [Source:NCBI... [more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
impdh1a5.748e-9061.47IMP (inosine 5'-monophosphate) dehydrogenase 1a [S... [more]
gmpr4.611e-931.40guanosine monophosphate reductase [Source:ZFIN;Acc... [more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
IMD46.125e-10960.65Inosine monophosphate dehydrogenase; catalyzes the... [more]
IMD31.291e-10761.23Inosine monophosphate dehydrogenase; catalyzes the... [more]
IMD26.943e-10559.06Inosine monophosphate dehydrogenase; catalyzes the... [more]
IMD12.438e-7450.75Nonfunctional protein with homology to IMP dehydro... [more]
YAR075W_mRNA8.446e-4761.18Non-functional protein with homology IMP dehydroge... [more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO498124.282e-13272.53Inosine-5'-monophosphate dehydrogenase [Source:Un... [more]
EDO498721.305e-11866.79Inosine-5'-monophosphate dehydrogenase [Source:Un... [more]
EDO318257.427e-1737.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474081.107e-886.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
impdh1b4.731e-12368.86inosine-5'-monophosphate dehydrogenase 1b [Source:... [more]
impdh29.494e-12063.30inosine monophosphate dehydrogenase 2 [Source:NCBI... [more]
ENSORLT00000012176.22.222e-11667.54inosine-5'-monophosphate dehydrogenase 1b-like [So... [more]
impdh23.710e-11461.77inosine monophosphate dehydrogenase 2 [Source:NCBI... [more]
impdh29.182e-10468.46inosine monophosphate dehydrogenase 2 [Source:NCBI... [more]
back to top
BLAST of Inosine-5'-monophosphate dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078264.13.058e-164100.00SMESG000078264.1[more]
SMESG000078264.12.018e-16198.19SMESG000078264.1[more]
SMESG000078264.11.313e-16698.19SMESG000078264.1[more]
SMESG000078264.14.577e-180100.00SMESG000078264.1[more]
SMESG000078264.14.893e-177100.00SMESG000078264.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028961 ID=SMED30028961|Name=Inosine-5'-monophosphate dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1946bp
AAATAATTTAATTCAAGCGTGATTTAACAATATTTTAAAATAATGAGTTC
AGCTGTGAACGGCATTGTTTATGACTACGATGGGTTTTCTGCATCAGAAC
TATTTAATAAAAAAACAGGATTAACCTACAATGATTTTATTCTTTTACCA
GGTTATATCGATTTTCGCTCCGAAGAAGTAGATATAACTACGAGGATTAC
AAAGAACATGTATCTTAAAACTCCATTAGTTTCTTCTCCCATGGACACTG
TTACAGAATCAAATATGGCTATTGCAATGGCTTTATCTGGAGGTATTGGT
ATATTACACCACAATTGTACTATTGATACTCAAGCAAATGAGATTAGAAG
AGTGAAAAAATACGAACAAGGATTTATAGTAGATCCTGTGGTGATGTCAA
TTGACAATACAGTGGGCGAAGTCATGAATATTAAAATTAAAAATGGATTC
ACCGGTATTCCGATTACAGATAACGGTAAGCTTGGAGGAAAACTAGTCGG
CCTTGTAACATTGAGAGATATTGATTTTTTACCAAAGAGTAATTGGGATC
TCAAAGTTTCAGAAGTAATGACTCCATTTGAAAATCTAATAACTGCTCCT
TATGGAGTTGCGTTACATGAAGCTAACGGAATATTACAGCGCAGTAAAAA
AGGTAAATTACCAATAATTAATGAAAACAGAGAACTAGTTGCACTTATTT
CCCGTACTGATTTGAAAAAAAATCGAGAATATCCCCTTTCTTCTAAAGAT
GACAGAAAGCAATTGAAAGTAGGAGCTGCAGTGGGAACCCACAAAGATGA
CTGTGAGCGCGCCAAAGTACTTATTGACGCAGGAGTAGATGTAGTAGTTA
TGGCGGCAACTGATGGTTGGAGCAGCCGTGGGTACAAATCTCAGTGATTA
TGATCGTGCATCAATGATTATCCACAGCGGAGCTGACCTCATTGTCATAG
ATTCATCCCAAGGTAATAGTATCTATCAAATAGATATGACGAAAAATTTA
AAAGCAAACTATCCTAATTTACAGATAATTGGTGGAAATGTTGTAACTCA
ACAACAAGCGAAGTCCCTTATTGATGCTGGTGTGGATGGTTTACGAGTAG
GAATGGGCAGTGGCTCAATTTGTATCACACAGGAAGTAATGGCCGTTGGA
AGACCACAAGCTACTGCAGTTTTTAAAGTAAGTGAATATGCTAGGCGGTA
TGATATTCCTATTATCGCTGATGGAGGAATTCAAAATGTAGGGCACATAG
TTAAAGCTTTGTGTCTTGGTGCCAGTGCAGCCATGATGGGTGGTATGCTT
GCTGGCACTTCAGAAGCTCCTGGAGAGTATTTCTTTTCAGATGGAGTTCG
ATTAAAAAAATATCGAGGGATGGGTAGTCTAGAAGCAATGACTGCTAACC
AGTCAAGTGCAGTAAGATATTTTAGCGAAAACGATAAAGTCAAGGTTGCA
CAAGGTGTTAGTGGAAATATGTTGGATAAAGGAAGCGTCATGAAACTCAT
GCCATATTTGGTAGCTGGTATACAGCATGGACTGCAAGATATGGGTGTTA
AAAATCTTGTGGAACTCAAAGAAAAAATATACAATGGAGAACTGAGATTC
GAAAAACGAACTACAAGTGCCCAAGTTGAAGGAGGCGTTCATAATTTGCA
CTCATACGAGAAACGATTATTCTAATCATTAGAAACGAAATTAGCAAATT
TCACTGCAAAAAATTGTTTTCAATTATGTTTGTAAAAGTTATTATTTACT
GTCTGGAATTTGATTCATTTTTAGCACAAACATTCAACTTTATTGAAAAA
TTATTTTTTTAATCGTTACATTTTCTGTAATTATTTATGTATCATTGGTA
TTGATTTAATTTTCTAAATTTTGGTATTTGCACAGATTTAGCTGTTATTT
AGATTATTGTGTCGTAAATAAATTGATAAATTATTCTCTTCTCAAA
back to top

