Protein disulfide-isomerase A6

Overview
NameProtein disulfide-isomerase A6
Smed IDSMED30028938
Length (bp)1590
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein disulfide-isomerase A6 (SMED30028938) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein disulfide-isomerase A6 (SMED30028938) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein disulfide-isomerase A6 (SMED30028938) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein disulfide-isomerase A6 (SMED30028938) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028938

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 38

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
secretory systemSMED30028938SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30028938SMESG000023147.1 SMESG000017020.1 SMED30017430smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028938SMESG000023147.1 SMESG000017020.1 SMED30017430smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30028938SMESG000023147.1 SMESG000017020.1 SMED30017430smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nu neoblastSMED30028938SMESG000023147.1 SMESG000017020.1 SMED30017430smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30028938SMESG000023147.1 SMESG000017020.1 SMED30028938smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028938SMESG000023147.1 SMESG000017020.1 SMED30028938smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30028938SMESG000023147.1 SMESG000017020.1 SMED30028938smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nu neoblastSMED30028938SMESG000023147.1 SMESG000017020.1 SMED30028938smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028938SMESG000017020.1 dd_Smed_v4_1058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30028938SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028938SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028938SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028938SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028938SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028938SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028938SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30028938SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028938SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30028938SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028938SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30028938SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028938SMESG000017020.1 Contig37625uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028938SMESG000017020.1 Contig37625newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028938SMESG000037711.1 Contig1422GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028938SMESG000023147.1 Contig44747uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028938SMESG000023147.1 Contig44747newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028938SMESG000017020.1 Contig1422GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028938SMESG000077847.1 SMESG000072336.1 SMESG000044971.1 SMESG000033570.1 SMESG000031842.1 SMESG000026563.1 SMESG000017020.1 SMESG000014849.1 Contig13526newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028938SMESG000077847.1 SMESG000072336.1 SMESG000044971.1 SMESG000033570.1 SMESG000031842.1 SMESG000026563.1 SMESG000017020.1 SMESG000014849.1 Contig13526uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30028938SMESG000077847.1 SMESG000072336.1 SMESG000044971.1 SMESG000033570.1 SMESG000031842.1 SMESG000026563.1 SMESG000017020.1 SMESG000014849.1 Contig13526newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30028938SMESG000077847.1 SMESG000072336.1 SMESG000044971.1 SMESG000033570.1 SMESG000031842.1 SMESG000026563.1 SMESG000017020.1 SMESG000014849.1 Contig13526uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30028938SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028938SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30028938SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028938SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028938SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30028938SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Human
Match: PDIA6 (protein disulfide isomerase family A member 6 [Source:HGNC Symbol;Acc:HGNC:30168])

HSP 1 Score: 471.47 bits (1212), Expect = 4.541e-163
Identity = 249/435 (57.24%), Postives = 309/435 (71.03%), Query Frame = 3
Query:  120 LSIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            L +V   F LA  N   +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L PEWKKAATALK VVKVGAVD DK+ SLG  YG+QGFPTIKIFG +K+ P+DYQG RT  +IV+AAL  L +LV+ RLGG SGG SS ++  S  SS    DV+ELTD +FD+ VL SE+ W+VEF+APWCGHCKNL+P W  AASE++    GKVKL A+DATV+   ASRYG++G+PTIK F  G       DYDGGR+ SDIV  A D   +  P PE+ EI+N++I K  CE+HQLCVVAVLP+ILD  +  RN Y+  L    DKYK   WGWLWTEA    ELE   GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGST+ + G   PTI   EPWDG+DGE+P E++IDLS++ +++
Sbjct:    3 LGLVSCTFFLA-VNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKK--DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESP---VDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD 431          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Human
Match: PDIA6 (protein disulfide isomerase family A member 6 [Source:HGNC Symbol;Acc:HGNC:30168])

HSP 1 Score: 471.085 bits (1211), Expect = 6.540e-163
Identity = 249/435 (57.24%), Postives = 309/435 (71.03%), Query Frame = 3
Query:  120 LSIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            L +V   F LA  N   +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L PEWKKAATALK VVKVGAVD DK+ SLG  YG+QGFPTIKIFG +K+ P+DYQG RT  +IV+AAL  L +LV+ RLGG SGG SS ++  S  SS    DV+ELTD +FD+ VL SE+ W+VEF+APWCGHCKNL+P W  AASE++    GKVKL A+DATV+   ASRYG++G+PTIK F  G       DYDGGR+ SDIV  A D   +  P PE+ EI+N++I K  CE+HQLCVVAVLP+ILD  +  RN Y+  L    DKYK   WGWLWTEA    ELE   GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGST+ + G   PTI   EPWDG+DGE+P E++IDLS++ +++
Sbjct:    6 LGLVSCTFFLA-VNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKK--DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESP---VDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD 434          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Human
Match: PDIA6 (protein disulfide isomerase family A member 6 [Source:HGNC Symbol;Acc:HGNC:30168])

HSP 1 Score: 470.7 bits (1210), Expect = 1.324e-162
Identity = 245/432 (56.71%), Postives = 306/432 (70.83%), Query Frame = 3
Query:  129 VLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            ++ C      N   +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L PEWKKAATALK VVKVGAVD DK+ SLG  YG+QGFPTIKIFG +K+ P+DYQG RT  +IV+AAL  L +LV+ RLGG SGG SS ++  S  SS    DV+ELTD +FD+ VL SE+ W+VEF+APWCGHCKNL+P W  AASE++    GKVKL A+DATV+   ASRYG++G+PTIK F  G       DYDGGR+ SDIV  A D   +  P PE+ EI+N++I K  CE+HQLCVVAVLP+ILD  +  RN Y+  L    DKYK   WGWLWTEA    ELE   GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGST+ + G   PTI   EPWDG+DGE+P E++IDLS++ +++
Sbjct:   13 LVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKK--DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESP---VDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD 439          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Human
Match: PDIA6 (protein disulfide isomerase family A member 6 [Source:HGNC Symbol;Acc:HGNC:30168])

HSP 1 Score: 471.855 bits (1213), Expect = 1.731e-162
Identity = 246/433 (56.81%), Postives = 309/433 (71.36%), Query Frame = 3
Query:  129 VLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQ-DYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            ++ C      N   +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L PEWKKAATALK VVKVGAVD DK+ SLG  YG+QGFPTIKIFG +K+ P+DYQG RT  +IV+AAL  L +LV+ RLGG SGG SS ++  S  SS    DV+ELTD +FD+ VL SE+ W+VEF+APWCGHCKNL+P W  AASE++    GKVKL A+DATV+   ASRYG++G+PTIK F    + G+S  DYDGGR+ SDIV  A D   +  P PE+ EI+N++I K  CE+HQLCVVAVLP+ILD  +  RN Y+  L    DKYK   WGWLWTEA    ELE   GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGST+ + G   PTI   EPWDG+DGE+P E++IDLS++ +++
Sbjct:   56 LVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKK--DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIF----QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD 482          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Human
Match: PDIA6 (protein disulfide isomerase family A member 6 [Source:HGNC Symbol;Acc:HGNC:30168])

HSP 1 Score: 469.929 bits (1208), Expect = 1.358e-161
Identity = 246/433 (56.81%), Postives = 309/433 (71.36%), Query Frame = 3
Query:  129 VLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQ-DYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            ++ C      N   +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L PEWKKAATALK VVKVGAVD DK+ SLG  YG+QGFPTIKIFG +K+ P+DYQG RT  +IV+AAL  L +LV+ RLGG SGG SS ++  S  SS    DV+ELTD +FD+ VL SE+ W+VEF+APWCGHCKNL+P W  AASE++    GKVKL A+DATV+   ASRYG++G+PTIK F    + G+S  DYDGGR+ SDIV  A D   +  P PE+ EI+N++I K  CE+HQLCVVAVLP+ILD  +  RN Y+  L    DKYK   WGWLWTEA    ELE   GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGST+ + G   PTI   EPWDG+DGE+P E++IDLS++ +++
Sbjct:   60 LVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKK--DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIF----QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD 486          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Celegans
Match: pdi-6 (Protein disulfide-isomerase A6 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q11067])

HSP 1 Score: 475.322 bits (1222), Expect = 6.863e-165
Identity = 230/425 (54.12%), Postives = 306/425 (72.00%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNF-NEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXX---XDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKE 1373
            M  + ++L   A+       ++++ V+ LT +NF ++VI  +   +VEFYAPWCGHC+SL PE+KKAA+ALKGV KVGAVDM ++ S+G PY +QGFPT+KIFG  K  P DY G+RTA +I ++ L E  + V +RLGG S GSSS    S  G  G G    +VVELTD+NF+++VL S++ WLVEFFAPWCGHCK+L+P W  AASEL+GKV+LGALDATVHT  A+++ ++G+PTIK+F  G    D+QDYDGGR SSDIV WAS +  E +PAPE+ E +NQ++++ AC++ QLC+ A LP+ILDCQS+CRN+Y+A LK   +K+K N WGW+W E    P LE  F +GGFGYPA+  +N RK KYA L G F + GI +F+RD+S G+G TS + GDG P I+  E WDGKDG +P E
Sbjct:    1 MALIKLLLASLAITSVCGMYSKKDDVVELTEANFQSKVINSDDIWIVEFYAPWCGHCKSLVPEYKKAASALKGVAKVGAVDMTQHQSVGGPYNVQGFPTLKIFGADKKKPTDYNGQRTAQAIADSVLAEAKKAVSARLGGKSSGSSSSGSGSGSGKRGGGGSGNEVVELTDANFEDLVLNSKDIWLVEFFAPWCGHCKSLEPQWKAAASELKGKVRLGALDATVHTVVANKFAIRGFPTIKYFAPGSDVSDAQDYDGGRQSSDIVAWASARAQENMPAPEVFEGINQQVVEDACKEKQLCIFAFLPHILDCQSECRNNYLAMLKEQSEKFKKNLWGWIWVEGAAQPALEESFEVGGFGYPAMTALNFRKNKYAVLKGSFGKDGIHEFLRDLSYGKGRTSSLRGDGFPKIQKTEKWDGKDGALPAE 425          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Celegans
Match: Y49E10.4 (pep chromosome:WBcel235:III:12378724:12380647:-1 gene:WBGene00013030.1 transcript:Y49E10.4.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y49E10.4)

HSP 1 Score: 372.474 bits (955), Expect = 9.424e-125
Identity = 188/439 (42.82%), Postives = 279/439 (63.55%), Query Frame = 3
Query:  129 VLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHS-PKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSG-DSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIH----GDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEEPKSEL 1424
            +L  FA++  +   T ++ V  LT+SNF+ +V++ ++  +VEFYAP+CGHC+SL PE+KKAA  LKG+ ++GA+D   +  +   Y I+G+PTIKIFG ++ S P DY G RTA  I +A  K +++ +  RL G S   S    K           VV LTDSNFD++VL S+EPW+VEFFAPWCGHC+ L+P W +AA E+ G+VK GALDAT H + A ++G++G+PTIKFF  G  S  D++DY GGR+S+D++ +A  K  +   APE+ E   + ++++ C+D QLC+   LP+I DCQS+CR   I  L      +K   +GW+W E      ++  F IG +G+P L+ ++ +KM Y+T  G FS  GI++F+  V+ G+G    I      +    I   +PWDGKD E+P  E+IDLS++ ++E K+EL
Sbjct:    7 ILLVFAISGSSTFYTAKDSVFELTDSNFDAKVLKSDRIWIVEFYAPYCGHCKSLVPEYKKAAKLLKGIAEIGAIDATVHQKIPLKYSIKGYPTIKIFGATEKSKPIDYNGPRTAKGIADAVKKSIEKSLEQRLKGKSSEKSKKSDKKGK--------VVVLTDSNFDKLVLNSKEPWMVEFFAPWCGHCQKLEPEWKKAAEEMGGRVKFGALDATAHESIAQKFGIRGFPTIKFFAPGTSSASDAEDYQGGRTSTDLISYAESKYDDFGAAPEVVEGTGKAVVETVCKDKQLCIFTFLPSIFDCQSKCRKQKIDMLNELATIFKKRSFGWVWMEGGAQENVQRAFEIGDYGFPVLIAMSPKKMMYSTQIGQFSVDGIKEFLNAVNYGKGRVLEIKPTHLSNNFLKIVETQPWDGKDKELPVMEDIDLSDVDMDE-KTEL 436          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Celegans
Match: Y49E10.4 (pep chromosome:WBcel235:III:12379000:12380647:-1 gene:WBGene00013030.1 transcript:Y49E10.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y49E10.4)

HSP 1 Score: 372.474 bits (955), Expect = 9.424e-125
Identity = 188/439 (42.82%), Postives = 279/439 (63.55%), Query Frame = 3
Query:  129 VLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHS-PKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSG-DSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIH----GDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEEPKSEL 1424
            +L  FA++  +   T ++ V  LT+SNF+ +V++ ++  +VEFYAP+CGHC+SL PE+KKAA  LKG+ ++GA+D   +  +   Y I+G+PTIKIFG ++ S P DY G RTA  I +A  K +++ +  RL G S   S    K           VV LTDSNFD++VL S+EPW+VEFFAPWCGHC+ L+P W +AA E+ G+VK GALDAT H + A ++G++G+PTIKFF  G  S  D++DY GGR+S+D++ +A  K  +   APE+ E   + ++++ C+D QLC+   LP+I DCQS+CR   I  L      +K   +GW+W E      ++  F IG +G+P L+ ++ +KM Y+T  G FS  GI++F+  V+ G+G    I      +    I   +PWDGKD E+P  E+IDLS++ ++E K+EL
Sbjct:    7 ILLVFAISGSSTFYTAKDSVFELTDSNFDAKVLKSDRIWIVEFYAPYCGHCKSLVPEYKKAAKLLKGIAEIGAIDATVHQKIPLKYSIKGYPTIKIFGATEKSKPIDYNGPRTAKGIADAVKKSIEKSLEQRLKGKSSEKSKKSDKKGK--------VVVLTDSNFDKLVLNSKEPWMVEFFAPWCGHCQKLEPEWKKAAEEMGGRVKFGALDATAHESIAQKFGIRGFPTIKFFAPGTSSASDAEDYQGGRTSTDLISYAESKYDDFGAAPEVVEGTGKAVVETVCKDKQLCIFTFLPSIFDCQSKCRKQKIDMLNELATIFKKRSFGWVWMEGGAQENVQRAFEIGDYGFPVLIAMSPKKMMYSTQIGQFSVDGIKEFLNAVNYGKGRVLEIKPTHLSNNFLKIVETQPWDGKDKELPVMEDIDLSDVDMDE-KTEL 436          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Celegans
Match: C14B9.2 (Probable protein disulfide-isomerase A4 [Source:UniProtKB/Swiss-Prot;Acc:P34329])

HSP 1 Score: 183.341 bits (464), Expect = 1.530e-50
Identity = 105/282 (37.23%), Postives = 160/282 (56.74%), Query Frame = 3
Query:   96 VLF*KMKYLSIVLFCFALAQCNADITEEE-------GVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRG---KVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDK 911
            ++F +  +  +VL C +  +   D +++E       GV+VLT+ NF+  ++KN  VLV+FYAPWCGHC+ LAPE++KA++  K  + +  VD    + LG+ + IQG+PT+K F K    P DY G R    IV        E V SR+                       +VV LT  NFD+ +  + E  LVEF+APWCGHCK L P +++AA +L+    KVKLG +DAT+     ++YGV GYPT+K     +++G   DY+G R ++ I+++ +D+
Sbjct:    1 MMFDRRFFALVVLLCVSAVRSTEDASDDELNYEMDEGVVVLTDKNFDAFLKKNPSVLVKFYAPWCGHCKHLAPEYEKASS--KVSIPLAKVDATVETELGKRFEIQGYPTLK-FWKDGKGPNDYDGGRDEAGIV--------EWVESRV--------------DPNYKPPPEEVVTLTTENFDDFI-SNNELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATIEKDLGTKYGVSGYPTMKI----IRNGRRFDYNGPREAAGIIKYMTDQ 252          

HSP 2 Score: 76.6406 bits (187), Expect = 1.805e-14
Identity = 40/101 (39.60%), Postives = 62/101 (61.39%), Query Frame = 3
Query:  612 SNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRG---KVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWAS 905
            SNFD++V    +  L+EF+APWCGHCK+ +  + + A  L+     V L  +DAT++ A  S++ V+G+PTI F PAG KS +   Y G R   D+ ++ +
Sbjct:  507 SNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDATINDA-PSQFAVEGFPTIYFAPAGKKS-EPIKYSGNRDLEDLKKFMT 605          

HSP 3 Score: 61.2326 bits (147), Expect = 1.269e-9
Identity = 36/96 (37.50%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  186 VLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHS-PKDYQGER 458
            V  +  SNF++++ +++K VL+EFYAPWCGHC+S   ++ + A ALK     V +  +D     +  Q + ++GFPTI      K S P  Y G R
Sbjct:  501 VKTVVGSNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDATINDAPSQ-FAVEGFPTIYFAPAGKKSEPIKYSGNR 595          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 114.39 bits (285), Expect = 1.221e-27
Identity = 56/118 (47.46%), Postives = 77/118 (65.25%), Query Frame = 3
Query:  132 LFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            LF   L    A I EEE V+VLT  NF+EVI  N+++LVEFYAPWCGHC+SLAPE+ KAAT LK     +K+G +D   +  +   + ++G+PT+K+F   K  P++Y G R   SI+
Sbjct:    7 LFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGK--PQEYNGGRDHDSII 122          

HSP 2 Score: 107.842 bits (268), Expect = 2.496e-25
Identity = 57/141 (40.43%), Postives = 84/141 (59.57%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR---GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVV 1004
            +V+ LT  NFDE V+   E  LVEF+APWCGHCK+L P + +AA++L+     +KLG LDATVH   +S++ V+GYPT+K F    ++G  Q+Y+GGR    I+ W   K       P  K + + + +K   E   + V+
Sbjct:   24 NVIVLTKDNFDE-VINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLF----RNGKPQEYNGGRDHDSIIAWLKKKT-----GPVAKPLADADAVKELQESADVVVI 154          

HSP 3 Score: 77.411 bits (189), Expect = 3.934e-15
Identity = 40/93 (43.01%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKN-KYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            V +L   NF +V   N K VLVEFYAPWCGHC+ LAP W K          +    MD   +  +   IQ FPTIK F    +   DY G+RT
Sbjct:  243 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRT 335          

HSP 4 Score: 73.9442 bits (180), Expect = 5.960e-14
Identity = 36/101 (35.64%), Postives = 56/101 (55.45%), Query Frame = 3
Query:  603 LTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRG--KVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRW 899
            L   NF+++   + +  LVEF+APWCGHCK L P WD+   +      + +  +D+T++     +  +Q +PTIKFFPAG  S    DY G R+     ++
Sbjct:  246 LVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVK--IQSFPTIKFFPAG--SNKVVDYTGDRTIEGFTKF 342          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Fly
Match: CaBP1 (gene:FBgn0025678 transcript:FBtr0345544)

HSP 1 Score: 461.07 bits (1185), Expect = 2.464e-159
Identity = 235/420 (55.95%), Postives = 306/420 (72.86%), Query Frame = 3
Query:  123 SIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVK-SGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEE 1376
            SI+L  F +   +A  +  +GV+ LT SNF+ EV++ +   +VEFYAPWCGHCQSL PE+KK A ALKGVVKVG+V+ D  S+L   +G++GFPTIKIFG +K SP DY G+RTA +I  AAL E+ + V+  LGG  G SS     SSG       DV+ELT+ NFD++VL S++ WLVEFFAPWCGHCKNL P W +AA EL+GKVKLGALDAT H + A+ Y V+GYPTIKFFPAG K + D+Q+YDGGR++SDIV WASDK V  +PAPE+ EI+N+   ++ACE   LCVV+VLP+ILDC ++CRN ++ TL+  G+K+K  +WGW W E  +   LE    +GGFGYPA+ VVN +KMK++ L G FS+ GI +F+RD+S GRG T+ + G   P I SV+PWDGKDG++P EE
Sbjct:    6 SILLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGD------DVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINESTFETACEGKPLCVVSVLPHILDCDAKCRNKFLDTLRTLGEKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNFKKMKFSVLKGSFSKDGINEFLRDISYGRGHTAPVRGAKKPAIVSVDPWDGKDGQLPTEE 419          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Fly
Match: CaBP1 (gene:FBgn0025678 transcript:FBtr0080837)

HSP 1 Score: 461.07 bits (1185), Expect = 2.464e-159
Identity = 235/420 (55.95%), Postives = 306/420 (72.86%), Query Frame = 3
Query:  123 SIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVK-SGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEE 1376
            SI+L  F +   +A  +  +GV+ LT SNF+ EV++ +   +VEFYAPWCGHCQSL PE+KK A ALKGVVKVG+V+ D  S+L   +G++GFPTIKIFG +K SP DY G+RTA +I  AAL E+ + V+  LGG  G SS     SSG       DV+ELT+ NFD++VL S++ WLVEFFAPWCGHCKNL P W +AA EL+GKVKLGALDAT H + A+ Y V+GYPTIKFFPAG K + D+Q+YDGGR++SDIV WASDK V  +PAPE+ EI+N+   ++ACE   LCVV+VLP+ILDC ++CRN ++ TL+  G+K+K  +WGW W E  +   LE    +GGFGYPA+ VVN +KMK++ L G FS+ GI +F+RD+S GRG T+ + G   P I SV+PWDGKDG++P EE
Sbjct:    6 SILLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGD------DVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINESTFETACEGKPLCVVSVLPHILDCDAKCRNKFLDTLRTLGEKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNFKKMKFSVLKGSFSKDGINEFLRDISYGRGHTAPVRGAKKPAIVSVDPWDGKDGQLPTEE 419          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Fly
Match: CG9302 (gene:FBgn0032514 transcript:FBtr0080470)

HSP 1 Score: 130.183 bits (326), Expect = 3.168e-32
Identity = 87/255 (34.12%), Postives = 132/255 (51.76%), Query Frame = 3
Query:  159 NADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVG---AVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRG--KVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASD 908
            +AD   E  ++ LT+  F   ++  K  LV FYAPWCGHC+ + PE++KAA  +K     G   A+D  K  S+ + Y ++G+PT+K F  S    K     R A  IV        E +R               + S        +V+ L D NF    LK ++  LV F+APWCGHCK+ KP +  AA+ L+   ++   A+D T   A  ++Y V+GYPTI +F + +K+    DY+GGR+S D + + ++
Sbjct:  266 SADTNSE--IVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFF--SNGVFKFEVNVREASKIV--------EFMRDP----KEPPPPPPPEKSWEEEEDSKEVLFLDDDNFSS-TLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDCTKLAALCAKYNVRGYPTILYF-SYLKT--KLDYNGGRTSKDFIAYMNN 500          

HSP 2 Score: 120.553 bits (301), Expect = 6.935e-29
Identity = 82/245 (33.47%), Postives = 129/245 (52.65%), Query Frame = 3
Query:  204 SNFNEVIEKN-KYVLVEFYAPWCGHCQSLAPEWKKAATALKG----VVKVGAVDMDKYSSLGQPYGIQGFPTIKIF--GKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKV---KLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASD 908
            ++F + + K+ + +LV FY PWCG C+ + PE+ KA+T LK     ++    V+  + + + + + I GFPT+  F  GK + +   Y+GE    ++V+  L                   + + K    S+ +  ++V LT   F E  LK E+  LV F+APWCGHCK +KP +++AA E++ K     L ALDAT   + A +Y V+GYPT+KFF  GV   +       R +S IV +  D
Sbjct:  152 ASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFT---YEGENNKEALVSFMLNP-------------NAKPTPKPKEPEWSADTNSEIVHLTSQGF-EPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEV----NVREASKIVEFMRD 375          

HSP 3 Score: 58.9214 bits (141), Expect = 7.383e-9
Identity = 34/121 (28.10%), Postives = 61/121 (50.41%), Query Frame = 3
Query:  591 DVVELTDS-NFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK--VKLGALDATVHTATASR--YGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPE 938
            DV+  +D+ +F + + K   P LV F+ PWCG CK +KP + +A++EL+ K    L A++         R  + + G+PT+ +F  G        Y+G  +   +V +  +   +  P P+
Sbjct:  144 DVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRF---TYEGENNKEALVSFMLNPNAKPTPKPK 261          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0346644)

HSP 1 Score: 108.997 bits (271), Expect = 4.418e-25
Identity = 56/128 (43.75%), Postives = 77/128 (60.16%), Query Frame = 3
Query:  111 MKYLSIVLF---CFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL---KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            MK+L   LF    +  A   A++  EEGVLV T  NF ++I  N++VLVEFYAPWCGHC++LAPE+ KAA  L   +  +K+  VD      L + Y ++G+PT+K F     SP +Y G R A  I+
Sbjct:    1 MKFLICALFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSG--SPVEYSGGRQAADII 126          

HSP 2 Score: 98.2117 bits (243), Expect = 1.682e-21
Identity = 52/146 (35.62%), Postives = 84/146 (57.53%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNI 1022
            V+  T  NF +++  +E   LVEF+APWCGHCK L P + +AA +L  K   +KL  +DATV    A +Y V+GYPT+KFF    +SG   +Y GGR ++DI+ W + K       P  K++ +    +   +D+++ ++    ++
Sbjct:   29 VLVATVDNFKQLIADNE-FVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFF----RSGSPVEYSGGRQAADIIAWVTKKT-----GPPAKDLTSVADAEQFLKDNEIAIIGFFKDL 164          

HSP 3 Score: 77.0258 bits (188), Expect = 1.241e-14
Identity = 41/98 (41.84%), Postives = 55/98 (56.12%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            V VL +SNF  V ++K+K VLVEFYAPWCGHC+ LAP + + A   K    +    MD  ++  +   I  FPTIK F K  +   D+  +RT    V
Sbjct:  369 VKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFV 466          

HSP 4 Score: 67.781 bits (164), Expect = 1.144e-11
Identity = 34/103 (33.01%), Postives = 59/103 (57.28%), Query Frame = 3
Query:  603 LTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK--VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQ--DYDGGRSSSDIVRW 899
            L  SNF+ + L   +  LVEF+APWCGHCK L P +DQ A + +    + +  +D+T +   + +  +  +PTIK+F    +  D++  D++  R+  D V++
Sbjct:  372 LVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIK--ISSFPTIKYF----RKEDNKVIDFNLDRTLDDFVKF 468          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0075648)

HSP 1 Score: 108.997 bits (271), Expect = 4.418e-25
Identity = 56/128 (43.75%), Postives = 77/128 (60.16%), Query Frame = 3
Query:  111 MKYLSIVLF---CFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL---KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            MK+L   LF    +  A   A++  EEGVLV T  NF ++I  N++VLVEFYAPWCGHC++LAPE+ KAA  L   +  +K+  VD      L + Y ++G+PT+K F     SP +Y G R A  I+
Sbjct:    1 MKFLICALFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSG--SPVEYSGGRQAADII 126          

HSP 2 Score: 98.2117 bits (243), Expect = 1.682e-21
Identity = 52/146 (35.62%), Postives = 84/146 (57.53%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNI 1022
            V+  T  NF +++  +E   LVEF+APWCGHCK L P + +AA +L  K   +KL  +DATV    A +Y V+GYPT+KFF    +SG   +Y GGR ++DI+ W + K       P  K++ +    +   +D+++ ++    ++
Sbjct:   29 VLVATVDNFKQLIADNE-FVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFF----RSGSPVEYSGGRQAADIIAWVTKKT-----GPPAKDLTSVADAEQFLKDNEIAIIGFFKDL 164          

HSP 3 Score: 77.0258 bits (188), Expect = 1.241e-14
Identity = 41/98 (41.84%), Postives = 55/98 (56.12%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            V VL +SNF  V ++K+K VLVEFYAPWCGHC+ LAP + + A   K    +    MD  ++  +   I  FPTIK F K  +   D+  +RT    V
Sbjct:  369 VKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFV 466          

HSP 4 Score: 67.781 bits (164), Expect = 1.144e-11
Identity = 34/103 (33.01%), Postives = 59/103 (57.28%), Query Frame = 3
Query:  603 LTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK--VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQ--DYDGGRSSSDIVRW 899
            L  SNF+ + L   +  LVEF+APWCGHCK L P +DQ A + +    + +  +D+T +   + +  +  +PTIK+F    +  D++  D++  R+  D V++
Sbjct:  372 LVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIK--ISSFPTIKYF----RKEDNKVIDFNLDRTLDDFVKF 468          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Zebrafish
Match: pdia6 (protein disulfide isomerase family A, member 6 [Source:ZFIN;Acc:ZDB-GENE-030131-879])

HSP 1 Score: 470.315 bits (1209), Expect = 1.016e-162
Identity = 239/427 (55.97%), Postives = 305/427 (71.43%), Query Frame = 3
Query:  111 MKYLSIVLFC-FALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKE 1373
            M+ L  VL C   +       T  + V+ L  SNFN EVI+ +   LVEFYAPWCGHC+SLAPEWKKAATALKG+VKVGAVD D+++SLG  YG++GFPTIKIFG +KH P+DYQG RT  +IV+AAL  L  LV+ RLGG +GGS    +   G  +    DVVELTD NFD  VL+S++ WLVEFFAPWCGHCKNL+P W  AA+E++    GKVKL A+DATVH   ASR+G++G+PTIK F  G    + +DY GGR+ SDIV  A +   + +PAPE++E+LN+ ILK  CED+QLC++AVLP+ILD  +  RN Y+  +K   +KYK   WGWLWTEA    ELE   GIGGFGYPA+  +N RKMK+A L G FS++GI +F+R++S+GRGST+ + G  LP I +V+ WDGKDGE+P E
Sbjct:    1 MRALLGVLACSLTVLSAYGLYTSSDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCKSLAPEWKKAATALKGIVKVGAVDADQHNSLGGQYGVRGFPTIKIFGGNKHKPEDYQGGRTNQAIVDAALNALRSLVKDRLGGKTGGSDYSRQSGGGAGNKK--DVVELTDDNFDRTVLESDDVWLVEFFAPWCGHCKNLEPEWTAAATEVKEQTKGKVKLAAVDATVHQGLASRFGIRGFPTIKVFRKGE---EPEDYQGGRTRSDIVARALELYSDNIPAPELQEVLNEGILKKTCEDYQLCIIAVLPHILDTGASGRNSYLEVMKTMAEKYKKKMWGWLWTEAGAQMELEASLGIGGFGYPAMAAINSRKMKFALLKGSFSETGIHEFLRELSVGRGSTATVGGGALPKINTVQAWDGKDGELPME 422          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Zebrafish
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 173.711 bits (439), Expect = 9.606e-47
Identity = 101/254 (39.76%), Postives = 141/254 (55.51%), Query Frame = 3
Query:  168 ITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDK 911
            + EE GVLVLT++NF+  IE    VLVEFYAPWCGHC+  APE++K A  LK     + V  VD  K S LG  + + G+PTIKI  K +  P DY G+R+  +IV    + + E+ +                            + LT  NFD+ V+ + +  LVEF+APWCGHCK L P +++AA EL  +   + L  +DAT  +  A+R+GV GYPT+K F    + G + DY+G R    IV + SD+
Sbjct:   55 VKEENGVLVLTDANFDTFIEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQTLKENDPPIPVAKVDATKASGLGSRFEVSGYPTIKILKKGE--PLDYDGDRSEHAIV----ERVKEVAQPDWKPPPEA------------------TLVLTKDNFDD-VVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPIPLAKVDATAESDLATRFGVSGYPTLKIF----RKGKAFDYNGPREKFGIVDYMSDQ 279          

HSP 2 Score: 94.3597 bits (233), Expect = 6.195e-20
Identity = 76/235 (32.34%), Postives = 110/235 (46.81%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQ---LPAPEIKEILNQEILKSACEDHQLCVVAVL-PNILDCQSQCRNDYIATLKVAGDKYKSNRWGWL---WTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRD 1268
            V+ LTD+NFD  + + ++  LVEF+APWCGHCK   P +++ A  L+     + +  +DAT  +   SR+ V GYPTIK     +K G+  DYDG RS   IV     K V Q    P PE   +L ++       +  + +V    P    C+       +A       K  SNR   +     +A    +L   FG+   GYP L +   RK K     GP  + GI D++ D
Sbjct:   61 VLVLTDANFDTFI-EGKDTVLVEFYAPWCGHCKQFAPEYEKIAQTLKENDPPIPVAKVDATKASGLGSRFEVSGYPTIKI----LKKGEPLDYDGDRSEHAIVERV--KEVAQPDWKPPPEATLVLTKDNFDDVVNNADIILVEFYAPWCGHCKR------LAPEYEKAAKELSNRTPPIPLAKVDATAESDLATRFGVS--GYPTLKI--FRKGKAFDYNGPREKFGIVDYMSD 278          

HSP 3 Score: 94.3597 bits (233), Expect = 6.419e-20
Identity = 52/127 (40.94%), Postives = 69/127 (54.33%), Query Frame = 3
Query:  180 EGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVN-------------AALKELDELVR 512
            E  LVLT  NF++V+     +LVEFYAPWCGHC+ LAPE++KAA  L      + +  VD    S L   +G+ G+PT+KIF K K    DY G R    IV+               LK++ EL+R
Sbjct:  174 EATLVLTKDNFDDVVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPIPLAKVDATAESDLATRFGVSGYPTLKIFRKGKAF--DYNGPREKFGIVDYMSDQAGPPSKQVQTLKQVQELLR 298          

HSP 4 Score: 71.2478 bits (173), Expect = 1.292e-12
Identity = 33/89 (37.08%), Postives = 53/89 (59.55%), Query Frame = 3
Query:  615 NFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKL--GALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGR 875
             FDE+V+ S++  L+EF+APWCGHCK L+P +     + + +  L    +DAT +      Y V+G+PTI F P+  K    + ++GG+
Sbjct:  531 TFDEIVMDSKKDVLIEFYAPWCGHCKKLEPDYISLGKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTIYFAPSNNKQNPIK-FEGGK 618          

HSP 5 Score: 57.7658 bits (138), Expect = 2.334e-8
Identity = 33/94 (35.11%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  186 VLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSS--LGQPYGIQGFPTIKIFGKS--KHSPKDYQG 452
            V V+    F+E++ +  K VL+EFYAPWCGHC+ L P++       K    +    MD  ++      Y ++GFPTI  F  S  K +P  ++G
Sbjct:  524 VKVVVGKTFDEIVMDSKKDVLIEFYAPWCGHCKKLEPDYISLGKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTI-YFAPSNNKQNPIKFEG 616          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Zebrafish
Match: dnajc10 (DnaJ (Hsp40) homolog, subfamily C, member 10 [Source:ZFIN;Acc:ZDB-GENE-070327-1])

HSP 1 Score: 133.65 bits (335), Expect = 1.216e-32
Identity = 68/223 (30.49%), Postives = 111/223 (49.78%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKNKYV---LVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQG----ERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPA 833
            V+ L   +F E++++ K     +V+FYAPWCG CQ+L PEW++ A  L G+V VG VD  K+ S  Q   ++ +P I++F ++ +    YQ      R A S+   AL  L                                 V+L+  +F   VL  ++ W+++F+APWCG C+   P ++  A  ++G V+ G +D   H  T    G++ YPT++F+P 
Sbjct:  554 VVTLGPESFQELVKRRKSSETWMVDFYAPWCGPCQALLPEWRRMARMLSGIVNVGTVDCQKHHSFCQSESVRAYPEIRLFPQNSNRRDQYQTYNGWHRDAFSLKAWALSSLPRA-----------------------------SVDLSPEDFKRKVLGGKDHWVLDFYAPWCGPCQQFAPEFEVLARMMKGTVRAGKVDCQAHYQTCQSAGIKAYPTVRFYPT 747          

HSP 2 Score: 122.865 bits (307), Expect = 4.262e-29
Identity = 76/224 (33.93%), Postives = 108/224 (48.21%), Query Frame = 3
Query:  243 LVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMV--LKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDS-QDYDG-GRSSSDIVRWA 902
            LV+F+APWC  C++L PE +KA+  L G +K G +D   +  L   Y I  +PT  IF KS  S  +Y+G  +A  I    L+ +++LV                            VV L   +F E+V   KS E W+V+F+APWCG C+ L P W + A  L G V +G +D   H +      V+ YP I+ FP      D  Q Y+G  R +  +  WA
Sbjct:  468 LVDFFAPWCPPCRALLPELRKASIQLFGQLKFGTLDCTIHEGLCNTYNIHAYPTTVIFNKS--SIHEYEGHHSADGI----LEFIEDLVNPV-------------------------VVTLGPESFQELVKRRKSSETWMVDFYAPWCGPCQALLPEWRRMARMLSGIVNVGTVDCQKHHSFCQSESVRAYPEIRLFPQNSNRRDQYQTYNGWHRDAFSLKAWA 660          

HSP 3 Score: 77.411 bits (189), Expect = 1.811e-14
Identity = 65/243 (26.75%), Postives = 101/243 (41.56%), Query Frame = 3
Query:  192 VLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV-VKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKV 914
            +LT S+F   +  +++ LV F     G     + E+KK    LK   ++VG VD    S L     I   P + +F G   H  + + G+    ++V  A + ++                               V  L   NF       +EPWLV+FFAPWC  C+ L P   +A+ +L G++K G LD T+H    + Y +  YPT   F          +Y+G  S+  I+ +  D V
Sbjct:  349 ILTKSSFEHKLAHHRW-LVSFSF---GRNDLASHEYKKLNALLKNSHIQVGKVDCISDSELCSSLYIHK-PCVAVFKGVGIHDFEIHHGKDALYNVVAFAKESVN-----------------------------AHVTTLRPENFPN---HEKEPWLVDFFAPWCPPCRALLPELRKASIQLFGQLKFGTLDCTIHEGLCNTYNIHAYPTTVIF----NKSSIHEYEGHHSADGILEFIEDLV 550          

HSP 4 Score: 70.0922 bits (170), Expect = 4.179e-12
Identity = 30/102 (29.41%), Postives = 55/102 (53.92%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALK 491
            +  L   +F+  +   +   V FY P C HC  LAP W++ A  + GV+++GAV+      L +  GI  +P++ +F ++  +P+ Y  +RT  S+   A++
Sbjct:  130 ITTLDRGDFDAAVNSGEVWFVNFYFPRCSHCHDLAPTWREFAKEMDGVIRIGAVNCGDNGMLCRSKGINSYPSLYVF-RAGMNPEKYFNDRTKSSLTKFAMQ 230          

HSP 5 Score: 67.0106 bits (162), Expect = 3.691e-11
Identity = 35/97 (36.08%), Postives = 53/97 (54.64%), Query Frame = 3
Query:  228 KNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGE----RTAGSIVNAALKELDEL 506
            K+ +VL +FYAPWCG CQ  APE++  A  +KG V+ G VD   +    Q  GI+ +PT++ +     + +D  GE    R A  I +   + L +L
Sbjct:  684 KDHWVL-DFYAPWCGPCQQFAPEFEVLARMMKGTVRAGKVDCQAHYQTCQSAGIKAYPTVRFYPTLGTTRRDQGGEHINSRDATVIADILRQRLQQL 779          

HSP 6 Score: 63.5438 bits (153), Expect = 4.141e-10
Identity = 31/104 (29.81%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWA 902
            ++  L   +FD  V  S E W V F+ P C HC +L P W + A E+ G +++GA++   +       G+  YP++  F AG+   + + Y   R+ S + ++A
Sbjct:  129 EITTLDRGDFDAAV-NSGEVWFVNFYFPRCSHCHDLAPTWREFAKEMDGVIRIGAVNCGDNGMLCRSKGINSYPSLYVFRAGM---NPEKYFNDRTKSSLTKFA 228          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Zebrafish
Match: txndc5 (thioredoxin domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1951])

HSP 1 Score: 128.642 bits (322), Expect = 4.039e-32
Identity = 82/254 (32.28%), Postives = 135/254 (53.15%), Query Frame = 3
Query:  180 EGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK--GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQ-AASELRG--KVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRS----SSDIVRWASDKV 914
            +G+  LT +NF   I K  +  V+F+APWCGHC+++AP W++ A++ +    +K+  VD  ++  +     ++G+PT+  F   +   + Y+G+R   S        + +   S+         +HE   S        +V+ LT+SNFDE V K      ++F+APWCGHCKNL P WD  +  E  G   VK+  +D TV     +R+ V+GYPT+  F AG +    ++++GGR      S I++ A D++
Sbjct:  158 QGLYELTATNFKSHIAKGSH-FVKFFAPWCGHCKAMAPTWEQLASSFEHSDSIKISKVDCTQHYEVCSDNQVRGYPTLLFFTDGEKIDQ-YKGKRDLDSFKEFVDNHV-KAAESKDEPEKEEEHTHEIPPSAEPEKQESNVLVLTESNFDETVAKGLS--FIKFYAPWCGHCKNLAPTWDDLSQKEFPGLTDVKIAKVDCTVERTLCNRFSVRGYPTLLMFRAGQQ---GEEHNGGRDLESLHSFIMKQARDEL 403          

HSP 2 Score: 126.716 bits (317), Expect = 2.022e-31
Identity = 100/311 (32.15%), Postives = 138/311 (44.37%), Query Frame = 3
Query:  117 YLSIVLFCFALAQCNADITEEEGV-LVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG-------VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAAS--ELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASD--KVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVL 1013
            ++ + L C  L+ C+ D  E+E      T   FN+ I    +  V F+APWCGHCQ L   W + A            VVKV      K+ S+   +GI+G+PT+K+F   + + K YQG R   ++ N  LK L E                 ++           + ELT +NF   + K      V+FFAPWCGHCK + P W+Q AS  E    +K+  +D T H    S   V+GYPT+ FF  G K      Y G R       +  +  K  E    PE +E    EI  SA  + Q   V VL
Sbjct:    8 FIYLALLCSRLS-CDNDTEEDEHAKHTYTVEMFNDAISTAPH-FVMFFAPWCGHCQRLQGTWNELADKYNSMEAPPAYVVKVDCTKDTKFCSI--EHGIRGYPTLKLFKPEQEAVK-YQGPRDLQALENWMLKTLQEEPEEPQSEPEPPKVPEPKQG----------LYELTATNFKSHIAKGSH--FVKFFAPWCGHCKAMAPTWEQLASSFEHSDSIKISKVDCTQHYEVCSDNQVRGYPTLLFFTDGEK---IDQYKGKRDLDSFKEFVDNHVKAAESKDEPEKEEEHTHEIPPSAEPEKQESNVLVL 298          

HSP 3 Score: 72.4034 bits (176), Expect = 3.008e-13
Identity = 41/115 (35.65%), Postives = 67/115 (58.26%), Query Frame = 3
Query:  174 EEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKK-AATALKGV--VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKEL-DEL 506
            +E  VLVLT SNF+E + K     ++FYAPWCGHC++LAP W   +     G+  VK+  VD     +L   + ++G+PT+ +F ++    +++ G R   S+ +  +K+  DEL
Sbjct:  291 QESNVLVLTESNFDETVAKG-LSFIKFYAPWCGHCKNLAPTWDDLSQKEFPGLTDVKIAKVDCTVERTLCNRFSVRGYPTLLMF-RAGQQGEEHNGGRDLESLHSFIMKQARDEL 403          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Zebrafish
Match: p4hb (prolyl 4-hydroxylase, beta polypeptide [Source:ZFIN;Acc:ZDB-GENE-080610-1])

HSP 1 Score: 116.316 bits (290), Expect = 2.812e-27
Identity = 59/124 (47.58%), Postives = 79/124 (63.71%), Query Frame = 3
Query:  120 LSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIVN 479
            L  ++ C   A   A+I EEE VLVL  SNF E ++ +  VLVEFYAPWCGHC++LAPE+ KAA  LK     +++  VD  + S L Q +G++G+PTIK F G  K +PK+Y   R A  IV+
Sbjct:    2 LKFLIVCALAAMSAAEIAEEEDVLVLKKSNFEEALKAHPNVLVEFYAPWCGHCKALAPEYSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVS 125          