protein sequence of SMED30028961-orf-1

>SMED30028961-orf-1 ID=SMED30028961-orf-1|Name=SMED30028961-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=271bp
MVGAAVGTNLSDYDRASMIIHSGADLIVIDSSQGNSIYQIDMTKNLKANY
PNLQIIGGNVVTQQQAKSLIDAGVDGLRVGMGSGSICITQEVMAVGRPQA
TAVFKVSEYARRYDIPIIADGGIQNVGHIVKALCLGASAAMMGGMLAGTS
EAPGEYFFSDGVRLKKYRGMGSLEAMTANQSSAVRYFSENDKVKVAQGVS
GNMLDKGSVMKLMPYLVAGIQHGLQDMGVKNLVELKEKIYNGELRFEKRT
TSAQVEGGVHNLHSYEKRLF*
back to top

protein sequence of SMED30028961-orf-2

>SMED30028961-orf-2 ID=SMED30028961-orf-2|Name=SMED30028961-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=285bp
MSSAVNGIVYDYDGFSASELFNKKTGLTYNDFILLPGYIDFRSEEVDITT
RITKNMYLKTPLVSSPMDTVTESNMAIAMALSGGIGILHHNCTIDTQANE
IRRVKKYEQGFIVDPVVMSIDNTVGEVMNIKIKNGFTGIPITDNGKLGGK
LVGLVTLRDIDFLPKSNWDLKVSEVMTPFENLITAPYGVALHEANGILQR
SKKGKLPIINENRELVALISRTDLKKNREYPLSSKDDRKQLKVGAAVGTH
KDDCERAKVLIDAGVDVVVMAATDGWSSRGYKSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000036eye
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000644CBS_dom
IPR001093IMP_DH_GMPRt
IPR013785Aldolase_TIM
IPR015875IMP_DH/GMP_Rdtase_CS
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016491oxidoreductase activity
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0003723RNA binding
GO:0003938IMP dehydrogenase activity
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006164purine nucleotide biosynthetic process
GO:0006177GMP biosynthetic process
GO:0006183GTP biosynthetic process
GO:0009168purine ribonucleoside monophosphate biosynthetic process
GO:0043312neutrophil degranulation
GO:0046651lymphocyte proliferation
GO:0051289protein homotetramerization
GO:0060041retina development in camera-type eye
GO:0071353cellular response to interleukin-4
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005778peroxisomal membrane
GO:0005829cytosol
GO:0016020membrane
GO:0034774secretory granule lumen
GO:0070062extracellular exosome
GO:1904813ficolin-1-rich granule lumen
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000644CBS domainSMARTSM00116cbs_1coord: 181..229
e-value: 0.0018
score: 27.5
coord: 114..165
e-value: 6.6E-8
score: 42.3
IPR000644CBS domainPFAMPF00571CBScoord: 114..160
e-value: 3.2E-6
score: 27.5
coord: 172..224
e-value: 2.9E-4
score: 21.2
IPR000644CBS domainPROSITEPS51371CBScoord: 176..234
score: 10.638
IPR000644CBS domainPROSITEPS51371CBScoord: 111..170
score: 10.594
NoneNo IPR availableSMARTSM01240IMPDH_2coord: 25..284
e-value: 5.3E-28
score: 109.0
NoneNo IPR availablePANTHERPTHR11911:SF74INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE 1coord: 11..277
NoneNo IPR availablePANTHERPTHR11911INOSINE-5-MONOPHOSPHATE DEHYDROGENASE RELATEDcoord: 11..277
NoneNo IPR availableCDDcd04601CBS_pair_IMPDHcoord: 112..226
e-value: 3.94091E-48
score: 154.108
NoneNo IPR availableSUPERFAMILYSSF51412Inosine monophosphate dehydrogenase (IMPDH)coord: 25..274
NoneNo IPR availableSUPERFAMILYSSF54631CBS-domain paircoord: 113..226
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 2..282
e-value: 1.1E-112
score: 378.8
IPR001093IMP dehydrogenase/GMP reductasePFAMPF00478IMPDHcoord: 26..278
e-value: 3.5E-47
score: 161.3