HSP 2 Score: 105.145 bits (261), Expect = 1.178e-23
Identity = 61/167 (36.53%), Postives = 92/167 (55.09%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGD 1082
            DV+ L  SNF+E  LK+    LVEF+APWCGHCK L P + +AA  L+ +   ++L  +DAT  +  A  +GV+GYPTIKFF  G K G+ ++Y  GR + DIV W   +      A  + +++  E   S   D+++ V+       D +S+    +I T +   D
Sbjct:   23 DVLVLKKSNFEE-ALKAHPNVLVEFYAPWCGHCKALAPEYSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEK-GNPKEYSAGRQAEDIVSWLKKRT--GPAATTLNDVMQAE---SIIADNEVAVIGFFK---DVESEDSKAFIKTAEAVDD 179          

HSP 3 Score: 73.9442 bits (180), Expect = 1.361e-13
Identity = 36/101 (35.64%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  603 LTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR--GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRW 899
            L   NF+E+         VEF+APWCGHCK L P WDQ   + +    + +  +D+T +   A +  V  +PT+KFFPAG       DY+G R+     ++
Sbjct:  370 LVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKDNANIVVAKMDSTANEIEAVK--VHSFPTLKFFPAG-DERKVIDYNGERTLDGFTKF 467          

HSP 4 Score: 71.2478 bits (173), Expect = 1.264e-12
Identity = 43/125 (34.40%), Postives = 58/125 (46.40%), Query Frame = 3
Query:  123 SIVLFCFALAQ-------CNADITEE---EGVLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERT 461
            +I+ FC +  +        + DI E+     V VL   NF EV       V VEFYAPWCGHC+ LAP W +     K    +    MD  ++  +   +  FPT+K F    +    DY GERT
Sbjct:  336 NIISFCTSFVEGTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKDNANIVVAKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERT 460          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Xenopus
Match: mettl16 (methyltransferase like 16 [Source:Xenbase;Acc:XB-GENE-952802])

HSP 1 Score: 462.225 bits (1188), Expect = 2.128e-159
Identity = 236/437 (54.00%), Postives = 303/437 (69.34%), Query Frame = 3
Query:  114 KYLSIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            K L   + C      +A  +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L P+WKKAATALKGVVK+GAV+ D++ SLG  YG++GFPTIK+FG +K+ P DYQG RTA +I++AAL  L   V+ RLGG SGGS S  +  S G      DV++LTD  FD+ VL S++ W VEF+APWCGHCKNL+P W  AA+E++    GKVKL A+DATV    ASRYG++G+PTIK F  G    D  DYDGGR+ +DIV  A D   E  P PEI EILN +I+K  C++HQLC+VAVLP+ILD  +  RN Y+  +    DKYK   WGWLW EA    +LE   GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGSTS + G  +P I +V PWDGKDGE+P E++IDLS++ +++
Sbjct:    8 KLLGGAVACTLFMAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAATALKGVVKIGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSFVKDRLGGRSGGSDSGRQSYSSGGGSKK-DVIDLTDDTFDKNVLNSDDVWFVEFYAPWCGHCKNLEPEWAAAATEIKQQTNGKVKLAAVDATVSQVLASRYGIRGFPTIKIFQKGE---DPVDYDGGRTKADIVARAIDLFSENAPPPEIYEILNGDIVKKTCDEHQLCIVAVLPHILDTGASGRNSYLDVMMKMADKYKKKMWGWLWAEAGAQMDLETSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTSPVGGGAIPKINTVVPWDGKDGELPAEDDIDLSDVELDD 440          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Xenopus
Match: mettl16 (methyltransferase like 16 [Source:Xenbase;Acc:XB-GENE-952802])

HSP 1 Score: 461.07 bits (1185), Expect = 5.162e-159
Identity = 232/429 (54.08%), Postives = 297/429 (69.23%), Query Frame = 3
Query:  138 CFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            C      +A  +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L P+WKKAATALKGVVK+GAV+ D++ SLG  YG++GFPTIK+FG +K+ P DYQG RTA +I++AAL  L   V+ RLGG SGGS S              DV++LTD  FD+ VL S++ W VEF+APWCGHCKNL+P W  AA+E++    GKVKL A+DATV    ASRYG++G+PTIK F  G    D  DYDGGR+ +DIV  A D   E  P PEI EILN +I+K  C++HQLC+VAVLP+ILD  +  RN Y+  +    DKYK   WGWLW EA    +LE   GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGSTS + G  +P I +V PWDGKDGE+P E++IDLS++ +++
Sbjct:   16 CTLFMAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAATALKGVVKIGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSFVKDRLGGRSGGSDSGSSGGGSKK-----DVIDLTDDTFDKNVLNSDDVWFVEFYAPWCGHCKNLEPEWAAAATEIKQQTNGKVKLAAVDATVSQVLASRYGIRGFPTIKIFQKG---EDPVDYDGGRTKADIVARAIDLFSENAPPPEIYEILNGDIVKKTCDEHQLCIVAVLPHILDTGASGRNSYLDVMMKMADKYKKKMWGWLWAEAGAQMDLETSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTSPVGGGAIPKINTVVPWDGKDGELPAEDDIDLSDVELDD 436          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Xenopus
Match: mettl16 (methyltransferase like 16 [Source:Xenbase;Acc:XB-GENE-952802])

HSP 1 Score: 461.455 bits (1186), Expect = 6.385e-159
Identity = 234/429 (54.55%), Postives = 300/429 (69.93%), Query Frame = 3
Query:  138 CFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            C      +A  +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L P+WKKAATALKGVVK+GAV+ D++ SLG  YG++GFPTIK+FG +K+ P DYQG RTA +I++AAL  L   V+ RLGG SGGS S  +  S G      DV++LTD  FD+ VL S++ W VEF+APWCGHCKNL+P W  AA+E++    GKVKL A+DATV    ASRYG++G+PTIK F  G    D  DYDGGR+ +DIV  A D   E  P PEI EILN +I+K  C++HQLC+VAVLP+ILD  +  RN Y+  +    DKYK   WGWLW EA    +LE   GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGSTS + G  +P I +V PWDGKDGE+P E++IDLS++ +++
Sbjct:   23 CTLFMAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAATALKGVVKIGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSFVKDRLGGRSGGSDSGRQSYSSGGGSKK-DVIDLTDDTFDKNVLNSDDVWFVEFYAPWCGHCKNLEPEWAAAATEIKQQTNGKVKLAAVDATVSQVLASRYGIRGFPTIKIFQKGE---DPVDYDGGRTKADIVARAIDLFSENAPPPEIYEILNGDIVKKTCDEHQLCIVAVLPHILDTGASGRNSYLDVMMKMADKYKKKMWGWLWAEAGAQMDLETSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTSPVGGGAIPKINTVVPWDGKDGELPAEDDIDLSDVELDD 447          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Xenopus
Match: mettl16 (methyltransferase like 16 [Source:Xenbase;Acc:XB-GENE-952802])

HSP 1 Score: 461.07 bits (1185), Expect = 6.580e-159
Identity = 233/429 (54.31%), Postives = 299/429 (69.70%), Query Frame = 3
Query:  138 CFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            C      +A  +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L P+WKKAATALKGVVK+GAV+ D++ SLG  YG++GFPTIK+FG +K+ P DYQG RTA +I++AAL  L   V+ RLGG SGGS S  +    G      DV++LTD  FD+ VL S++ W VEF+APWCGHCKNL+P W  AA+E++    GKVKL A+DATV    ASRYG++G+PTIK F  G    D  DYDGGR+ +DIV  A D   E  P PEI EILN +I+K  C++HQLC+VAVLP+ILD  +  RN Y+  +    DKYK   WGWLW EA    +LE   GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGSTS + G  +P I +V PWDGKDGE+P E++IDLS++ +++
Sbjct:   15 CTLFMAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAATALKGVVKIGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSFVKDRLGGRSGGSDSGRQVGFSGYIKK--DVIDLTDDTFDKNVLNSDDVWFVEFYAPWCGHCKNLEPEWAAAATEIKQQTNGKVKLAAVDATVSQVLASRYGIRGFPTIKIFQKG---EDPVDYDGGRTKADIVARAIDLFSENAPPPEIYEILNGDIVKKTCDEHQLCIVAVLPHILDTGASGRNSYLDVMMKMADKYKKKMWGWLWAEAGAQMDLETSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTSPVGGGAIPKINTVVPWDGKDGELPAEDDIDLSDVELDD 438          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Xenopus
Match: mettl16 (methyltransferase like 16 [Source:Xenbase;Acc:XB-GENE-952802])

HSP 1 Score: 460.685 bits (1184), Expect = 7.551e-159
Identity = 233/429 (54.31%), Postives = 299/429 (69.70%), Query Frame = 3
Query:  138 CFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            C      +A  +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L P+WKKAATALKGVVK+GAV+ D++ SLG  YG++GFPTIK+FG +K+ P DYQG RTA +I++AAL  L   V+ RLGG SGGS S  +    G      DV++LTD  FD+ VL S++ W VEF+APWCGHCKNL+P W  AA+E++    GKVKL A+DATV    ASRYG++G+PTIK F  G    D  DYDGGR+ +DIV  A D   E  P PEI EILN +I+K  C++HQLC+VAVLP+ILD  +  RN Y+  +    DKYK   WGWLW EA    +LE   GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGSTS + G  +P I +V PWDGKDGE+P E++IDLS++ +++
Sbjct:    6 CTLFMAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAATALKGVVKIGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSFVKDRLGGRSGGSDSGRQVGFSGYIKK--DVIDLTDDTFDKNVLNSDDVWFVEFYAPWCGHCKNLEPEWAAAATEIKQQTNGKVKLAAVDATVSQVLASRYGIRGFPTIKIFQKG---EDPVDYDGGRTKADIVARAIDLFSENAPPPEIYEILNGDIVKKTCDEHQLCIVAVLPHILDTGASGRNSYLDVMMKMADKYKKKMWGWLWAEAGAQMDLETSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTSPVGGGAIPKINTVVPWDGKDGELPAEDDIDLSDVELDD 429          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Mouse
Match: Pdia6 (protein disulfide isomerase associated 6 [Source:MGI Symbol;Acc:MGI:1919103])

HSP 1 Score: 468.003 bits (1203), Expect = 1.149e-161
Identity = 245/444 (55.18%), Postives = 308/444 (69.37%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADI------TEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            M+ + +      L  C   +      +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L PEWKKAATALK VVKVGAV+ DK+ SLG  YG+QGFPTIKIFG +K+ P+DYQG RT  +IV+AAL  L +LV+ RLGG SGG SS ++     SS    DVVELTD  FD+ VL SE+ W+VEF+APWCGHCKNL+P W  AA+E++    GKVKL A+DAT++   ASRYG++G+PTIK F  G       DYDGGR+ SDIV  A D   +  P PE+ EI+N++I K  CE+HQLCVVAVLP+ILD  +  RN Y+  L    DKYK   WGWLWTEA    ELEN  GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGST+ + G   PTI   EPWDGKDGE+P E++IDLS++ +++
Sbjct:    1 MRVIGMARLVLGLVSCTFFLAVSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKK--DVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATMNQVLASRYGIKGFPTIKIFQKGESP---VDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGSFPTITPREPWDGKDGELPVEDDIDLSDVELDD 439          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Mouse
Match: Pdia4 (protein disulfide isomerase associated 4 [Source:MGI Symbol;Acc:MGI:104864])

HSP 1 Score: 154.066 bits (388), Expect = 8.603e-40
Identity = 107/306 (34.97%), Postives = 150/306 (49.02%), Query Frame = 3
Query:  183 GVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVL------PNIL---DCQSQCRNDY 1055
            GV VL + NF+  +     VL+EFYAPWCGHC+  APE++K A+ LK     + V  +D    S L   + + G+PTIKI  K +    DY G RT   IV A ++E+ +                        +      + LT  NFD+ V+ + +  LVEF+APWCGHCK L P +++AA EL  +   + L  +DAT  T  A R+ V GYPT+K F    + G   DY+G R    IV    D ++EQ   P  KEIL  + ++   +D    V+  L      P  L   D  +  R DY
Sbjct:   59 GVWVLNDGNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKGQAV--DYDGSRTQEEIV-AKVREVSQ---------------------PDWTPPPEVTLSLTKDNFDD-VVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIF----RKGRPFDYNGPREKYGIV----DYMIEQ-SGPPSKEILTLKQVQEFLKDGDDVVIIGLFQGDGDPAYLQYQDAANNLREDY 330          

HSP 2 Score: 90.1225 bits (222), Expect = 1.372e-18
Identity = 44/108 (40.74%), Postives = 65/108 (60.19%), Query Frame = 3
Query:  180 EGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKE 494
            E  L LT  NF++V+     +LVEFYAPWCGHC+ LAPE++KAA  L      + +  VD  + + L + + + G+PT+KIF K +  P DY G R    IV+  +++
Sbjct:  173 EVTLSLTKDNFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFRKGR--PFDYNGPREKYGIVDYMIEQ 278          

HSP 3 Score: 88.9669 bits (219), Expect = 3.695e-18
Identity = 68/227 (29.96%), Postives = 107/227 (47.14%), Query Frame = 3
Query:  603 LTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQ---LPAPEIKEILNQEILKSACEDHQLCVVAVL-PNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFV 1262
            L D NFD  V   ++  L+EF+APWCGHCK   P +++ AS L+     + +  +DAT  +  AS++ V GYPTIK     +K G + DYDG R+  +IV  A  + V Q    P PE+   L ++       +  + +V    P    C+        A  +++    +S        +A +  +L   F +   GYP L +   RK +     GP  + GI D++
Sbjct:   63 LNDGNFDNFVA-DKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKI----LKKGQAVDYDGSRTQEEIV--AKVREVSQPDWTPPPEVTLSLTKDNFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSK---RSPPIPLAKVDATEQTDLAKRFDVS--GYPTLKI--FRKGRPFDYNGPREKYGIVDYM 275          

HSP 4 Score: 73.1738 bits (178), Expect = 3.858e-13
Identity = 34/105 (32.38%), Postives = 58/105 (55.24%), Query Frame = 3
Query:  615 NFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKL--GALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQ 923
             FD +V+  ++  L+EF+APWCGHCK L+P +     + +G+  L    +DAT +  T  +Y V+G+PTI F P+G K    +   G R    + ++  +   ++
Sbjct:  530 TFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFIDEHATKR 634          

HSP 5 Score: 56.9954 bits (136), Expect = 5.077e-8
Identity = 33/94 (35.11%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  186 VLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSS--LGQPYGIQGFPTIKIFGKS--KHSPKDYQG 452
            V V+    F+ ++ +  K VL+EFYAPWCGHC+ L P +       KG   +    MD  ++      Y ++GFPTI  F  S  K +P  ++G
Sbjct:  523 VKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTI-YFAPSGDKKNPIKFEG 615          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Mouse
Match: Dnajc10 (DnaJ heat shock protein family (Hsp40) member C10 [Source:MGI Symbol;Acc:MGI:1914111])

HSP 1 Score: 130.183 bits (326), Expect = 1.906e-31
Identity = 67/222 (30.18%), Postives = 111/222 (50.00%), Query Frame = 3
Query:  183 GVLVLTNSNFNEVIEKNKYV---LVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQG----ERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFF 827
             V+ LT S FNE++++ K+    +V+FY+PWC  CQ L PEWK+ A  L G++ VG+VD  +Y S      +Q +P I+ + +       Y       R A S+ +  L  L +                               ++LT   F+E VL+ +  W+V+F+APWCG C+N  P ++  A  ++GKV+ G +D   +  T  + G++ YP++K +
Sbjct:  557 SVVSLTPSTFNELVKQRKHDEVWMVDFYSPWCHPCQVLMPEWKRMARTLTGLINVGSVDCQQYHSFCTQENVQRYPEIRFYPQKSSKAYQYHSYNGWNRDAYSLRSWGLGFLPQAS-----------------------------IDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLY 749          

HSP 2 Score: 124.79 bits (312), Expect = 1.259e-29
Identity = 73/223 (32.74%), Postives = 114/223 (51.12%), Query Frame = 3
Query:  243 LVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMV--LKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPA-GVKSGDSQDYDG-GRSSSDIVRW 899
            LV+F+APWC  C++L PE +KA+T L G +KVG +D   +  L   Y IQ +PT  +F +S  S  +Y+G  +A  I+     E  E +R+                          VV LT S F+E+V   K +E W+V+F++PWC  C+ L P W + A  L G + +G++D   + +  ++  VQ YP I+F+P    K+     Y+G  R +  +  W
Sbjct:  472 LVDFFAPWCPPCRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQS--SIHEYEGHHSAEQIL-----EFIEDLRN------------------------PSVVSLTPSTFNELVKQRKHDEVWMVDFYSPWCHPCQVLMPEWKRMARTLTGLINVGSVDCQQYHSFCTQENVQRYPEIRFYPQKSSKAYQYHSYNGWNRDAYSLRSW 663          

HSP 3 Score: 77.0258 bits (188), Expect = 2.543e-14
Identity = 34/89 (38.20%), Postives = 51/89 (57.30%), Query Frame = 3
Query:  642 EEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASD 908
            +EPWLV+FFAPWC  C+ L P   +A++ L G++K+G LD T+H    + Y +Q YPT   F          +Y+G  S+  I+ +  D
Sbjct:  468 KEPWLVDFFAPWCPPCRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVF----NQSSIHEYEGHHSAEQILEFIED 552          

HSP 4 Score: 72.0182 bits (175), Expect = 9.696e-13
Identity = 38/94 (40.43%), Postives = 53/94 (56.38%), Query Frame = 3
Query:  195 LTNSNFNE-VIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSI 473
            LT   FNE V++   + +V+FYAPWCG CQ+ APE++  A  +KG V+ G VD   Y    Q  GI+ +P++K+          YQ ER   SI
Sbjct:  675 LTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKL----------YQYERAKKSI 758          

HSP 5 Score: 67.781 bits (164), Expect = 2.250e-11
Identity = 31/108 (28.70%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELV 509
            ++ L    F+  +   +   V FY+P C HC  LAP W++ A  + G++++GAV+      L +  G+  +P++ IF +S  +   Y G+R+  S+V  A++ +   V
Sbjct:  131 IITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIF-RSGMAAVKYNGDRSKESLVAFAMQHVRSTV 237          

HSP 6 Score: 65.4698 bits (158), Expect = 1.231e-10
Identity = 34/108 (31.48%), Postives = 55/108 (50.93%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKV 914
            +++ L    FD  V  S E W V F++P C HC +L P W + A E+ G +++GA++           GV  YP++  F +G+    +  Y+G RS   +V +A   V
Sbjct:  130 EIITLERREFDAAV-NSGELWFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMA---AVKYNGDRSKESLVAFAMQHV 233          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Mouse
Match: Txndc5 (thioredoxin domain containing 5 [Source:MGI Symbol;Acc:MGI:2145316])

HSP 1 Score: 121.324 bits (303), Expect = 3.951e-30
Identity = 79/259 (30.50%), Postives = 140/259 (54.05%), Query Frame = 3
Query:  177 EEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG--VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXX----DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQ-AASELRG--KVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRS----SSDIVRWASDKV 914
            ++G+  L+ +NF   + +  +  ++F+APWCGHC++LAP W++ A  L+    VK+G VD  ++ ++   + ++G+PT+  F   K   + Y+G+R         L+ L + V+S+L G+     + E   +   +         V+ LT+ +F++ + +      V+F+APWCGHCKNL P W++ +  E  G   V +  +D T      S+Y V+GYPT+  F  G K G   +++GGR      S ++R A D++
Sbjct:   80 KQGLYELSANNFELHVSQGNH-FIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGKKVDQ-YKGKRD--------LESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDTIAQGIT--FVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVG---EHNGGRDLDSLHSFVLRQAKDEL 323          

HSP 2 Score: 88.9669 bits (219), Expect = 6.343e-19
Identity = 65/208 (31.25%), Postives = 97/208 (46.63%), Query Frame = 3
Query:  330 VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK--VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKE 947
            V V  VD    S +    G++G+PT+K F   + + K YQG R   ++ N  L+ L+E            ++         +      + EL+ +NF+  V  S+    ++FFAPWCGHCK L P W+Q A  L     VK+G +D T H A  S + V+GYPT+ +F  G K      Y G R    +  +   ++     APE  E
Sbjct:    6 VYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVK-YQGPRDFETLENWMLQTLNE----------EPATPEPEAEPPRAPELKQGLYELSANNFELHV--SQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGKK---VDQYKGKRDLESLRDYVQSQLQGSEAAPETVE 197          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Mouse
Match: Txndc5 (thioredoxin domain containing 5 [Source:MGI Symbol;Acc:MGI:2145316])

HSP 1 Score: 121.324 bits (303), Expect = 5.830e-30
Identity = 79/259 (30.50%), Postives = 140/259 (54.05%), Query Frame = 3
Query:  177 EEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG--VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXX----DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQ-AASELRG--KVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRS----SSDIVRWASDKV 914
            ++G+  L+ +NF   + +  +  ++F+APWCGHC++LAP W++ A  L+    VK+G VD  ++ ++   + ++G+PT+  F   K   + Y+G+R         L+ L + V+S+L G+     + E   +   +         V+ LT+ +F++ + +      V+F+APWCGHCKNL P W++ +  E  G   V +  +D T      S+Y V+GYPT+  F  G K G   +++GGR      S ++R A D++
Sbjct:  101 KQGLYELSANNFELHVSQGNH-FIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGKKVDQ-YKGKRD--------LESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDTIAQGIT--FVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVG---EHNGGRDLDSLHSFVLRQAKDEL 344          

HSP 2 Score: 103.219 bits (256), Expect = 1.016e-23
Identity = 74/233 (31.76%), Postives = 107/233 (45.92%), Query Frame = 3
Query:  267 CGHCQSLAPEWK----KAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK--VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKE 947
            CGHCQ L P W     K  +     V V  VD    S +    G++G+PT+K F   + + K YQG R   ++ N  L+ L+E            ++         +      + EL+ +NF+  V  S+    ++FFAPWCGHCK L P W+Q A  L     VK+G +D T H A  S + V+GYPT+ +F  G K      Y G R    +  +   ++     APE  E
Sbjct:    2 CGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVK-YQGPRDFETLENWMLQTLNE----------EPATPEPEAEPPRAPELKQGLYELSANNFELHV--SQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGKK---VDQYKGKRDLESLRDYVQSQLQGSEAAPETVE 218          

HSP 3 Score: 62.003 bits (149), Expect = 6.559e-10
Identity = 41/121 (33.88%), Postives = 65/121 (53.72%), Query Frame = 3
Query:  162 ADITEEEG-VLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEW----KKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKEL-DEL 506
            A+ T ++G VL LT  +F + I +     V+FYAPWCGHC++LAP W    KK    L  V  +  VD     ++   Y ++G+PT+ +F +      ++ G R   S+ +  L++  DEL
Sbjct:  227 AEPTGDKGTVLALTEKSFEDTIAQG-ITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVT-IAEVDCTAERNVCSKYSVRGYPTLLLF-RGGEKVGEHNGGRDLDSLHSFVLRQAKDEL 344          
BLAST of Protein disulfide-isomerase A6 vs. UniProt/SwissProt
Match: sp|Q11067|PDIA6_CAEEL (Protein disulfide-isomerase A6 homolog OS=Caenorhabditis elegans OX=6239 GN=pdi-6 PE=3 SV=1)

HSP 1 Score: 475.322 bits (1222), Expect = 8.730e-164
Identity = 230/425 (54.12%), Postives = 306/425 (72.00%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNF-NEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXX---XDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKE 1373
            M  + ++L   A+       ++++ V+ LT +NF ++VI  +   +VEFYAPWCGHC+SL PE+KKAA+ALKGV KVGAVDM ++ S+G PY +QGFPT+KIFG  K  P DY G+RTA +I ++ L E  + V +RLGG S GSSS    S  G  G G    +VVELTD+NF+++VL S++ WLVEFFAPWCGHCK+L+P W  AASEL+GKV+LGALDATVHT  A+++ ++G+PTIK+F  G    D+QDYDGGR SSDIV WAS +  E +PAPE+ E +NQ++++ AC++ QLC+ A LP+ILDCQS+CRN+Y+A LK   +K+K N WGW+W E    P LE  F +GGFGYPA+  +N RK KYA L G F + GI +F+RD+S G+G TS + GDG P I+  E WDGKDG +P E
Sbjct:    1 MALIKLLLASLAITSVCGMYSKKDDVVELTEANFQSKVINSDDIWIVEFYAPWCGHCKSLVPEYKKAASALKGVAKVGAVDMTQHQSVGGPYNVQGFPTLKIFGADKKKPTDYNGQRTAQAIADSVLAEAKKAVSARLGGKSSGSSSSGSGSGSGKRGGGGSGNEVVELTDANFEDLVLNSKDIWLVEFFAPWCGHCKSLEPQWKAAASELKGKVRLGALDATVHTVVANKFAIRGFPTIKYFAPGSDVSDAQDYDGGRQSSDIVAWASARAQENMPAPEVFEGINQQVVEDACKEKQLCIFAFLPHILDCQSECRNNYLAMLKEQSEKFKKNLWGWIWVEGAAQPALEESFEVGGFGYPAMTALNFRKNKYAVLKGSFGKDGIHEFLRDLSYGKGRTSSLRGDGFPKIQKTEKWDGKDGALPAE 425          
BLAST of Protein disulfide-isomerase A6 vs. UniProt/SwissProt
Match: sp|Q15084|PDIA6_HUMAN (Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1)

HSP 1 Score: 471.085 bits (1211), Expect = 3.141e-162
Identity = 249/435 (57.24%), Postives = 309/435 (71.03%), Query Frame = 3
Query:  120 LSIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            L +V   F LA  N   +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L PEWKKAATALK VVKVGAVD DK+ SLG  YG+QGFPTIKIFG +K+ P+DYQG RT  +IV+AAL  L +LV+ RLGG SGG SS ++  S  SS    DV+ELTD +FD+ VL SE+ W+VEF+APWCGHCKNL+P W  AASE++    GKVKL A+DATV+   ASRYG++G+PTIK F  G       DYDGGR+ SDIV  A D   +  P PE+ EI+N++I K  CE+HQLCVVAVLP+ILD  +  RN Y+  L    DKYK   WGWLWTEA    ELE   GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGST+ + G   PTI   EPWDG+DGE+P E++IDLS++ +++
Sbjct:    6 LGLVSCTFFLA-VNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKK--DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESP---VDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD 434          
BLAST of Protein disulfide-isomerase A6 vs. UniProt/SwissProt
Match: sp|Q5R6T1|PDIA6_PONAB (Protein disulfide-isomerase A6 OS=Pongo abelii OX=9601 GN=PDIA6 PE=2 SV=1)

HSP 1 Score: 468.003 bits (1203), Expect = 5.504e-161
Identity = 243/429 (56.64%), Postives = 305/429 (71.10%), Query Frame = 3
Query:  138 CFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            C    + N   +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L PEWKKAATALK VVKVGAVD DK+ SLG  YG+QGFPTIKIFG +K+ P+DYQG RT  +IV+AAL  L +LV+ RLGG SGG SS ++  S  SS    DV+ELTD +FD+ VL SE+ W+VEF+APWCGHCKNL+P W  AASE++    GKVKL A+DATV+   ASRYG++G+PTIK F  G       DYDGGR+ SDIV  A D   +  P PE+ EI++++I K  CE+HQLCVV+VLP+ILD  +  RN Y+  L    DKYK   WGWLWTEA    ELE   GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGST+ + G   PTI   EPWDG+DGE+P E++IDLS++ +++
Sbjct:   11 CAFFLEVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGQSGGYSSGKQGRSDSSSKK--DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESP---VDYDGGRTRSDIVSRALDLFSDNAPPPELLEIISEDIAKRTCEEHQLCVVSVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD 434          
BLAST of Protein disulfide-isomerase A6 vs. UniProt/SwissProt
Match: sp|Q922R8|PDIA6_MOUSE (Protein disulfide-isomerase A6 OS=Mus musculus OX=10090 GN=Pdia6 PE=1 SV=3)

HSP 1 Score: 467.618 bits (1202), Expect = 7.798e-161
Identity = 248/435 (57.01%), Postives = 308/435 (70.80%), Query Frame = 3
Query:  120 LSIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            L +V   F LA  +   +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L PEWKKAATALK VVKVGAV+ DK+ SLG  YG+QGFPTIKIFG +K+ P+DYQG RT  +IV+AAL  L +LV+ RLGG SGG SS ++     SS    DVVELTD  FD+ VL SE+ W+VEF+APWCGHCKNL+P W  AA+E++    GKVKL A+DATV+   ASRYG++G+PTIK F  G       DYDGGR+ SDIV  A D   +  P PE+ EI+N++I K  CE+HQLCVVAVLP+ILD  +  RN Y+  L    DKYK   WGWLWTEA    ELEN  GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGST+ + G   PTI   EPWDGKDGE+P E++IDLS++ +++
Sbjct:    6 LGLVSCTFFLA-VSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKK--DVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIKGFPTIKIFQKGESP---VDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGSFPTITPREPWDGKDGELPVEDDIDLSDVELDD 434          
BLAST of Protein disulfide-isomerase A6 vs. UniProt/SwissProt
Match: sp|Q63081|PDIA6_RAT (Protein disulfide-isomerase A6 OS=Rattus norvegicus OX=10116 GN=Pdia6 PE=1 SV=2)

HSP 1 Score: 467.233 bits (1201), Expect = 1.315e-160
Identity = 247/435 (56.78%), Postives = 308/435 (70.80%), Query Frame = 3
Query:  120 LSIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            L +V   F LA  +A  +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L PEWKKAA+ALK VVKVGAV+ DK+ SLG  YG+QGFPTIKIFG +K+ P+DYQG RT  +IV+AAL  L +LV+ RLGG SGG SS ++     SS    DVVELTD  FD+ VL SE+ W+VEF+APWCGHCKNL+P W  AA+E++    GKVKL A+DATV+   ASRYG++G+PTIK F  G       DYDGGR+ SDIV  A D   +  P PE+ EI+N++I K  CE+HQLCVVAVLP+ILD  +  RN Y+  L    DKYK   WGWLWTEA    ELEN  GIGGFGYPA+  +N RKMK+A L G FS+ GI +F+R++S GRGST+ + G   P I   EPWDGKDGE+P E++IDLS++ +++
Sbjct:    6 LGLVSCTFFLA-VSALYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAASALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKK--DVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIKGFPTIKIFQKGESP---VDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKTCEEHQLCVVAVLPHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGSFPNITPREPWDGKDGELPVEDDIDLSDVELDD 434          
BLAST of Protein disulfide-isomerase A6 vs. TrEMBL
Match: A0A1S3JU63 (protein disulfide-isomerase A6 homolog isoform X1 OS=Lingula unguis OX=7574 GN=LOC106175982 PE=3 SV=1)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 265/433 (61.20%), Postives = 337/433 (77.83%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNE-VIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIE 1406
            M+ ++ +L C  ++  +A  +  + V+ LT +NFN+ VI+ ++  LVEFYAPWCGHCQSLAPEWKKAATALKGVV VGAVDMD++ S+G PYGI+GFPTIKIFG +K+  +DY G R+A +IV++A+  L ++V++RL G  G S        G   G    V+ELTDSNF+E+VL SE+ WLVEFFAPWCGHCKNL PHW+QAASEL+GKVKLGALDATVHT  A+RYGV+GYPTIK FPAG K GD+ +YDGGR++SDIVRWASD++VE LP PEI +I  ++ LK ACEDH LC++AVLP+ILDCQS+CRN Y+  +K  GDKYK  +WGW+W EAM+ PELE+  GIGGFGYPA+  +N RKMKYA L G FS+ GI  F+R++S+GRGSTS +    LP IK V+PWDGKDG++  EEEIDLS++ +E
Sbjct:    1 MQAIAGLLICGLISVTSALYSSSDDVIELTAANFNQKVIQSDQLWLVEFYAPWCGHCQSLAPEWKKAATALKGVVNVGAVDMDQHQSVGGPYGIRGFPTIKIFGANKNKAEDYNGARSANAIVDSAMSHLKQMVQARLSGRGGSSGGGRSSGGGSQGGGKA-VIELTDSNFEELVLNSEDFWLVEFFAPWCGHCKNLAPHWEQAASELKGKVKLGALDATVHTVMANRYGVRGYPTIKAFPAGKKDGDTIEYDGGRTASDIVRWASDRIVENLPPPEIVQITEEKSLKDACEDHPLCIIAVLPHILDCQSECRNKYLDVMKELGDKYKGKQWGWVWAEAMQQPELEDSLGIGGFGYPAMAAMNARKMKYAILRGAFSKDGINSFLRELSVGRGSTSPVKNAQLPPIKKVDPWDGKDGKLEVEEEIDLSDVELE 432          
BLAST of Protein disulfide-isomerase A6 vs. TrEMBL
Match: F1KYD8 (Protein disulfide-isomerase A6 OS=Ascaris suum OX=6253 PE=2 SV=1)

HSP 1 Score: 519.62 bits (1337), Expect = 8.782e-179
Identity = 244/431 (56.61%), Postives = 324/431 (75.17%), Query Frame = 3
Query:  120 LSIVLFCFALAQCNADITEEEGVLVLTNSNF-NEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            L+ V      + C+A       V+ LT SNF N V+  ++  +VEFYAPWCGHC++ APE+KKAA ALKG++KVGAVDM ++ S+GQPY +QGFPT+KIFG +K  P DYQG RTA  + +AA++EL   V +RLGG +   S  ++ + G       +V+ELTDSNFDE+VL S++ W+VEFFAPWCGHCK LKPHWDQAA+EL+GK+KLGALDATVH   ASR+G++G+PTIK+F  G  + D+ DYDGGRSSSDIV+WA +K  E +PAPEI E  +Q I++ AC++ QLC+V+VLP+ILDCQS+CRNDY+A LK  G+K+K N WGW+WTEA K PELE  FG+GGFGYPA+  VN RKMK++ L G F + GI +F+RD+S G+G T+ + G   P I+ VEPWDGKDG +P +EEID+S++ +++
Sbjct:    3 LAFVYLVVGASVCSALYDGNTDVIELTQSNFHNRVLNSDEIWIVEFYAPWCGHCKNFAPEYKKAAKALKGLIKVGAVDMTEHQSVGQPYNVQGFPTVKIFGANKQKPSDYQGARTAQGLADAAIEELRRTVSARLGGKTSTGSGGKKSTGGDGK----EVIELTDSNFDELVLHSKDAWMVEFFAPWCGHCKALKPHWDQAATELKGKIKLGALDATVHQVMASRFGIKGFPTIKYFAPGSGADDAVDYDGGRSSSDIVQWALNKAAENMPAPEIMEATSQPIVEEACKEKQLCIVSVLPDILDCQSKCRNDYLAVLKELGEKFKKNMWGWIWTEAGKQPELEEAFGMGGFGYPAMAAVNYRKMKFSMLKGSFGKDGINEFLRDLSYGKGQTAPVKGAEFPKIRKVEPWDGKDGVMPVDEEIDISDVELDD 429          
BLAST of Protein disulfide-isomerase A6 vs. TrEMBL
Match: A0A0N4V5W5 (Uncharacterized protein OS=Enterobius vermicularis OX=51028 GN=EVEC_LOCUS5245 PE=3 SV=1)

HSP 1 Score: 517.309 bits (1331), Expect = 6.502e-178
Identity = 247/430 (57.44%), Postives = 326/430 (75.81%), Query Frame = 3
Query:  135 FCFALAQCNADITEEEGVLVLTNSNF-NEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEEPKSE 1421
              F     NA    ++ V+ LT SNF N VI+ ++  +VEF+APWCGHC++LAPE+KKAA ALKG++KVGAVDM ++ ++GQPY ++GFPTIKIFG  K  P DYQG RTA +IV+AA+ EL +    RLGG +G   S +     GS+    DV+ELTDSNF+ MVL S++ WLVEFFAPWCGHCKNLKPHW+QAA+EL+GKVKLGALDAT H   AS++G++G+PTIK+F  G  + D+ DYDGGR+SSDIV+WA +KV E +PAPE+ E  +QE+++ AC++ QLCV++VLP+ILDCQS+CRNDYI  LK   +K+K N WGW+WTEA K P LE  FG+GGFGYPA+  +N RKMK+A L G FS+ GI +F+RD+S G+G T+ + G   P +K VEPWDGKDGE+P +E+IDLS++ +E+ + E
Sbjct:    1 MAFISTSVNALYDSQDEVVELTASNFQNRVIKGDEIWVVEFFAPWCGHCKNLAPEYKKAAKALKGLIKVGAVDMTQHQAVGQPYNVRGFPTIKIFGGDKQKPSDYQGARTAQAIVDAAINELKKTASVRLGGKTGSGESKKGSGKRGSAD---DVIELTDSNFESMVLNSDDIWLVEFFAPWCGHCKNLKPHWEQAAAELKGKVKLGALDATTHQVMASKFGIKGFPTIKYFAPGSSADDAVDYDGGRTSSDIVQWALNKVAENVPAPEVVEATSQEVVEKACKEAQLCVISVLPHILDCQSKCRNDYIQILKELAEKFKRNLWGWVWTEAGKQPALEEAFGMGGFGYPAMAALNYRKMKFAMLKGSFSKDGIHEFLRDLSYGKGQTAPVKGAEFPKLKKVEPWDGKDGEMPVDEDIDLSDVELEDLEPE 427          
BLAST of Protein disulfide-isomerase A6 vs. TrEMBL
Match: A0A0B2W322 (Uncharacterized protein OS=Toxocara canis OX=6265 GN=tag-320 PE=3 SV=1)

HSP 1 Score: 516.153 bits (1328), Expect = 1.665e-177
Identity = 245/440 (55.68%), Postives = 328/440 (74.55%), Query Frame = 3
Query:  117 YLSIVLFCFALAQCNADITEEEGVLVLTNSNF-NEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE---PKSEL 1424
            +LS++    +++ C A       V+ LT SNF N+V+  ++  +VEFYAPWCGHC++ APE+KKAA  LKG++KVGAVDM  + S+GQPY +QGFPT+KIFG +K  P +YQG RTA  + +A ++EL  +V +RLGG S   S  ++   G        V+ELTDSNFDE+VL S++ W+VEF+APWCGHCK LKPHWD+AA+EL+GKVKLGALDATVH   ASR+G++G+PTIK+F  G  S D+ DYDGGRSSSDIV+WA +K  E +PAPEI E  +Q ++  AC++ QLC+VAVLP+ILDCQS+CRNDY+A LK  G+K+K N WGW+WTEA K P+LE  FG+GGFGYPA+  VN RKMK++ L G F + GI +F+RD+S G+G T+ + G  +P I+ VEPWDGKDG +P +EEID+S++ +E+    K+EL
Sbjct:    2 WLSLLFIVVSVSACTALYDGSTDVVELTQSNFHNKVLNSDELWIVEFYAPWCGHCKNFAPEYKKAAKVLKGLIKVGAVDMTVHQSVGQPYNVQGFPTVKIFGANKQKPTEYQGARTAQGLADAGIEELRRMVSARLGGRSSDGSGGKKSGGGDGKD----VIELTDSNFDELVLHSKDAWMVEFYAPWCGHCKALKPHWDEAATELKGKVKLGALDATVHQVMASRFGIKGFPTIKYFAPGSGSDDAVDYDGGRSSSDIVQWALNKAAENMPAPEIMEATSQSVVVEACKEKQLCIVAVLPDILDCQSKCRNDYLAVLKELGEKFKKNMWGWIWTEAGKQPDLEEAFGMGGFGYPAMAAVNYRKMKFSMLKGSFGKDGINEFLRDLSYGKGQTAPVKGAEIPKIRDVEPWDGKDGVMPVDEEIDVSDVDLEDLNTAKTEL 437          
BLAST of Protein disulfide-isomerase A6 vs. TrEMBL
Match: A0A267EG43 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030607g1 PE=3 SV=1)

HSP 1 Score: 516.153 bits (1328), Expect = 6.422e-177
Identity = 254/441 (57.60%), Postives = 320/441 (72.56%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEE-EGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKL-PELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEEPKSEL 1424
            MK     L   ALA     + +  + V+ LT +NFN +V+  ++  LVEFYAPWCGHCQSLAP WK+AA ALKGVVKVGA++MD++ S+GQPYGI+GFPTIK+FG  K SP DY G R+A SIV+ AL  L  +VR RL G            SG  +    DV+ELTD+NF+  V+ S++ WLVEFFAPWCGHCK LKPHWD+AASEL GKVKLGALDATVHT+ A+RYG+QGYPTIK FPAG K+G++ +YDGGR+S DIVRWA DK+ + +  PEI EI +Q +L+  C D QLCVV+VLP +LDCQS CRN Y+  LK  G+KYK   WGW+W +   +  +LE  FGIGGFGYPA+ VVN +KMK++ L GPF+  GI +FVR +SLGRGST  + G  +P  K  +PWDGKD +I +++EIDLSELG+E  K+EL
Sbjct:   40 MKAAFAFLCGLALASSTLALYDSSDDVIELTTANFNSKVLNSDELWLVEFYAPWCGHCQSLAPAWKQAARALKGVVKVGAINMDEHQSVGQPYGIRGFPTIKVFGSDKQSPSDYNGARSADSIVDTALSHLQAMVRQRLSGGGSSRGGSGGGGSGSGA----DVIELTDANFESTVMGSKDLWLVEFFAPWCGHCKQLKPHWDRAASELSGKVKLGALDATVHTSMAARYGIQGYPTIKMFPAGRKTGEAVEYDGGRTSDDIVRWALDKLADSIAPPEIVEITDQTVLQDHCLDKQLCVVSVLPQLLDCQSDCRNGYLKILKEIGEKYKKLMWGWVWFQGGDMQTQLEEAFGIGGFGYPAMAVVNAKKMKFSLLKGPFTFDGINEFVRSLSLGRGSTEPVRGASIPEAKKRDPWDGKDAKITQDDEIDLSELGMES-KTEL 475          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Cavefish
Match: PDIA6 (protein disulfide-isomerase A6 [Source:NCBI gene;Acc:103027650])

HSP 1 Score: 459.914 bits (1182), Expect = 8.435e-159
Identity = 226/427 (52.93%), Postives = 297/427 (69.56%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAAS----ELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEE 1376
            M+ L  VL    +   +   T  + V+ L  SNFN +V++ +   L+EFYAPWCGHCQ L P+WKKAATALKG+VK+GAVD D++ SLG  YGI+GFPTIK+FG +K+ P DYQG RT+ +IV  A+  L  LV+ RL G +GGS   ++   G  +G   DVVELTD NFD +VL  +E W+VEFFAPWCGHCK L+P W  AA+    + +GKVKLGA+DATVH   ASRYG++G+PTIK F  G    + +DY+GGR+ +DIV  A D      P PE+ EI++Q+I KS C+D QLC+VAVLP+ILD  +  RN Y+  ++   +KYK   WGWLW EA    +LE+  GIGGFGYPA+  +N RKMKY+ L G FS++GI +F+RD+S+GRGST+ I G  LP I +VE W+GKDG++P EE
Sbjct:    1 MELLQGVLVSALVITVHGFYTASDDVIELNPSNFNKQVLQSDSLWLIEFYAPWCGHCQRLTPDWKKAATALKGIVKIGAVDADQHKSLGSQYGIRGFPTIKVFGANKNKPDDYQGGRTSEAIVEGAMTALRSLVKDRLSGRTGGSGQSKQSGGGSGAGDKKDVVELTDDNFDRLVLNGDEVWMVEFFAPWCGHCKRLEPEWTAAATAVKDQTKGKVKLGAVDATVHQGLASRYGIRGFPTIKIFSKGE---EPEDYEGGRTRADIVARAMDLFSANAPPPELHEIIDQDIFKSTCDDSQLCIVAVLPHILDTGASGRNSYLDVMRKMAEKYKKKMWGWLWAEAGAQMDLESSLGIGGFGYPAMAAINARKMKYSLLKGSFSETGIHEFLRDLSVGRGSTASIGGGALPKISTVEAWNGKDGQLPVEE 424          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Cavefish
Match: pdia6 (protein disulfide-isomerase A6-like [Source:NCBI gene;Acc:103041928])

HSP 1 Score: 453.751 bits (1166), Expect = 3.125e-156
Identity = 230/430 (53.49%), Postives = 299/430 (69.53%), Query Frame = 3
Query:  111 MKYLSIVLFC-FALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXX---XXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKE 1373
            M+ +  VL C   +   +   +  + V+ L  SNFN EV++ +   LVEFYAPWCGHCQSL PEWKKAA+ALKGVVK+GAVD D+++SLG  YG++GFPTIKIFG +K+ P++YQG R++ +IV+ AL  L  +V+ RL G +     S        G S GS  DV+ELTD NFDE V  S++ W+VEFFAPWCGHCKNL+P W  AAS+++    G+VKLGA+DATVH   ASRYG++G+PTIK F  G    + +DY GGR+ SDI+  A D   +  P PE+ EILN++ILK  C+DHQLCV+AVLP+ILD  +  RN Y+  +    +KYK   WGWLWTEA    +LE   GIGGFGYPA+  +N RKMK+A L G FS++GI +F+RD+S+GRGST+ + G  LP I SVE WDGKDG +P E
Sbjct:    1 MRAVLGVLACSLTVLSVHGLYSASDDVIELNPSNFNREVLQSDSLWLVEFYAPWCGHCQSLVPEWKKAASALKGVVKIGAVDADQHNSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDTALNALRSIVKDRLSGKTGGSDYSRQSSGGGGGSSGGSKQDVIELTDDNFDEKVFGSDDVWMVEFFAPWCGHCKNLEPEWAAAASQVKEQTNGRVKLGAVDATVHQGLASRYGIRGFPTIKVFRKGE---EPEDYQGGRTRSDIIARALDLYSDNAPPPEMLEILNEDILKKTCDDHQLCVIAVLPHILDTGAAGRNGYLEVMMKMAEKYKKKMWGWLWTEAGAQMDLEASLGIGGFGYPAMAAINARKMKFALLKGSFSETGIHEFLRDLSVGRGSTATVGGGALPKINSVEAWDGKDGVLPVE 427          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Cavefish
Match: pdia4 (protein disulfide isomerase family A member 4 [Source:NCBI gene;Acc:103026638])

HSP 1 Score: 167.933 bits (424), Expect = 9.530e-45
Identity = 103/277 (37.18%), Postives = 152/277 (54.87%), Query Frame = 3
Query:  162 ADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILN-QEILK 971
             ++ EE GVLVLT++NF+  +E    VLVEFYAPWCGHC+  APE++K A  LK     + V  VD  K ++LG  + + G+PTIKI  K +  P +Y G+R+  +IV    + + E+ +                            + LT  NFD+ V+ + +  LVEF+APWCGHCK L P +++AA EL  +   + L  +DATV    ASR+ V GYPT+K F    + G   DY+G R    IV + S++     P+ +++ +   QE+LK
Sbjct:   55 TEVKEENGVLVLTDANFDTFMEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQVLKESDPPIPVAKVDATKATALGSRFEVSGYPTIKILKKGE--PVEYDGDRSEKAIV----ERVKEVAQPDWKPPPEA------------------TLVLTKDNFDD-VVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPILLAKVDATVENDLASRFDVTGYPTLKMF----RKGKVFDYNGPREKIGIVDYMSEQA--GPPSKQVQALKQIQELLK 300          

HSP 2 Score: 71.2478 bits (173), Expect = 1.155e-12
Identity = 34/91 (37.36%), Postives = 53/91 (58.24%), Query Frame = 3
Query:  615 NFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKL--GALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSS 881
             FDE+VL  ++  L+EF+APWCGHCK L+P +   A + + +  L    +DAT +      Y V+G+PTI F P+  K    + ++GG  +
Sbjct:  532 TFDEIVLDKKKDVLIEFYAPWCGHCKKLEPDYLALAKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTIYFAPSNNKQNPIK-FEGGERN 621          

HSP 3 Score: 62.3882 bits (150), Expect = 8.198e-10
Identity = 34/93 (36.56%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  186 VLVLTNSNFNE-VIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSS--LGQPYGIQGFPTIKIF-GKSKHSPKDYQG 452
            V V+    F+E V++K K VL+EFYAPWCGHC+ L P++   A   K    +    MD  ++      Y ++GFPTI      +K +P  ++G
Sbjct:  525 VKVIVGKTFDEIVLDKKKDVLIEFYAPWCGHCKKLEPDYLALAKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTIYFAPSNNKQNPIKFEG 617          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Cavefish
Match: dnajc10 (DnaJ heat shock protein family (Hsp40) member C10 [Source:NCBI gene;Acc:103021499])

HSP 1 Score: 140.198 bits (352), Expect = 7.764e-35
Identity = 70/223 (31.39%), Postives = 112/223 (50.22%), Query Frame = 3
Query:  183 GVLVLTNSNFNEVIEKNKYV---LVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQG----ERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFP 830
             V+ LT   F +++++ K     +V+FYAPWCG CQ+L PEW++ A  L GV+ VG VD  K+ SL Q   ++ +P I++F ++ +    Y       R A S+   AL  L                                 V+LT  +F   +L+ +E W+++F+APWCG C++  P ++  A  L+G V+ G +D   H  T    G+  YPT++F+P
Sbjct:  560 AVVTLTPDTFQQLVKRRKQTETWVVDFYAPWCGPCQALLPEWRRMARMLSGVINVGTVDCQKHHSLCQSENVRAYPEIRLFPQNSNRRDQYHSYNGWHRDAQSLKTWALSSLPRA-----------------------------SVDLTPEDFKRKILEGKEHWVLDFYAPWCGPCQHFAPEFEILARMLKGTVRAGKVDCQAHYQTCQSAGITAYPTVRFYP 753          

HSP 2 Score: 120.553 bits (301), Expect = 2.115e-28
Identity = 73/224 (32.59%), Postives = 105/224 (46.88%), Query Frame = 3
Query:  243 LVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMV--LKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDS-QDYDG-GRSSSDIVRWA 902
            LV+F+APWC  C++L PE +KA+  L G +K G +D   +  L   Y I  +PT  IF KS  S  +Y+G  +A  I    L+ + +LV                            VV LT   F ++V   K  E W+V+F+APWCG C+ L P W + A  L G + +G +D   H +      V+ YP I+ FP      D    Y+G  R +  +  WA
Sbjct:  475 LVDFFAPWCPPCRALLPELRKASIQLYGQMKFGTLDCTIHEGLCSRYNINAYPTTVIFNKS--SVHEYEGHHSADGI----LEFIQDLVNPA-------------------------VVTLTPDTFQQLVKRRKQTETWVVDFYAPWCGPCQALLPEWRRMARMLSGVINVGTVDCQKHHSLCQSENVRAYPEIRLFPQNSNRRDQYHSYNGWHRDAQSLKTWA 667          

HSP 3 Score: 79.7221 bits (195), Expect = 2.761e-15
Identity = 36/91 (39.56%), Postives = 51/91 (56.04%), Query Frame = 3
Query:  642 EEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKV 914
            +EPWLV+FFAPWC  C+ L P   +A+ +L G++K G LD T+H    SRY +  YPT   F          +Y+G  S+  I+ +  D V
Sbjct:  471 KEPWLVDFFAPWCPPCRALLPELRKASIQLYGQMKFGTLDCTIHEGLCSRYNINAYPTTVIF----NKSSVHEYEGHHSADGILEFIQDLV 557          

HSP 4 Score: 79.7221 bits (195), Expect = 3.121e-15
Identity = 58/221 (26.24%), Postives = 96/221 (43.44%), Query Frame = 3
Query:  174 EEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAG 836
            E+  ++ L   +F+  +   +   V FY P C HC  LAP W++ A  + GV+++ AV+    + L +  GI  +P++ IF ++  +P+ Y GER+  S+   A++ +   V                     +    G+V    D  F E +      WL+ F A   G C   +    + A  L G VK+G +D T+H      + V    T   FP G
Sbjct:  133 EDPEIITLDRGDFDAAVNSGEVWFVNFYFPRCSHCHDLAPTWREFAKEMDGVIRISAVNCGDNNRLCRSKGISSYPSLFIF-RAGMNPEKYYGERSKHSLTKFAMQYVTSKV---------------------TELWQGNVFTEIDQAFSERI-----GWLITFCAD-TGDCLEAQTR-QKLAGMLDGVVKVGWMDCTLHAELCESFDVTSSST-ALFPPG 323          

HSP 5 Score: 65.855 bits (159), Expect = 7.410e-11
Identity = 40/148 (27.03%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPA-------PEIKEILNQEI--LKSACEDHQLCVVA 1007
            +++ L   +FD  V  S E W V F+ P C HC +L P W + A E+ G +++ A++   +       G+  YP++  F AG+   + + Y G RS   + ++A   V  ++          EI +  ++ I  L + C D   C+ A
Sbjct:  136 EIITLDRGDFDAAV-NSGEVWFVNFYFPRCSHCHDLAPTWREFAKEMDGVIRISAVNCGDNNRLCRSKGISSYPSLFIFRAGM---NPEKYYGERSKHSLTKFAMQYVTSKVTELWQGNVFTEIDQAFSERIGWLITFCADTGDCLEA 279          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Cavefish
Match: dnajc10 (DnaJ heat shock protein family (Hsp40) member C10 [Source:NCBI gene;Acc:103021499])

HSP 1 Score: 139.043 bits (349), Expect = 2.143e-34
Identity = 82/269 (30.48%), Postives = 134/269 (49.81%), Query Frame = 3
Query:  183 GVLVLTNSNFNEVIEKNKYV---LVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFP-AGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLP--APEIKEILNQEILK 971
             V+ LT   F +++++ K     +V+FYAPWCG CQ+L PEW++ A  L GV+ VG VD  K+ SL Q   ++ +P I++F ++ +   +     T  +     L  L  L R+                           V+LT  +F   +L+ +E W+++F+APWCG C++  P ++  A  L+G V+ G +D   H  T    G+  YPT++F+P  G +     +Y   R S+ I    SD + ++L   A + K  L  +ILK
Sbjct:  549 AVVTLTPDTFQQLVKRRKQTETWVVDFYAPWCGPCQALLPEWRRMARMLSGVINVGTVDCQKHHSLCQSENVRAYPEIRLFPQNSNPSSN-----TLNTEYIVILCFLSSLPRAS--------------------------VDLTPEDFKRKILEGKEHWVLDFYAPWCGPCQHFAPEFEILARMLKGTVRAGKVDCQAHYQTCQSAGITAYPTVRFYPYLGTQRVRGGEYINSRDSNVI----SDVIHQRLQQLALKNKSKLKVQILK 782          

HSP 2 Score: 117.857 bits (294), Expect = 1.927e-27
Identity = 67/198 (33.84%), Postives = 96/198 (48.48%), Query Frame = 3
Query:  243 LVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMV--LKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFP 830
            LV+F+APWC  C++L PE +KA+  L G +K G +D   +  L   Y I  +PT  IF KS  S  +Y+G  +A  I    L+ + +LV                            VV LT   F ++V   K  E W+V+F+APWCG C+ L P W + A  L G + +G +D   H +      V+ YP I+ FP
Sbjct:  464 LVDFFAPWCPPCRALLPELRKASIQLYGQMKFGTLDCTIHEGLCSRYNINAYPTTVIFNKS--SVHEYEGHHSADGI----LEFIQDLVNP-------------------------AVVTLTPDTFQQLVKRRKQTETWVVDFYAPWCGPCQALLPEWRRMARMLSGVINVGTVDCQKHHSLCQSENVRAYPEIRLFP 630          

HSP 3 Score: 80.8777 bits (198), Expect = 1.309e-15
Identity = 36/91 (39.56%), Postives = 51/91 (56.04%), Query Frame = 3
Query:  642 EEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKV 914
            +EPWLV+FFAPWC  C+ L P   +A+ +L G++K G LD T+H    SRY +  YPT   F          +Y+G  S+  I+ +  D V
Sbjct:  460 KEPWLVDFFAPWCPPCRALLPELRKASIQLYGQMKFGTLDCTIHEGLCSRYNINAYPTTVIF----NKSSVHEYEGHHSADGILEFIQDLV 546          

HSP 4 Score: 73.1738 bits (178), Expect = 3.452e-13
Identity = 39/134 (29.10%), Postives = 69/134 (51.49%), Query Frame = 3
Query:  114 KYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF---GKSKHSPKDYQGERTAGSIVNAALKELDEL 506
            +Y+ I+ F  +L + + D+T E+           +++E  ++ +++FYAPWCG CQ  APE++  A  LKG V+ G VD   +    Q  GI  +PT++ +   G  +    +Y   R +  I +   + L +L
Sbjct:  643 EYIVILCFLSSLPRASVDLTPEDFK--------RKILEGKEHWVLDFYAPWCGPCQHFAPEFEILARMLKGTVRAGKVDCQAHYQTCQSAGITAYPTVRFYPYLGTQRVRGGEYINSRDSNVISDVIHQRLQQL 768          

HSP 5 Score: 72.7886 bits (177), Expect = 4.521e-13
Identity = 32/106 (30.19%), Postives = 59/106 (55.66%), Query Frame = 3
Query:  174 EEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALK 491
            E+  ++ L   +F+  +   +   V FY P C HC  LAP W++ A  + GV+++ AV+    + L +  GI  +P++ IF ++  +P+ Y GER+  S+   A++
Sbjct:  133 EDPEIITLDRGDFDAAVNSGEVWFVNFYFPRCSHCHDLAPTWREFAKEMDGVIRISAVNCGDNNRLCRSKGISSYPSLFIF-RAGMNPEKYYGERSKHSLTKFAMQ 237          

HSP 6 Score: 65.4698 bits (158), Expect = 8.203e-11
Identity = 32/112 (28.57%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQL 926
            +++ L   +FD  V  S E W V F+ P C HC +L P W + A E+ G +++ A++   +       G+  YP++  F AG+   + + Y G RS   + ++A   V  ++
Sbjct:  136 EIITLDRGDFDAAV-NSGEVWFVNFYFPRCSHCHDLAPTWREFAKEMDGVIRISAVNCGDNNRLCRSKGISSYPSLFIFRAGM---NPEKYYGERSKHSLTKFAMQYVTSKV 243          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Sea Lamprey
Match: pdia6 (protein disulfide isomerase family A, member 6 [Source:ZFIN;Acc:ZDB-GENE-030131-879])

HSP 1 Score: 442.195 bits (1136), Expect = 2.032e-152
Identity = 226/446 (50.67%), Postives = 307/446 (68.83%), Query Frame = 3
Query:  108 KMKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXX-XXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR----GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE-PKSEL 1424
            ++K    ++    +A   A  +  + V+ LT SNFN EV++ N   LVEFYAPWCGHCQ L PEWKKAATALKG+VK+GAVD D++  LG  Y ++GFPTIKIFG +K+ P+D+ G RT   IV+ AL  L  LV+ RLGG  G  S  +  ++   +G      V  +    +++     E W+VEFFAPWCGHCK L+P W  AA+E++    G+VKL A+DATV+   ++R+G++G+PTIK F  G    + Q+Y GGR+ SDIV +A +   +  PAPE+ EILNQ+++K +CE+HQLC+V++LP+ILD  +  RN YIATL+   DKYK   WGWLWTEA   PELE+  GIGGFGYPA+  VN RKMK+A L G FS+SGI +F+R++S+GRGST+ + G  LP I S E WDGKDGE+P E++IDLS++ ++E  +SEL
Sbjct:    1 EVKVFGALVLGVLVAGAQALYSPSDDVIELTASNFNREVVQSNDLWLVEFYAPWCGHCQRLIPEWKKAATALKGIVKLGAVDADEHKGLGSTYNVRGFPTIKIFGINKNKPEDFNGGRTTQGIVDGALGALRSLVKDRLGGKGGSDSGKQNINTFSGNGFCKRKPVSFSIITTNKITFTPSETWIVEFFAPWCGHCKKLEPEWAAAATEVKAQTNGRVKLAAVDATVNQELSNRFGIRGFPTIKVFRKG--EDEPQEYQGGRTKSDIVAYALELYTDNAPAPEVVEILNQDVVKKSCEEHQLCIVSILPHILDTGATGRNGYIATLQGMADKYKKKLWGWLWTEAGAQPELEDSLGIGGFGYPAMAAVNARKMKFAILKGSFSESGINEFLRELSVGRGSTAPVKGAALPPIISKEAWDGKDGELPVEDDIDLSDVELDEFDRSEL 444          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Sea Lamprey
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 154.066 bits (388), Expect = 1.308e-40
Identity = 94/248 (37.90%), Postives = 131/248 (52.82%), Query Frame = 3
Query:  168 ITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL---KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIV 893
            + EE GVL+L + NF+  +     VL+EFYAPWCGHC+  A E++K A  L      + V  VD      L + + + G+PTIKI  K +    DY G+RT  +I+ A +KE+                     +S         V+ LT+SNFDE+V    +  LVEF+APWCGHCK L P +++AA EL      + L  +DATV +    R+GV GYPT+K F    + G + DY+G R    IV
Sbjct:   52 VKEENGVLILKDLNFDFFVAGKDTVLLEFYAPWCGHCKEFASEYEKIAKELAENDPPIPVAKVDATVAVHLAERFSVSGYPTIKILKKGQAV--DYDGDRTQDAII-AKVKEV---------------------ASPDWKPPPEAVLTLTESNFDEIV-NDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKNTPPIPLAKVDATVESELGKRFGVSGYPTLKLF----RKGKAYDYNGPREQYGIV 270          

HSP 2 Score: 97.0561 bits (240), Expect = 1.622e-21
Identity = 48/108 (44.44%), Postives = 67/108 (62.04%), Query Frame = 3
Query:  180 EGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKE 494
            E VL LT SNF+E++     +LVEFYAPWCGHC+ LAPE++KAA  L      + +  VD    S LG+ +G+ G+PT+K+F K K    DY G R    IV+  +++
Sbjct:  171 EAVLTLTESNFDEIVNDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKNTPPIPLAKVDATVESELGKRFGVSGYPTLKLFRKGKAY--DYNGPREQYGIVSHMIEQ 276          

HSP 3 Score: 79.337 bits (194), Expect = 6.282e-16
Identity = 71/224 (31.70%), Postives = 97/224 (43.30%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQ-LPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLW-TEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGI 1250
            V+ L D NFD  V   ++  L+EF+APWCGHCK     +++ A EL      + +  +DATV    A R+ V GYPTIK     +K G + DYDG R+   I+    +       P PE    L +        D  + +V        C   C+       K A +  K+     L   +A    EL   FG+   GYP L +   RK K     GP  Q GI
Sbjct:   58 VLILKDLNFDFFV-AGKDTVLLEFYAPWCGHCKEFASEYEKIAKELAENDPPIPVAKVDATVAVHLAERFSVSGYPTIKI----LKKGQAVDYDGDRTQDAIIAKVKEVASPDWKPPPEAVLTLTESNFDEIVNDADIILVEFYAPW--C-GHCKKLAPEYEKAAQELSKNTPPIPLAKVDATVESELGKRFGVS--GYPTLKL--FRKGKAYDYNGPREQYGI 269          

HSP 4 Score: 75.485 bits (184), Expect = 1.057e-14
Identity = 34/97 (35.05%), Postives = 56/97 (57.73%), Query Frame = 3
Query:  615 NFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK--VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRW 899
             F++MVL + +  L+EF+APWCGHCK+L+P +     + +G   + +  +DATV+      Y  +G+PTI F P+G K    +  DG R    + ++
Sbjct:  529 TFEQMVLDNSKDVLIEFYAPWCGHCKSLEPIYKDLGKKYKGHKGLVIAKMDATVNDIPHDSYKAEGFPTIYFSPSGAKDRPIKFADGSRDLESLSKF 625          

HSP 5 Score: 55.8398 bits (133), Expect = 1.418e-8
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 3
Query:  186 VLVLTNSNFNE-VIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSS--LGQPYGIQGFPTI 407
            V V+    F + V++ +K VL+EFYAPWCGHC+SL P +K      KG   +    MD   +      Y  +GFPTI
Sbjct:  522 VKVVVGRTFEQMVLDNSKDVLIEFYAPWCGHCKSLEPIYKDLGKKYKGHKGLVIAKMDATVNDIPHDSYKAEGFPTI 598          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Sea Lamprey
Match: dnajc10 (DnaJ (Hsp40) homolog, subfamily C, member 10 [Source:ZFIN;Acc:ZDB-GENE-070327-1])

HSP 1 Score: 125.176 bits (313), Expect = 1.574e-30
Identity = 69/221 (31.22%), Postives = 107/221 (48.42%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKNKYV---LVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQG----ERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFF 827
            V+ LT   +  ++++ K     +V+FYAPWCG CQ+L PEWK+ A  L G+V+VG+VD  K+ +L Q   +  +P I++F  +  S   Y       R A S+   A   L +                                +LT   F+  VL+  E WLV+F+ PWCGHC+   P ++ AA  L+GK++ G ++           G+ GYPT+ F+
Sbjct:  559 VVTLTPETYVSLVKQRKRDEVWMVDFYAPWCGPCQALLPEWKRMARMLSGMVQVGSVDCQKHHALCQSEMVHAYPEIRLFPMNPASSDKYFKYNGWHRDANSLKGWAFGYLPQTAE-----------------------------DLTPQKFNSEVLEGMEHWLVDFYTPWCGHCQIFAPEFEIAARLLKGKLRTGKVNCQNDPHVCQSAGIHGYPTVMFY 750          

HSP 2 Score: 118.627 bits (296), Expect = 1.883e-28
Identity = 71/224 (31.70%), Postives = 111/224 (49.55%), Query Frame = 3
Query:  243 LVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMV--LKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQ-DYDG-GRSSSDIVRWA 902
            L++F+APWC  C++L PE +KA+  L G +K G +D   +S +   +GI  +PT  IF +S  +  +Y G+ +A        ++L E V+  +  +                     VV LT   +  +V   K +E W+V+F+APWCG C+ L P W + A  L G V++G++D   H A      V  YP I+ FP    S D    Y+G  R ++ +  WA
Sbjct:  473 LIDFFAPWCPPCRALLPELRKASRLLTGQLKFGTIDCTIHSKICNLHGIHAYPTTLIFNQS--NIHEYNGQHSA--------EQLMEYVQDLMSPS---------------------VVTLTPETYVSLVKQRKRDEVWMVDFYAPWCGPCQALLPEWKRMARMLSGMVQVGSVDCQKHHALCQSEMVHAYPEIRLFPMNPASSDKYFKYNGWHRDANSLKGWA 665          

HSP 3 Score: 85.8853 bits (211), Expect = 6.998e-18
Identity = 54/206 (26.21%), Postives = 92/206 (44.66%), Query Frame = 3
Query:  294 EWKKAATALKGV-VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASD 908
            E+KK  T LK   +KVG +D + +  +     I     +   GK  H  + + G+ T   +V+ A + ++ LV +                             L+   F E   K +EPWL++FFAPWC  C+ L P   +A+  L G++K G +D T+H+   + +G+  YPT   F       +  +Y+G  S+  ++ +  D
Sbjct:  384 EFKKLNTLLKSKNIKVGTLDCNPFPYICDQLYINSRAVVVFKGKGLHEYEIHHGKTTLYELVSFAKESVNSLVHT-----------------------------LSPETFPE---KDKEPWLIDFFAPWCPPCRALLPELRKASRLLTGQLKFGTIDCTIHSKICNLHGIHAYPTTLIF----NQSNIHEYNGQHSAEQLMEYVQD 553          

HSP 4 Score: 74.7146 bits (182), Expect = 2.299e-14
Identity = 38/84 (45.24%), Postives = 52/84 (61.90%), Query Frame = 3
Query:  195 LTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF---GKSKHS 434
            LT   FN EV+E  ++ LV+FY PWCGHCQ  APE++ AA  LKG ++ G V+      + Q  GI G+PT+  +   G+SK S
Sbjct:  676 LTPQKFNSEVLEGMEHWLVDFYTPWCGHCQIFAPEFEIAARLLKGKLRTGKVNCQNDPHVCQSAGIHGYPTVMFYQYQGRSKRS 759          

HSP 5 Score: 69.3218 bits (168), Expect = 1.074e-12
Identity = 55/222 (24.77%), Postives = 93/222 (41.89%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNF---DEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQA-ASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGV 839
            VL L    F+  +   +   V FY+P C HC  LAP W++ A  + GV++V AV+      + +  GI  +P++ ++ ++   P  Y G+R+   +V   +K     V S+                         V EL   NF    E    +E  WL+ + +   G C  L  H  +  A  L G   +G +D +      S+  ++   T+ F+P G+
Sbjct:  133 VLTLDRGEFDAAVSSGELFFVNFYSPRCSHCHELAPMWREFAKEMDGVIRVAAVNCGDNRMMCRSKGIGSYPSLYVY-RAGMQPVKYSGDRSKDDLVRFVMK----YVTSK-------------------------VTELWAGNFVNAFEQAGSTETGWLLSYCSD-IGDC--LSQHTRRKLAGMLDGMANVGWVDCSTQKHICSQMNIEESKTV-FYPPGL 320          

HSP 6 Score: 62.3882 bits (150), Expect = 1.451e-10
Identity = 33/112 (29.46%), Postives = 56/112 (50.00%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQL 926
            +V+ L    FD  V  S E + V F++P C HC  L P W + A E+ G +++ A++   +       G+  YP++  + AG++      Y G RS  D+VR+    V  ++
Sbjct:  132 EVLTLDRGEFDAAV-SSGELFFVNFYSPRCSHCHELAPMWREFAKEMDGVIRVAAVNCGDNRMMCRSKGIGSYPSLYVYRAGMQ---PVKYSGDRSKDDLVRFVMKYVTSKV 239          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006474.1 (pep scaffold:Pmarinus_7.0:GL478000:14574:47610:1 gene:ENSPMAG00000005827.1 transcript:ENSPMAT00000006474.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.25 bits (308), Expect = 1.986e-30
Identity = 80/252 (31.75%), Postives = 122/252 (48.41%), Query Frame = 3
Query:  177 EEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVK-----VGAVDMDKYSSLGQPYGIQGFPTIKIF--GKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR--GKVKLGALDATV--HTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRW 899
            +  V  LT+ +F + ++K+  VLV FYAPWCGHC+ L P++ +AA  L    +     + AVD   + +L + + I+GFPT+K F  G+ K++  D + +    S +                                      DV  L+ + F E  LK +   L+ F+APWC HCK  KPH+  AA++LR   KV L A+D T   +    S+ GV+GYPT+  +  G   G    Y GGR  +D + +
Sbjct:  277 DSAVFHLTDEDFQDFVDKHPNVLVMFYAPWCGHCKKLKPDYDEAAKILNNEEENSPGVLAAVDATIHRALAERFAIKGFPTMKFFQDGEEKYTVSDLRSKDKILSWIR--------------------DPQPPPPPEVPWDEQENDVAHLSVATFREF-LKKKRHALLMFYAPWCFHCKQAKPHFTAAAAQLREDHKVALAAVDCTKQDNNELCSQEGVRGYPTMNHYTYGKFVG---PYTGGRQEADFINF 504          

HSP 2 Score: 114.39 bits (285), Expect = 1.893e-27
Identity = 79/249 (31.73%), Postives = 124/249 (49.80%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKN-KYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMD--KYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVK-----LGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASD 908
            V V ++  F  +++K  + +L+ FYAPWCG C+ + P +++AAT  K    +  +++   ++  +   Y + G+PT   F K K    +YQ          A  K++ E +++         S          S +   V  LTD +F + V K     LV F+APWCGHCK LKP +D+AA  L  + +     L A+DAT+H A A R+ ++G+PT+KFF  G +     D    RS   I+ W  D
Sbjct:  156 VHVHSDKEFRLLLKKEERPILMMFYAPWCGVCKRMKPVFQEAATMAKKTYVLAGMNVHPAEFDGIKSDYNVTGYPTFCYFEKGKFR-FNYQS-------YGAQAKDIVEWLKN-------PESPKPTVPEVAWSETDSAVFHLTDEDFQDFVDKHPNV-LVMFYAPWCGHCKKLKPDYDEAAKILNNEEENSPGVLAAVDATIHRALAERFAIKGFPTMKFFQDGEEKYTVSDL---RSKDKILSWIRD 385          

HSP 3 Score: 72.4034 bits (176), Expect = 7.749e-14
Identity = 69/244 (28.28%), Postives = 109/244 (44.67%), Query Frame = 3
Query:  591 DVVEL-TDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTA----TASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEI----LNQEILKSACEDHQLCVVAVLPNIL---------DCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRD 1268
            DVV + +D  F  ++ K E P L+ F+APWCG CK +KP + +AA+  +    L  ++  VH A      S Y V GYPT  +F  G    + Q Y  G  + DIV W  +    + P P + E+     +  +     ED Q   V   PN+L          C+ + + DY    K+  ++ +++       +A     L   F I GF  P +      + KY T++   S+  I  ++RD
Sbjct:  154 DVVHVHSDKEFRLLLKKEERPILMMFYAPWCGVCKRMKPVFQEAATMAKKTYVLAGMN--VHPAEFDGIKSDYNVTGYPTFCYFEKGKFRFNYQSY--GAQAKDIVEWLKNP---ESPKPTVPEVAWSETDSAVFHLTDEDFQD-FVDKHPNVLVMFYAPWCGHCK-KLKPDYDEAAKILNNEEENSPGVLAAVDATIHRALAERFAIKGF--PTMKFFQDGEEKY-TVSDLRSKDKILSWIRD 385          

HSP 4 Score: 59.6918 bits (143), Expect = 8.994e-10
Identity = 36/109 (33.03%), Postives = 54/109 (49.54%), Query Frame = 3
Query:  174 EEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKV--GAVDMDKY--SSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAAL 488
            +E  V  L+ + F E ++K ++ L+ FYAPWC HC+   P +  AA  L+   KV   AVD  K   + L    G++G+PT+  +   K     Y G R     +N  L
Sbjct:  399 QENDVAHLSVATFREFLKKKRHALLMFYAPWCFHCKQAKPHFTAAAAQLREDHKVALAAVDCTKQDNNELCSQEGVRGYPTMNHYTYGKFV-GPYTGGRQEADFINFLL 506          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Sea Lamprey
Match: txndc5 (thioredoxin domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1951])

HSP 1 Score: 113.62 bits (283), Expect = 1.282e-27
Identity = 78/265 (29.43%), Postives = 130/265 (49.06%), Query Frame = 3
Query:  165 DITE-EEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK--GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSI-----VNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHW-DQAASELRG--KVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQL 926
            DI E + G+  LT+ +F E + +  Y  ++F+APWCGHC++L P W++ A+  +  G VK+  VD   +  +     ++G+PT+  F K       Y+G+R   S+         ++  DE+V  +                 G       V+ L ++NFD  V  ++    V+F+APWCGHCKNL P W D A  E  G  KV +  +D T      S+  V+GYPT+  +  G + G   +++G R+   +  +   +  ++L
Sbjct:  164 DIPEPQHGLYELTSGSFKEHVAEG-YHFIKFFAPWCGHCKALIPAWEQLASTFEYSGKVKIAKVDCTAHQDICNENQVRGYPTLLWF-KDGEKVDQYRGKRDLDSLKVFVDTQIQIEPEDEVVTQQ----------------AGDEEEASSVLVLNENNFDATV--ADGITFVKFYAPWCGHCKNLAPTWEDLAKKEFSGLSKVTIAKVDCTSEAQLCSKQHVRGYPTLLLYVGGKQVG---EHEGTRNLEALHSYVLSRARDEL 405          

HSP 2 Score: 111.309 bits (277), Expect = 6.519e-27
Identity = 75/239 (31.38%), Postives = 114/239 (47.70%), Query Frame = 3
Query:  243 LVEFYAPWCGHCQSLAPEWKKAATALKGVVK----VGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAAS--ELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEI 941
             + F+APWCGHCQ L   W         + +    V  VD   ++     +G++G+PT+K+F   + S   YQG+R   ++ +  L+ L+E           G      + S         + ELT  +F E V  +E    ++FFAPWCGHCK L P W+Q AS  E  GKVK+  +D T H    +   V+GYPT+ +F    K G+  D   G+   D ++   D  ++  P  E+
Sbjct:   61 FIMFFAPWCGHCQKLQSTWNTLGDKYNEMPEPPAYVAKVDCTMHAQTCSDHGVKGYPTLKLFKPGQKSIL-YQGQRDLDTLESWMLQTLNE---------DAGVHEESERPSPDIPEPQHGLYELTSGSFKEHV--AEGYHFIKFFAPWCGHCKALIPAWEQLASTFEYSGKVKIAKVDCTAHQDICNENQVRGYPTLLWF----KDGEKVDQYRGKRDLDSLKVFVDTQIQIEPEDEV 283          

HSP 3 Score: 67.3958 bits (163), Expect = 2.404e-12
Identity = 41/122 (33.61%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  624 EMVLKS--EEPWLVEFFAPWCGHCKNLKPHW----DQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVE--------QLPAPEIKE 947
            EM++ S  + P  + FFAPWCGHC+ L+  W    D+          +  +D T+H  T S +GV+GYPT+K F  G K   S  Y G R    +  W    + E        + P+P+I E
Sbjct:   49 EMLVHSVDQAPHFIMFFAPWCGHCQKLQSTWNTLGDKYNEMPEPPAYVAKVDCTMHAQTCSDHGVKGYPTLKLFKPGQK---SILYQGQRDLDTLESWMLQTLNEDAGVHEESERPSPDIPE 167          

HSP 4 Score: 62.7734 bits (151), Expect = 7.745e-11
Identity = 40/124 (32.26%), Postives = 64/124 (51.61%), Query Frame = 3
Query:  147 LAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKK-AATALKGVVKV--GAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAAL-KELDEL 506
            + Q   D  E   VLVL  +NF+  +  +    V+FYAPWCGHC++LAP W+  A     G+ KV    VD    + L     ++G+PT+ ++   K    +++G R   ++ +  L +  DEL
Sbjct:  284 VTQQAGDEEEASSVLVLNENNFDATV-ADGITFVKFYAPWCGHCKNLAPTWEDLAKKEFSGLSKVTIAKVDCTSEAQLCSKQHVRGYPTLLLYVGGKQV-GEHEGTRNLEALHSYVLSRARDEL 405          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Yeast
Match: PDI1 (Protein disulfide isomerase; multifunctional oxidoreductase of the ER lumen, essential for disulfide bond formation in secretory and cell-surface proteins, processing of non-native disulfide bonds; Ero1p activator; complexes with exomannosidase, Mnl1p to facilitate the recognition of misfolded glycoproteins and the trimming of glycan Man8GlcNAc2 to Man7GlcNAc2 on substrates, thereby accelerating ERAD; PDI1 has a paralog, EUG1, that arose from the whole genome duplication [Source:SGD;Acc:S000000548])

HSP 1 Score: 92.0485 bits (227), Expect = 2.587e-20
Identity = 47/118 (39.83%), Postives = 72/118 (61.02%), Query Frame = 3
Query:  147 LAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAA-TALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSK-HSPKDYQGERTAGSIVNAALKE 494
             AQ  A   E+  V+ L   +FNE I+ +  VL EF+APWCGHC+++APE+ KAA T ++  + +  +D  +   L   + I GFP++KIF  S  ++  DY+G RTA +IV   +K+
Sbjct:   21 FAQQEAVAPEDSAVVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQ 138          

HSP 2 Score: 75.0998 bits (183), Expect = 7.815e-15
Identity = 43/120 (35.83%), Postives = 67/120 (55.83%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK-VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDK------VVEQLPA 932
            VV+L   +F+E + +S +  L EFFAPWCGHCKN+ P + +AA  L  K + L  +D T +      + + G+P++K F       +S DY+G R++  IV++   +      VV  LPA
Sbjct:   34 VVKLATDSFNEYI-QSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEHNIPGFPSLKIF-KNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLPA 151          

HSP 3 Score: 63.929 bits (154), Expect = 2.945e-11
Identity = 39/99 (39.39%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAA---SELRGKVKLGALDATVHTATASR-YGVQGYPTIKFFPAGVKSGDSQDYDGGRS 878
            V +L   N DE+V   ++  LV ++APWCGHCK L P + + A   +     V +  LD   HT    R   ++GYPTI  +P G KS +S  Y G RS
Sbjct:  378 VFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLD---HTENDVRGVVIEGYPTIVLYPGGKKS-ESVVYQGSRS 472          

HSP 4 Score: 60.077 bits (144), Expect = 4.778e-10
Identity = 35/106 (33.02%), Postives = 56/106 (52.83%), Query Frame = 3
Query:  171 TEEEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAA-TALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIVN 479
             ++  V  L   N +E++ +  K VLV +YAPWCGHC+ LAP +++ A T       V    +D   +  +   I+G+PTI ++ G  K     YQG R+  S+ +
Sbjct:  373 NQDSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFD 478          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Yeast
Match: MPD1 (Member of the protein disulfide isomerase (PDI) family; interacts with and inhibits the chaperone activity of Cne1p; MPD1 overexpression in a pdi1 null mutant suppresses defects in Pdi1p functions such as carboxypeptidase Y maturation [Source:SGD;Acc:S000005814])

HSP 1 Score: 84.7297 bits (208), Expect = 1.628e-18
Identity = 52/158 (32.91%), Postives = 78/158 (49.37%), Query Frame = 3
Query:  111 MKYLSIV-----LFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYV-LVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAV--DMDKYSSLGQPYGIQGFPTIKIFGKSK----------------HSPKDYQGERTAGSIVNAALKELDELVR 512
            M +L+I+     LF     +       +  +  LT  +F++ I    Y  LVEFYAPWCGHC+ L+  ++KAA  L GVV+V AV  D++K  +L   Y + GFPT+ +F   K                H+ + Y G RT   IV+ +L  +   V+
Sbjct:    1 MLFLNIIKLLLGLFIMNEVKAQNFYDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEVYSGARTLAPIVDFSLSRIRSYVK 158          

HSP 2 Score: 68.9366 bits (167), Expect = 2.899e-13
Identity = 32/80 (40.00%), Postives = 48/80 (60.00%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGAL--DATVHTATASRYGVQGYPTIKFF 827
            + ELT  +FD+ +  +    LVEF+APWCGHCK L   + +AA  L G V++ A+  D   + A  ++Y V G+PT+  F
Sbjct:   31 ISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVF 110          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Yeast
Match: EUG1 (Protein disulfide isomerase of the endoplasmic reticulum lumen; EUG1 has a paralog, PDI1, that arose from the whole genome duplication; function overlaps with that of Pdi1p; may interact with nascent polypeptides in the ER [Source:SGD;Acc:S000002926])

HSP 1 Score: 71.633 bits (174), Expect = 9.755e-14
Identity = 43/107 (40.19%), Postives = 58/107 (54.21%), Query Frame = 3
Query:  123 SIVLFC----FALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK-GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSK 428
            +IV FC    F LA+ +A  T    +LVLT   F   IE +  VLVEF+APWC H Q L P  ++AA+ LK   V V  +D +  S +     I  +PT+KIF   +
Sbjct:   10 AIVSFCLFASFTLAENSARATPGSDLLVLTEKKFKSFIESHPLVLVEFFAPWCLHSQILRPHLEEAASILKEHNVPVVQIDCEANSMVCLQQTINTYPTLKIFKNGR 116          

HSP 2 Score: 64.6994 bits (156), Expect = 1.682e-11
Identity = 35/104 (33.65%), Postives = 58/104 (55.77%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR-GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRW 899
            D++ LT+  F   + +S    LVEFFAPWC H + L+PH ++AAS L+   V +  +D   ++    +  +  YPT+K F  G +  D Q Y G + + +I ++
Sbjct:   34 DLLVLTEKKFKSFI-ESHPLVLVEFFAPWCLHSQILRPHLEEAASILKEHNVPVVQIDCEANSMVCLQQTINTYPTLKIFKNG-RIFDGQVYRGVKITDEITQY 135          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Yeast
Match: TRX1 (Cytoplasmic thioredoxin isoenzyme; part of thioredoxin system which protects cells against oxidative and reductive stress; forms LMA1 complex with Pbi2p; acts as a cofactor for Tsa1p; required for ER-Golgi transport and vacuole inheritance; with Trx2p, facilitates mitochondrial import of small Tims Tim9p, Tim10p, Tim13p by maintaining them in reduced form; abundance increases iunder DNA replication stress; TRX1 has a paralog, TRX2, that arose from the whole genome duplication [Source:SGD;Acc:S000004033])

HSP 1 Score: 48.521 bits (114), Expect = 8.755e-8
Identity = 25/81 (30.86%), Postives = 41/81 (50.62%), Query Frame = 3
Query:  198 TNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPK 440
            T S F+  I ++K V+V+FYA WCG C+ +AP  +K +           +D+D+   + Q   +   PT+ +F   K   K
Sbjct:    7 TASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQ-ADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAK 86          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Yeast
Match: EPS1 (ER protein with chaperone and co-chaperone activity; involved in retention of resident ER proteins; has a role in recognizing proteins targeted for ER-associated degradation (ERAD), member of the protein disulfide isomerase family [Source:SGD;Acc:S000001267])

HSP 1 Score: 46.9802 bits (110), Expect = 6.546e-6
Identity = 29/105 (27.62%), Postives = 51/105 (48.57%), Query Frame = 3
Query:  195 LTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKV-----GAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKE 494
            L  +NF E + K  ++ ++FY+P+C HC+ LAP W +     K   K        V+  + + L     I+ FP I+++  S +     +  RT  S++  A +E
Sbjct:   37 LNPTNFKEELSKGLHI-IDFYSPYCPHCKHLAPVWMETWEEFKEESKTLNITFSQVNCIESADLCGDENIEYFPEIRLYNPSGYIKSFTETPRTKESLIAFARRE 140          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Nematostella
Match: EDO37155 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGL1])

HSP 1 Score: 491.5 bits (1264), Expect = 1.108e-171
Identity = 238/417 (57.07%), Postives = 311/417 (74.58%), Query Frame = 3
Query:  186 VLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDS-QDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGI---EEPKSE 1421
            V+ LT +NFN  VI  +   +VEFYAPWCGHC++LAPEW KAATALKGVVKVGAVDMD + S+G PY I+GFPTIKIFG +K+SP+DY G+RTA  IV+AA++   E V  R+ G    SS    +  G       DVVELTD+NF++ VL S++ WLVEFFAPWCGHC+ L P W +AA+EL+GKVK+GALDATVHT TASRY VQGYPTIK F AG+K+  S +DY GGR++SDI+++A DK  + +  PE+ + ++ E+LK  C +H +CV+A LP+ILD  +  RN Y+A LK  G+KYK NRWGWLW+EA   P+LE    +GGFGYPA+V VN+RK K+A L G F ++GI +F+R VS+GRGST+ + GD LP + S+E WDGKDG++P+EE+IDLS++ +   +EPK E
Sbjct:   14 VVELTANNFNNRVINDDAVWMVEFYAPWCGHCKALAPEWMKAATALKGVVKVGAVDMDVHQSVGGPYNIRGFPTIKIFGANKNSPQDYNGQRTAQGIVDAAMRAAQEAVSQRMSGGGRSSSGGGGRRGGSGGNKE-DVVELTDTNFEKEVLNSKDLWLVEFFAPWCGHCQRLAPEWAKAATELKGKVKVGALDATVHTVTASRYQVQGYPTIKVFAAGIKNSHSVEDYQGGRTASDIIQYALDKAADSIEPPEVIQAISNEVLKEGCNEHPICVIAFLPHILDSGASGRNTYLANLKELGEKYKKNRWGWLWSEAAAQPKLEEAVEVGGFGYPAMVAVNIRKKKFAVLKGSFDRTGIDEFLRTVSVGRGSTATMRGDSLPELSSIEAWDGKDGQLPQEEDIDLSDVDLDDEDEPKKE 429          

HSP 2 Score: 113.235 bits (282), Expect = 3.461e-27
Identity = 53/116 (45.69%), Postives = 75/116 (64.66%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIV----RWASDKVVEQL 926
            DVVELT +NF+  V+  +  W+VEF+APWCGHCK L P W +AA+ L+G VK+GA+D  VH +    Y ++G+PTIK F  G      QDY+G R++  IV    R A + V +++
Sbjct:   13 DVVELTANNFNNRVINDDAVWMVEFYAPWCGHCKALAPEWMKAATALKGVVKVGAVDMDVHQSVGGPYNIRGFPTIKIF--GANKNSPQDYNGQRTAQGIVDAAMRAAQEAVSQRM 126          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Nematostella
Match: EDO47340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMG9])

HSP 1 Score: 167.933 bits (424), Expect = 3.417e-47
Identity = 97/267 (36.33%), Postives = 141/267 (52.81%), Query Frame = 3
Query:  129 VLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL--KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDEL--VRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVK--LGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDK 911
            VLF   L    + +T+ + V+ LT  NF+EV+   K+ LVEFYAPWCGHC+ LAP +++   A      V +  VD D    LG  + ++GFPTIK F K   +P++Y G R     +N  +K ++E   VR R+                        V +L +SNFD++V   +   LVEFFAPWCGHCKNL P +++     + +    +  +DA  H+A   +YGV GYPT+KFF    K G  ++Y  GR     V + ++K
Sbjct:    6 VLFKLFLLFSISSLTQGK-VIDLTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPTYEQLGEAYTQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRD----INDFIKFIEEKTGVRGRVPVIPSA------------------VADLDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVYEKVGEAFKNEPNCVIAKVDADAHSALGQKYGVSGYPTLKFFSKTNKDG--EEYSSGRDEQSFVDFMNEK 247          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Nematostella
Match: EDO32930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM8])

HSP 1 Score: 170.244 bits (430), Expect = 5.130e-46
Identity = 98/256 (38.28%), Postives = 136/256 (53.12%), Query Frame = 3
Query:  165 DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKV 914
            ++ EE+ VLVL + NF+ VIE+N  +LVEFYAPWCGHC+SLAPE+ KAA  +K     V    +D    S + Q + + G+PT+KIF K   +P +Y+G R    IV    K+ D   +                            + LT  NF E V+  E   LVEFFAPWCGHCK L P +++AA EL+     + L  +DAT+ +  A +Y VQGYPT+K F    + G + +Y G R    I  +   +V
Sbjct:   56 EVKEEDDVLVLNSKNFDRVIEENNIILVEFYAPWCGHCKSLAPEYAKAAKKMKLNDPPVPFAKMDATVASDIAQRFDVSGYPTLKIFRKG--TPYEYEGPREESGIVEYMKKQSDPNWKPPPVA----------------------ALTLTKENFTE-VVNRESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKNDPPIPLAIVDATIESELAQKYEVQGYPTLKVF----RKGKATEYKGQRDQYGIASYMRSQV 282          

HSP 2 Score: 75.0998 bits (183), Expect = 2.845e-14
Identity = 38/114 (33.33%), Postives = 62/114 (54.39%), Query Frame = 3
Query:  618 FDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRG--KVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEIL 953
            FDE+V   ++  L+EF+APWCGHCK L+P + +     R    + +  +DAT +    S Y V+G+PTI +F       +   +DGGR   D++++  +K    L   + K+ L
Sbjct:  535 FDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRNDKNIVIAKIDATAND-VPSTYAVEGFPTI-YFATSKDKKNPIKFDGGRELKDLIKFVEEKATVSLSKEKAKDEL 646          

HSP 3 Score: 66.6254 bits (161), Expect = 1.371e-11
Identity = 37/109 (33.94%), Postives = 58/109 (53.21%), Query Frame = 3
Query:  171 TEEEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG-----VVKVGAVDMDKYSSLGQPYGIQGFPTIKI-FGKSKHSPKDYQGERTAGSIV 476
            + +E V V+    F+E++ +  K VL+EFYAPWCGHC++L P +KK     +      + K+ A   D  S+    Y ++GFPTI     K K +P  + G R    ++
Sbjct:  522 SNKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRNDKNIVIAKIDATANDVPST----YAVEGFPTIYFATSKDKKNPIKFDGGRELKDLI 626          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Nematostella
Match: EDO34590 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNX3])

HSP 1 Score: 123.25 bits (308), Expect = 5.298e-31
Identity = 77/250 (30.80%), Postives = 122/250 (48.80%), Query Frame = 3
Query:  171 TEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK--GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDE--LVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKV---KLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRW 899
            T E GV +LT + F++ IE   +  V+FYAPWC HC  LAP W++ A   K    + +  +D   + S    +G+ GFPT+K+F   +   + Y G R+   + N    ++ E  L+ +     S  +       +   +       +L + NFD  V  S     V+F+APWC HCK L P WDQ A++   +V   K+  +D T   +    +G+ GYPT+  F  GV+    ++Y G R    + R+
Sbjct:  107 TSEAGVHILTKNTFDKHIELGLH-FVKFYAPWCIHCIKLAPIWERLAEDFKDNADITISKIDCTAHGSKCSQHGVNGFPTLKLFKNGREVDR-YSGMRSLEDLKNYVKLKIAEHGLLSTVTTDKSETAEEVPPTDTDMDAADLIKPYQLNNQNFDTTV--SLGTTFVKFYAPWCRHCKILAPVWDQLANKCADQVAGPKIAKVDCTKEESLCQSFGINGYPTLMLFKDGVQ---KKEYSGNRDLDSLYRF 349          

HSP 2 Score: 89.3521 bits (220), Expect = 2.163e-19
Identity = 66/232 (28.45%), Postives = 106/232 (45.69%), Query Frame = 3
Query:  243 LVEFYAPWCGHCQSLAPEWK---KAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELR--GKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQ 923
             V FY PWC HC+++ P W+   +  +  K  + +  VD     +L     I+ +PT+K++       K Y G R A  +       +D++V              + K S G S S   V  LT + FD+ +        V+F+APWC HC  L P W++ A + +    + +  +D T H +  S++GV G+PT+K F  G    +   Y G RS  D+  +   K+ E 
Sbjct:    7 FVMFYGPWCEHCKNMMPAWEALGEQYSKEKRDLTIAKVDCTSDVNLCVKQNIRAYPTMKLYYDG--DIKRYTGRRNAEDMKVF----VDKIV---------LKPEGKSKDSEGLSTSEAGVHILTKNTFDKHIELGLH--FVKFYAPWCIHCIKLAPIWERLAEDFKDNADITISKIDCTAHGSKCSQHGVNGFPTLKLFKNG---REVDRYSGMRSLEDLKNYVKLKIAEH 218          

HSP 3 Score: 71.2478 bits (173), Expect = 1.912e-13
Identity = 39/106 (36.79%), Postives = 54/106 (50.94%), Query Frame = 3
Query:  195 LTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVV---KVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDE 503
            L N NF+  +       V+FYAPWC HC+ LAP W + A      V   K+  VD  K  SL Q +GI G+PT+ +F K     K+Y G R   S+    ++  D+
Sbjct:  253 LNNQNFDTTVSLGT-TFVKFYAPWCRHCKILAPVWDQLANKCADQVAGPKIAKVDCTKEESLCQSFGINGYPTLMLF-KDGVQKKEYSGNRDLDSLYRFIMQNHDK 356          

HSP 4 Score: 57.7658 bits (138), Expect = 4.418e-9
Identity = 29/96 (30.21%), Postives = 49/96 (51.04%), Query Frame = 3
Query:  639 SEEPWLVEFFAPWCGHCKNLKPHWD---QAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVV 917
            S  P  V F+ PWC HCKN+ P W+   +  S+ +  + +  +D T       +  ++ YPT+K +      GD + Y G R++ D+  +  DK+V
Sbjct:    2 SSTPHFVMFYGPWCEHCKNMMPAWEALGEQYSKEKRDLTIAKVDCTSDVNLCVKQNIRAYPTMKLY----YDGDIKRYTGRRNAEDMKVFV-DKIV 92          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Nematostella
Match: EDO41376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4E6])

HSP 1 Score: 121.709 bits (304), Expect = 7.163e-30
Identity = 81/248 (32.66%), Postives = 120/248 (48.39%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK-----GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKL--GALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASD 908
            V+ L +  F++ + KN  VLV FYAPWCGHC+++ PE+  AA  LK     GV+   AVD  K ++LG+ + ++G+PT   +   + +      ER   SIVN                                S    +V  L+D+ F   V K ++  LV F+APWCGHCK  KP    AA   + K K+   A+D T   A   ++GV+GYPT ++F  G    +   Y  GR + D +++  D
Sbjct:  243 VVHLRDDMFDDFVAKNPSVLVMFYAPWCGHCKAMKPEYVDAAQTLKEQEIPGVL--AAVDATKEAALGKRFKVEGYPTGTSYMDGEFAFD--VNERKGDSIVN--------------FMKDPKEPPRPPPPEQEWSEIPSEVYHLSDTTFKSFV-KKKKHVLVMFYAPWCGHCKKAKPELMSAAKHHKDKNKIAYAAVDCTKEMAVCQQFGVEGYPTFRYFNYG---KNDFKYTSGREAKDFIQFMDD 468          

HSP 2 Score: 100.908 bits (250), Expect = 9.029e-23
Identity = 103/380 (27.11%), Postives = 160/380 (42.11%), Query Frame = 3
Query:  219 VIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYS--SLGQPYGIQGFPTIKIF--GKSKHSPKDYQGERTAGSIVN--------AALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKV---KLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVV-----------EQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLG 1280
            +  + K VL+ FYAPWCG+C+   PE+  AAT  K    +  +D+D     S+   Y I GFPT   F  G+ K+    Y G+    ++V         A +KE DE   S                      +  +VV L D  FD+ V K+    LV F+APWCGHCK +KP +  AA  L+ +     L A+DAT   A   R+ V+GYPT   +  G  + D  +    R    IV +  D               ++P+ E+  + +        +   + V+   P    C+ + + + ++  K   DK   N+  +   +  K   +   FG+   GYP     N  K  +   +G  ++  IQ F+ D   G
Sbjct:  131 LTREKKPVLIMFYAPWCGYCKRFKPEFAAAATEHKDEAVLAGMDVDTEDGYSVRVHYNITGFPTTIYFELGQPKYK---YSGKHEKDALVQWMKDPSAVAPVKE-DEKPWS---------------------DTPSEVVHLRDDMFDDFVAKNPS-VLVMFYAPWCGHCKAMKPEYVDAAQTLKEQEIPGVLAAVDATKEAALGKRFKVEGYPTGTSYMDGEFAFDVNE----RKGDSIVNFMKDPKEPPRPPPPEQEWSEIPS-EVYHLSDTTFKSFVKKKKHVLVMFYAPWCGHCK-KAKPELMSAAKHHKDK---NKIAYAAVDCTKEMAVCQQFGVE--GYPTFRYFNYGKNDFKYTSGREAKDFIQ-FMDDPREG 472          

HSP 3 Score: 64.6994 bits (156), Expect = 3.488e-11
Identity = 33/109 (30.28%), Postives = 54/109 (49.54%), Query Frame = 3
Query:  591 DVVELTDS-NFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASR--YGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASD 908
            DVV L  +    +++ + ++P L+ F+APWCG+CK  KP +  AA+E + +  L  +D       + R  Y + G+PT  +F  G        Y G      +V+W  D
Sbjct:  117 DVVHLEKAGELSKLLTREKKPVLIMFYAPWCGYCKRFKPEFAAAATEHKDEAVLAGMDVDTEDGYSVRVHYNITGFPTTIYFELG---QPKYKYSGKHEKDALVQWMKD 222          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Medaka
Match: pdia6 (protein disulfide isomerase family A member 6 [Source:NCBI gene;Acc:101171545])

HSP 1 Score: 464.151 bits (1193), Expect = 1.964e-160
Identity = 236/432 (54.63%), Postives = 310/432 (71.76%), Query Frame = 3
Query:  129 VLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAAS----ELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            VL C  L    A  +  + V+ LT SNFN EV++ +   LVEFYAPWCGHC++LAP+WKKAATALKG+VKVGAVD D++ SLG  YG++GFPTIKIFG +K+ P++YQG R++ +IV+ A+  L  LV+ RL G SG S    +  SG S  S  DVVELTD NFD+ VL+S++ WLVEFFAPWCGHCKNL+P W  AA+    + +GKV+LGA+DATVH   +SRYGV+G+PTIK F  G    + +DY GGR+  DI+  A D   +  P PE+ EILN+++LKS CE  QLCV+AVLP+ILD  +  RN Y+  +     KYK   WGWLWTEA    ELE+  GIGGFGYPA+  +N RKMK+A L G FS++GI +F+R++S+GRGST+ + G  +P I +VEPWDGKDG++P EE+ DLS++ ++E
Sbjct:    8 VLGCSLLLSVEALYSPSDDVVELTPSNFNREVMQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKVGAVDADEHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGARSSQAIVDGAMNALRSLVKDRLSGKSGSSGYSRQSDSGSSGSSK-DVVELTDDNFDKTVLQSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVDATVHQVLSSRYGVRGFPTIKIFRKGE---EPEDYQGGRTRGDIIERALDLFSDNAPPPELVEILNEDVLKSTCEGSQLCVIAVLPHILDTGAAGRNGYLEVMIKMAQKYKKKMWGWLWTEAGAQMELESALGIGGFGYPAMAAINTRKMKFALLKGSFSETGIHEFLRELSVGRGSTATLGGGVMPKIHAVEPWDGKDGQLPVEEDYDLSDVDLDE 435          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Medaka
Match: pdia6 (protein disulfide isomerase family A member 6 [Source:NCBI gene;Acc:101171545])

HSP 1 Score: 401.364 bits (1030), Expect = 4.742e-136
Identity = 211/431 (48.96%), Postives = 281/431 (65.20%), Query Frame = 3
Query:  129 VLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAAS----ELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEE 1409
            VL C  L    A  +  + V+ LT SNFN  + ++   L         HC S             G+VKVGAVD D++ SLG  YG++GFPTIKIFG +K+ P++YQG R++ +IV+ A+  L  LV+ RL G SG S     K          DVVELTD NFD+ VL+S++ WLVEFFAPWCGHCKNL+P W  AA+    + +GKV+LGA+DATVH   +SRYGV+G+PTIK F  G    + +DY GGR+  DI+  A D   +  P PE+ EILN+++LKS CE  QLCV+AVLP+ILD  +  RN Y+  +     KYK   WGWLWTEA    ELE+  GIGGFGYPA+  +N RKMK+A L G FS++GI +F+R++S+GRGST+ + G  +P I +VEPWDGKDG++P EE+ DLS++ ++E
Sbjct:   10 VLGCSLLLSVEALYSPSDDVVELTPSNFNREVMQSDISL---------HCTS-------KGFCGTGIVKVGAVDADEHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGARSSQAIVDGAMNALRSLVKDRLSGKSGSSGYSSSK----------DVVELTDDNFDKTVLQSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVDATVHQVLSSRYGVRGFPTIKIFRKGE---EPEDYQGGRTRGDIIERALDLFSDNAPPPELVEILNEDVLKSTCEGSQLCVIAVLPHILDTGAAGRNGYLEVMIKMAQKYKKKMWGWLWTEAGAQMELESALGIGGFGYPAMAAINTRKMKFALLKGSFSETGIHEFLRELSVGRGSTATLGGGVMPKIHAVEPWDGKDGQLPVEEDYDLSDVDLDE 411          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Medaka
Match: pdia4 (protein disulfide isomerase family A member 4 [Source:NCBI gene;Acc:101168751])

HSP 1 Score: 161.384 bits (407), Expect = 1.939e-42
Identity = 104/303 (34.32%), Postives = 153/303 (50.50%), Query Frame = 3
Query:  183 GVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILN-QEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLK 1070
            GVLVLT++NF+  +E    VLVEFYAPWCGHC+  APE++K A  LK     + V  VD  + S L   + + G+PTIKI    +  P DY G RT  +IV    + + E+                              + LT  NFD+ V  + +  LVEF+APWCGHCK L P +++AA EL  +   + L  +DATV T  A RYGV G+PT+K F    + G + +Y+G R +  IV    ++     P+ +++ +   QE++K         +V +  N  D   +   +   TL+
Sbjct:   59 GVLVLTDNNFDTFMEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQTLKDNDPPIPVAKVDATQASQLASKFDVSGYPTIKILKNGE--PVDYDGARTEKAIV----ERVKEVAHPDWKPPPDA------------------TLVLTQENFDDTV-NNADIILVEFYAPWCGHCKRLAPEYEKAAKELSKRTPPIPLAKVDATVETELAKRYGVNGFPTLKIF----RKGRAFEYNGPRENYGIVEHMGEQA--GPPSKQVQAVKQVQELIKDG---DDAVIVGIFSNEQDSAYELYTEACNTLR 327          

HSP 2 Score: 89.3521 bits (220), Expect = 2.433e-18
Identity = 48/127 (37.80%), Postives = 69/127 (54.33%), Query Frame = 3
Query:  180 EGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVN-------------AALKELDELVR 512
            +  LVLT  NF++ +     +LVEFYAPWCGHC+ LAPE++KAA  L      + +  VD    + L + YG+ GFPT+KIF K +    +Y G R    IV               A+K++ EL++
Sbjct:  173 DATLVLTQENFDDTVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSKRTPPIPLAKVDATVETELAKRYGVNGFPTLKIFRKGRAF--EYNGPRENYGIVEHMGEQAGPPSKQVQAVKQVQELIK 297          

HSP 3 Score: 65.855 bits (159), Expect = 5.207e-11
Identity = 31/90 (34.44%), Postives = 49/90 (54.44%), Query Frame = 3
Query:  615 NFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKL--GALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRS 878
             FDE+V+ +++  L+EF+APWCGHCK L+P +     + + +  L    +DAT +      Y  +G+PTI   PA  K    +   G R+
Sbjct:  530 TFDEIVMDTQKDVLIEFYAPWCGHCKKLEPDYLSLGKKYKKEKNLVIAKMDATANDIPNDNYKAEGFPTIYLAPANGKQSPVKFEGGDRT 619          

HSP 4 Score: 60.4622 bits (145), Expect = 2.788e-9
Identity = 39/118 (33.05%), Postives = 60/118 (50.85%), Query Frame = 3
Query:  186 VLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSS--LGQPYGIQGFPTIKIF-GKSKHSPKDYQ-GERTAGSIVN------AALKELDEL 506
            V V+    F+E++ +  K VL+EFYAPWCGHC+ L P++       K    +    MD  ++      Y  +GFPTI +     K SP  ++ G+RT  ++ N        L++ DEL
Sbjct:  523 VKVVVGKTFDEIVMDTQKDVLIEFYAPWCGHCKKLEPDYLSLGKKYKKEKNLVIAKMDATANDIPNDNYKAEGFPTIYLAPANGKQSPVKFEGGDRTVEALSNFLEKHATKLQQKDEL 640          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Medaka
Match: txndc5 (thioredoxin domain containing 5 [Source:NCBI gene;Acc:101160445])

HSP 1 Score: 140.584 bits (353), Expect = 4.424e-37
Identity = 87/258 (33.72%), Postives = 138/258 (53.49%), Query Frame = 3
Query:  177 EEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV--VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGS---IVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQ-AASELRG--KVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQL 926
            ++G+  LT  NF E I K  +  V+F+APWCGHC+++AP W++ AT L+    VK+G VD  ++  +    G++G+PT+ +F  +    + Y+G+R   S    V+  LK L              +++           +  +V+ LT+S+FDE V K      V+F+APWCGHCKNL P WD  +  E  G   VK+  +D TV     ++Y V+GYPT+  F AG + GD  ++ GGR    +  +   +  ++L
Sbjct:   81 KQGMYELTALNFKEHISKGAH-FVKFFAPWCGHCKAMAPTWEQLATTLEHSEDVKIGKVDCTQHYEVCSDNGVRGYPTL-LFFYNGQKKEQYKGKRDLDSFKDFVDNQLKALQTEEHEHELKEEQQAANEIPTEEPAKEEAESNVLVLTESDFDEAVAKGFT--FVKFYAPWCGHCKNLAPTWDDLSKKEFPGLTDVKIAKVDCTVERTLCNKYSVRGYPTLIIFRAG-EQGD--EHHGGRDLESLHNFVMKQTRDEL 331          
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Medaka
Match: txndc5 (thioredoxin domain containing 5 [Source:NCBI gene;Acc:101160445])

HSP 1 Score: 140.198 bits (352), Expect = 2.737e-36
Identity = 87/258 (33.72%), Postives = 138/258 (53.49%), Query Frame = 3
Query:  177 EEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV--VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGS---IVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQ-AASELRG--KVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQL 926
            ++G+  LT  NF E I K  +  V+F+APWCGHC+++AP W++ AT L+    VK+G VD  ++  +    G++G+PT+ +F  +    + Y+G+R   S    V+  LK L              +++           +  +V+ LT+S+FDE V K      V+F+APWCGHCKNL P WD  +  E  G   VK+  +D TV     ++Y V+GYPT+  F AG + GD  ++ GGR    +  +   +  ++L
Sbjct:  163 KQGMYELTALNFKEHISKGAH-FVKFFAPWCGHCKAMAPTWEQLATTLEHSEDVKIGKVDCTQHYEVCSDNGVRGYPTL-LFFYNGQKKEQYKGKRDLDSFKDFVDNQLKALQTEEHEHELKEEQQAANEIPTEEPAKEEAESNVLVLTESDFDEAVAKGFT--FVKFYAPWCGHCKNLAPTWDDLSKKEFPGLTDVKIAKVDCTVERTLCNKYSVRGYPTLIIFRAG-EQGD--EHHGGRDLESLHNFVMKQTRDEL 413          

HSP 2 Score: 128.642 bits (322), Expect = 4.224e-32
Identity = 92/263 (34.98%), Postives = 120/263 (45.63%), Query Frame = 3
Query:  117 YLSIVLFCFALAQCNADITEEEGV-LVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG-------VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK--VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGR 875
            Y S++   FA   C+ D  EEE      T   FNE +    +  V FYAPWCGHCQ L P W + A            VVKV  V   K+ S    +G++G+PT+ +F   + + K YQG R   S+    LK L                         +      + ELT  NF E + K      V+FFAPWCGHCK + P W+Q A+ L     VK+G +D T H    S  GV+GYPT+ FF  G K    + Y G R
Sbjct:   16 YFSLL---FAGVLCDTDAEEEEHAKHTYTVEMFNEAVPTAPH-FVMFYAPWCGHCQRLQPTWNELAEKYNSMDEPPVYVVKVDCVQDTKFCS--NVHGVRGYPTLLLFKPDQEAVK-YQGPRDLQSLETWMLKTLQAEPSEP----------ESELEPPKAPEPKQGMYELTALNFKEHISKGAH--FVKFFAPWCGHCKAMAPTWEQLATTLEHSEDVKIGKVDCTQHYEVCSDNGVRGYPTLLFFYNGQK---KEQYKGKR 256          

HSP 3 Score: 53.5286 bits (127), Expect = 2.816e-7
Identity = 32/99 (32.32%), Postives = 48/99 (48.48%), Query Frame = 3
Query:  618 FDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK----VKLGALDATVHTATASR-YGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRW 899
            F+E V  +  P  V F+APWCGHC+ L+P W++ A +        V +  +D    T   S  +GV+GYPT+  F       ++  Y G R    +  W
Sbjct:   45 FNEAVPTA--PHFVMFYAPWCGHCQRLQPTWNELAEKYNSMDEPPVYVVKVDCVQDTKFCSNVHGVRGYPTLLLFKP---DQEAVKYQGPRDLQSLETW 138          
BLAST of Protein disulfide-isomerase A6 vs. Planmine SMEST
Match: SMESG000017020.1 (SMESG000017020.1)

HSP 1 Score: 768.074 bits (1982), Expect = 0.000e+0
Identity = 402/436 (92.20%), Postives = 414/436 (94.95%), Query Frame = 3
Query:  117 YLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEEPKSEL 1424
            Y   ++F +A +   A  +  + V+ LT SNF+++   +    VEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQG+RTAGSIVNAALKELDELVRSRLGGASGGSSSHERKSSGGSSGSGGDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEEPKSEL
Sbjct:    4 YSFFLIFLYAKSS-TALYSSNDDVVELTPSNFDDMKNSDSLWFVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGDRTAGSIVNAALKELDELVRSRLGGASGGSSSHERKSSGGSSGSGGDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGIGGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGDGLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEEPKSEL 438          
BLAST of Protein disulfide-isomerase A6 vs. Planmine SMEST
Match: SMESG000023147.1 (SMESG000023147.1)

HSP 1 Score: 169.474 bits (428), Expect = 3.225e-46
Identity = 83/126 (65.87%), Postives = 96/126 (76.19%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVN 479
            MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHC++LAPE+  AA  LK    ++K+  VD    + L   + IQG+PT+K F   K    DY G RTA +I++
Sbjct:    1 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK--VMDYGGGRTADTIIS 124          

HSP 2 Score: 104.76 bits (260), Expect = 1.019e-23
Identity = 58/145 (40.00%), Postives = 85/145 (58.62%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPN 1019
            V+ LT+SNF+E++ K++   LVEF+APWCGHCK L P +  AA +L+ K   +KL  +DATV    AS++ +QGYPT+KFF    K G   DY GGR++  I+ W     +E+   P    + + E  K+  E   + VV    +
Sbjct:   26 VLVLTNSNFNEVIEKNKY-VLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFF----KDGKVMDYGGGRTADTIISW-----LEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKD 160          

HSP 3 Score: 79.337 bits (194), Expect = 1.912e-15
Identity = 40/93 (43.01%), Postives = 52/93 (55.91%), Query Frame = 3
Query:  186 VLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            V VL   NF+ V  +K+K V VEFYAPWCGHC+ LAP W +     K    +    MD  ++  +   IQ FPTIK F K      D++G+RT
Sbjct:  367 VKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRT 459          

HSP 4 Score: 71.633 bits (174), Expect = 4.615e-13
Identity = 34/94 (36.17%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  603 LTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK--VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRS 878
            L   NFD +     +   VEF+APWCGHCK L P WDQ     +    + +  +D+T +     R  +Q +PTIK+FP    S +  D++G R+
Sbjct:  370 LVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVR--IQSFPTIKYFPKD--SDEMVDFEGDRT 459          
BLAST of Protein disulfide-isomerase A6 vs. Planmine SMEST
Match: SMESG000010656.1 (SMESG000010656.1)

HSP 1 Score: 154.066 bits (388), Expect = 4.823e-40
Identity = 98/251 (39.04%), Postives = 124/251 (49.40%), Query Frame = 3
Query:  165 DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAA---SELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRW 899
            +I  +  V VL + NF+E I  N  V+VEFYAPWCGHC+ L P + KAA  LK     + +G VD    S L   +GI G+PT+K F      P DY   R+  +IVN   K                        S         V+ LT  NF ++V +S    LVEFFAPWCGHCK+L P + +AA   S L   ++L  +DATV T  A  Y V GYP++K F          DY G RSS  IV W
Sbjct:   23 EIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELATRFGISGYPTLKFFKSG--IPYDYDDSRSESAIVNFMKK----------------------VGSPDWQPPKNYVLTLTKENFTQIV-ESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPSLKLFK---NKNFFVDYSGPRSSDGIVDW 245          

HSP 2 Score: 97.0561 bits (240), Expect = 5.009e-21
Identity = 45/105 (42.86%), Postives = 70/105 (66.67%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALK 491
            VL LT  NF +++E + Y+LVEF+APWCGHC+SLAPE+ KAA  L  +   +++  VD    + L + Y + G+P++K+F K+K+   DY G R++  IV+  +K
Sbjct:  145 VLTLTKENFTQIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPSLKLF-KNKNFFVDYSGPRSSDGIVDWMIK 248          
BLAST of Protein disulfide-isomerase A6 vs. Planmine SMEST
Match: SMESG000005268.1 (SMESG000005268.1)

HSP 1 Score: 111.309 bits (277), Expect = 1.804e-25
Identity = 79/282 (28.01%), Postives = 129/282 (45.74%), Query Frame = 3
Query:  174 EEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMD----KYSSLGQPYGIQGFPTIKIFGKSKH-SPKDYQGERTAGSIV----NAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVK---LGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACE 983
            E+  V+      F  V+++ K+ LV FYAPWCGHC++  P++  AA  +    KV  + +D     ++ +    GI GFP  + F   K+ S  +Y  ER     V    N A  +LD     R                         +V L  +NF + ++      LV F++PWCGHC  + P +  AA++L+  +    + A+DAT  T  A++Y V G+PT+ +F     +GD   Y G R+   I  +   K  + +   E +++  +E  K+  E
Sbjct:  381 EQSQVIHPVPEEFRAVLKRYKHALVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEA------------------IVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMMPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSP---NGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEEKKKADAE 641          

HSP 2 Score: 109.383 bits (272), Expect = 6.175e-25
Identity = 75/260 (28.85%), Postives = 123/260 (47.31%), Query Frame = 3
Query:  174 EEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASEL--RGKVKLGALDATVHTAT--ASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPA 932
            E   +  LT++NF E +++++ V+V FYAPWCGHC+++ P    AA  L+ +    ++ A+D  +  ++ Q + I+GFPT+K F             + A  + +   +  D LV+  L          E       S     V E   +     VLK  +  LV F+APWCGHCK  KP +  AA+++    KV    +D T  +     +  G+ G+P  ++F  G  + +S+ Y   R   D V + ++    QL A
Sbjct:  259 ETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKAMKPAMVDAAVQLRKLKIDAQIAAIDSTENKNISQAFQIKGFPTVKYF-------------KNAQFMYDVNERSADGLVKFLLDPKKPEEPKLELPWKEEQSQVIHPVPEEFRA-----VLKRYKHALVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSE-YSLEREEDDFVAFMTNPANPQLDA 499          

HSP 3 Score: 96.6709 bits (239), Expect = 7.186e-21
Identity = 64/239 (26.78%), Postives = 116/239 (48.54%), Query Frame = 3
Query:  240 VLVEFYAPWCGHCQSLAPEWKKAATALKG-VVKVGAV-DMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRG---KVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEI 941
            +++ FYAPWCG+C+ + P++  AAT LKG  + +G   D+     L Q + I G+P++ +        K Y+G+ +  +++           +  +  +   +                ++  LTD+NF E  L   E  +V F+APWCGHCK +KP    AA +LR      ++ A+D+T +   +  + ++G+PT+K+F       D  +    RS+  +V++  D    + P  E+
Sbjct:  160 MMLMFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFK-YEGDNSKEALIKFVHNPTQPPPQKDVPWSEETN----------------EIDFLTDANFYE-YLDQHESVIVMFYAPWCGHCKAMKPAMVDAAVQLRKLKIDAQIAAIDSTENKNISQAFQIKGFPTVKYFKNAQFMYDVNE----RSADGLVKFLLDPKKPEEPKLEL 376          
BLAST of Protein disulfide-isomerase A6 vs. Planmine SMEST
Match: SMESG000041085.1 (SMESG000041085.1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.570e-19
Identity = 59/182 (32.42%), Postives = 88/182 (48.35%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAM 1127
            DV+E  DS+F++ V K     LVEF+APWCGHCK L P ++ AA+ L+ +   + +  +D T  T T  ++GV GYPT+K F  G     + DY G RS+  I+++   K       P  KE+  +E            VV          S+  + Y A L VA    +  R+   + E +
Sbjct:   18 DVLEFKDSSFEQSV-KEHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG---QFAFDYSGERSADGIIKYMVSK-----SGPSSKELKTEENFNKFTASADPVVVGFF------TSESSDLYKAFLSVAEKLNEDFRFAHTFDETL 184          

HSP 2 Score: 88.9669 bits (219), Expect = 1.515e-18
Identity = 47/125 (37.60%), Postives = 72/125 (57.60%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            M  L  + F   LA  +        VL   +S+F + ++++  +LVEFYAPWCGHC+ LAPE++ AATALK     + +  VD    +   + +G+ G+PT+K+F K+     DY GER+A  I+
Sbjct:    1 MNILISLFFLLPLAMAS-------DVLEFKDSSFEQSVKEHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVF-KNGQFAFDYSGERSADGII 117          

HSP 3 Score: 83.9593 bits (206), Expect = 5.367e-17
Identity = 48/124 (38.71%), Postives = 69/124 (55.65%), Query Frame = 3
Query:  177 EEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSS-LGQPYGIQGFPTIKIFGK-SKHSPKDYQGERTAGSIV-------NAALKELDELVRSR 518
            +E V V+   NF+E++ +  K VL+EFYAPWCGHC+SLAP++++ A  L     +    MD  ++ +  PY + GFPTI    K SKHSPK Y   R    ++       ++ LK  D   R R
Sbjct:  363 DEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDR 486          

HSP 4 Score: 75.8702 bits (185), Expect = 2.082e-14
Identity = 37/97 (38.14%), Postives = 57/97 (58.76%), Query Frame = 3
Query:  615 NFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK--VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRW 899
            NFDE+V    +  L+EF+APWCGHCK+L P +++ A +L  +  + +  +DAT +    S Y V G+PTI F P   K    + Y  GR   D++++
Sbjct:  373 NFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAND-VPSPYEVSGFPTIYFAPKNSKHS-PKSYSSGREVDDMLKY 467          
The following BLAST results are available for this feature:
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDIA64.541e-16357.24protein disulfide isomerase family A member 6 [Sou... [more]
PDIA66.540e-16357.24protein disulfide isomerase family A member 6 [Sou... [more]
PDIA61.324e-16256.71protein disulfide isomerase family A member 6 [Sou... [more]
PDIA61.731e-16256.81protein disulfide isomerase family A member 6 [Sou... [more]
PDIA61.358e-16156.81protein disulfide isomerase family A member 6 [Sou... [more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdi-66.863e-16554.12Protein disulfide-isomerase A6 homolog [Source:Un... [more]
Y49E10.49.424e-12542.82pep chromosome:WBcel235:III:12378724:12380647:-1 g... [more]
Y49E10.49.424e-12542.82pep chromosome:WBcel235:III:12379000:12380647:-1 g... [more]
C14B9.21.530e-5037.23Probable protein disulfide-isomerase A4 [Source:U... [more]
pdi-21.221e-2747.46Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CaBP12.464e-15955.95gene:FBgn0025678 transcript:FBtr0345544[more]
CaBP12.464e-15955.95gene:FBgn0025678 transcript:FBtr0080837[more]
CG93023.168e-3234.12gene:FBgn0032514 transcript:FBtr0080470[more]
Pdi4.418e-2543.75gene:FBgn0286818 transcript:FBtr0346644[more]
Pdi4.418e-2543.75gene:FBgn0286818 transcript:FBtr0075648[more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia61.016e-16255.97protein disulfide isomerase family A, member 6 [So... [more]
pdia49.606e-4739.76protein disulfide isomerase family A, member 4 [So... [more]
dnajc101.216e-3230.49DnaJ (Hsp40) homolog, subfamily C, member 10 [Sour... [more]
txndc54.039e-3232.28thioredoxin domain containing 5 [Source:ZFIN;Acc:Z... [more]
p4hb2.812e-2747.58prolyl 4-hydroxylase, beta polypeptide [Source:ZFI... [more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mettl162.128e-15954.00methyltransferase like 16 [Source:Xenbase;Acc:XB-G... [more]
mettl165.162e-15954.08methyltransferase like 16 [Source:Xenbase;Acc:XB-G... [more]
mettl166.385e-15954.55methyltransferase like 16 [Source:Xenbase;Acc:XB-G... [more]
mettl166.580e-15954.31methyltransferase like 16 [Source:Xenbase;Acc:XB-G... [more]
mettl167.551e-15954.31methyltransferase like 16 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdia61.149e-16155.18protein disulfide isomerase associated 6 [Source:M... [more]
Pdia48.603e-4034.97protein disulfide isomerase associated 4 [Source:M... [more]
Dnajc101.906e-3130.18DnaJ heat shock protein family (Hsp40) member C10 ... [more]
Txndc53.951e-3030.50thioredoxin domain containing 5 [Source:MGI Symbol... [more]
Txndc55.830e-3030.50thioredoxin domain containing 5 [Source:MGI Symbol... [more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q11067|PDIA6_CAEEL8.730e-16454.12Protein disulfide-isomerase A6 homolog OS=Caenorha... [more]
sp|Q15084|PDIA6_HUMAN3.141e-16257.24Protein disulfide-isomerase A6 OS=Homo sapiens OX=... [more]
sp|Q5R6T1|PDIA6_PONAB5.504e-16156.64Protein disulfide-isomerase A6 OS=Pongo abelii OX=... [more]
sp|Q922R8|PDIA6_MOUSE7.798e-16157.01Protein disulfide-isomerase A6 OS=Mus musculus OX=... [more]
sp|Q63081|PDIA6_RAT1.315e-16056.78Protein disulfide-isomerase A6 OS=Rattus norvegicu... [more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JU630.000e+061.20protein disulfide-isomerase A6 homolog isoform X1 ... [more]
F1KYD88.782e-17956.61Protein disulfide-isomerase A6 OS=Ascaris suum OX=... [more]
A0A0N4V5W56.502e-17857.44Uncharacterized protein OS=Enterobius vermicularis... [more]
A0A0B2W3221.665e-17755.68Uncharacterized protein OS=Toxocara canis OX=6265 ... [more]
A0A267EG436.422e-17757.60Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDIA68.435e-15952.93protein disulfide-isomerase A6 [Source:NCBI gene;A... [more]
pdia63.125e-15653.49protein disulfide-isomerase A6-like [Source:NCBI g... [more]
pdia49.530e-4537.18protein disulfide isomerase family A member 4 [Sou... [more]
dnajc107.764e-3531.39DnaJ heat shock protein family (Hsp40) member C10 ... [more]
dnajc102.143e-3430.48DnaJ heat shock protein family (Hsp40) member C10 ... [more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia62.032e-15250.67protein disulfide isomerase family A, member 6 [So... [more]
pdia41.308e-4037.90protein disulfide isomerase family A, member 4 [So... [more]
dnajc101.574e-3031.22DnaJ (Hsp40) homolog, subfamily C, member 10 [Sour... [more]
ENSPMAT00000006474.11.986e-3031.75pep scaffold:Pmarinus_7.0:GL478000:14574:47610:1 g... [more]
txndc51.282e-2729.43thioredoxin domain containing 5 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PDI12.587e-2039.83Protein disulfide isomerase; multifunctional oxido... [more]
MPD11.628e-1832.91Member of the protein disulfide isomerase (PDI) fa... [more]
EUG19.755e-1440.19Protein disulfide isomerase of the endoplasmic ret... [more]
TRX18.755e-830.86Cytoplasmic thioredoxin isoenzyme; part of thiored... [more]
EPS16.546e-627.62ER protein with chaperone and co-chaperone activit... [more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO371551.108e-17157.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473403.417e-4736.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329305.130e-4638.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345905.298e-3130.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413767.163e-3032.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia61.964e-16054.63protein disulfide isomerase family A member 6 [Sou... [more]
pdia64.742e-13648.96protein disulfide isomerase family A member 6 [Sou... [more]
pdia41.939e-4234.32protein disulfide isomerase family A member 4 [Sou... [more]
txndc54.424e-3733.72thioredoxin domain containing 5 [Source:NCBI gene;... [more]
txndc52.737e-3633.72thioredoxin domain containing 5 [Source:NCBI gene;... [more]
back to top
BLAST of Protein disulfide-isomerase A6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017020.10.000e+092.20SMESG000017020.1[more]
SMESG000023147.13.225e-4665.87SMESG000023147.1[more]
SMESG000010656.14.823e-4039.04SMESG000010656.1[more]
SMESG000005268.11.804e-2528.01SMESG000005268.1[more]
SMESG000041085.13.570e-1932.42SMESG000041085.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028938 ID=SMED30028938|Name=Protein disulfide-isomerase A6|organism=Schmidtea mediterranea sexual|type=transcript|length=1590bp
TCCATTTGTTTAACCATTCTAATTTACATGCACATTACTACACGTAGTAT
ATCCATACGTATATACATTTATAAAATACTTCCATTGTGAATTTAGTTCT
ATTTTAGAAAATGAAATATCTGTCGATAGTTTTATTTTGTTTTGCCTTAG
CGCAATGTAATGCTGACATTACTGAAGAAGAAGGTGTTTTAGTATTGACA
AACAGTAATTTTAATGAAGTGATTGAGAAGAACAAATATGTATTAGTTGA
ATTCTATGCTCCATGGTGTGGTCATTGCCAATCTTTGGCTCCAGAATGGA
AGAAAGCTGCAACTGCGTTGAAAGGTGTTGTTAAAGTTGGAGCAGTTGAT
ATGGATAAATATTCCTCACTCGGTCAACCATATGGTATACAAGGATTTCC
AACTATCAAAATTTTCGGCAAAAGTAAACACTCACCCAAAGATTATCAAG
GCGAAAGGACTGCTGGTTCGATTGTAAACGCGGCTTTAAAGGAATTAGAC
GAGTTAGTTCGGTCTAGATTGGGTGGCGCAAGTGGGGGTTCTTCTTCACA
CGAACGAAAATCGAGTGGTGGCAGTAGCGGCAGTGGAGGAGACGTTGTTG
AATTGACAGACAGCAATTTCGATGAGATGGTTTTGAAGAGTGAGGAACCT
TGGCTCGTAGAGTTCTTTGCTCCGTGGTGTGGCCACTGCAAGAACCTCAA
GCCGCACTGGGATCAAGCCGCTTCTGAATTAAGGGGAAAGGTGAAATTGG
GAGCTCTTGATGCCACCGTGCATACCGCAACCGCCAGCAGATACGGGGTA
CAAGGGTATCCCACTATCAAATTTTTCCCGGCCGGTGTAAAATCCGGGGA
CTCCCAGGACTACGATGGCGGCCGATCATCATCGGATATTGTTAGATGGG
CGTCTGACAAAGTTGTCGAGCAGCTGCCGGCACCGGAAATCAAAGAAATT
CTCAATCAGGAAATCCTGAAATCCGCTTGTGAAGACCACCAATTGTGTGT
GGTGGCGGTGCTGCCAAATATTCTCGACTGCCAATCACAATGCAGAAACG
ATTACATTGCAACTCTGAAGGTGGCCGGTGACAAATATAAATCCAATCGA
TGGGGATGGCTGTGGACCGAGGCCATGAAATTGCCGGAACTGGAAAATGT
TTTCGGAATCGGGGGATTCGGTTATCCGGCGCTGGTTGTGGTCAATGTCA
GGAAGATGAAATATGCAACTCTCACTGGGCCTTTCAGCCAGTCGGGAATC
CAGGATTTCGTCAGGGATGTCAGTCTCGGTAGAGGTTCCACATCCGGTAT
CCATGGTGATGGGTTGCCTACAATTAAATCCGTTGAGCCCTGGGACGGAA
AGGATGGAGAAATCCCCAAGGAAGAGGAAATCGATCTCAGCGAACTGGGC
ATTGAAGAACCGAAATCGGAATTGTAACATTTCTCTAGTTGTTGTTTGTA
TCCAGAGTGTGATGAGAATTCGGATCCAGCTGTATAGTTGTTGTTCATTA
AATTATATTTTTAATTAGTTGTTTCATTGGTGCATCGAGTTTATTACTGT
TAATATTTATGCAATAAATTGGTTCATTTTTAAAAAAAAA
back to top

protein sequence of SMED30028938-orf-1

>SMED30028938-orf-1 ID=SMED30028938-orf-1|Name=SMED30028938-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=439bp
MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYA
PWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIK
IFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLGGASGGSSSHERK
SSGGSSGSGGDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHW
DQAASELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQD
YDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAV
LPNILDCQSQCRNDYIATLKVAGDKYKSNRWGWLWTEAMKLPELENVFGI
GGFGYPALVVVNVRKMKYATLTGPFSQSGIQDFVRDVSLGRGSTSGIHGD
GLPTIKSVEPWDGKDGEIPKEEEIDLSELGIEEPKSEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003756protein disulfide isomerase activity
GO:0016853isomerase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000019muscle progenitor cell
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000039gamma neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
PLANA:0007552nu neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR012336Thioredoxin-like_fold
IPR013766Thioredoxin_domain
IPR017937Thioredoxin_CS
Vocabulary: biological process
TermDefinition
GO:0045454cell redox homeostasis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 11..48
e-value: 1.2E-5
score: 27.5
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.748