Adiponectin receptor protein

Overview
NameAdiponectin receptor protein
Smed IDSMED30028925
Length (bp)1490
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adiponectin receptor protein (SMED30028925) t-SNE clustered cells

Violin plots show distribution of expression levels for Adiponectin receptor protein (SMED30028925) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adiponectin receptor protein (SMED30028925) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adiponectin receptor protein (SMED30028925) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028925

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028925h1SMcG0013451 PL08006A1G08smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028925h1SMcG0013451 Contig5712GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30028925h1SMcG0013451 dd_Smed_v4_2696_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30028925h1SMcG0013451 dd_Smed_v4_2696_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028925h1SMcG0013451 dd_Smed_v4_2696_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028925h1SMcG0013451 dd_Smed_v4_2696_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028925h1SMcG0013451 dd_Smed_v4_2696_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adiponectin receptor protein vs. Ensembl Human
Match: ADIPOR2 (adiponectin receptor 2 [Source:HGNC Symbol;Acc:HGNC:24041])

HSP 1 Score: 321.242 bits (822), Expect = 2.145e-105
Identity = 172/355 (48.45%), Postives = 222/355 (62.54%), Query Frame = 3
Query:   66 LNSPTKINESDNRFHKRSISHGPDLMKSAESVETLLNNGWSEKSDSKTNIVRQRKTHSHNRSASFGGKFSDFSEA-------------ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            +N PT+     +R  +  I     L K  +   T   +  S + D +  I+      SH++ +S   ++SD +               A   + + EE +  +    W V+    LP WLKDNDFLL GHRP + SF+ACF SIFRIHTET NIWTHLLG + F+ L I+++ +P    +  L EKVVF  FF+GAILCL FSW FHTV+CHSE V R+F+KLDY GI LL +GS +PWL+YSFYCN  P  IY I+I VLG   + +S  D FATP +R +RA VF+ LGLSG+IP  HY+I EGF  A     +GWL+LMA+LYITGA +YA R+PERFFPGK DIWF SHQ+
Sbjct:    1 MNEPTENRLGCSRTPEPDIR----LRKGHQLDGTRRGDNDSHQGDLEP-ILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQL 350          
BLAST of Adiponectin receptor protein vs. Ensembl Human
Match: ADIPOR2 (adiponectin receptor 2 [Source:HGNC Symbol;Acc:HGNC:24041])

HSP 1 Score: 321.242 bits (822), Expect = 2.145e-105
Identity = 172/355 (48.45%), Postives = 222/355 (62.54%), Query Frame = 3
Query:   66 LNSPTKINESDNRFHKRSISHGPDLMKSAESVETLLNNGWSEKSDSKTNIVRQRKTHSHNRSASFGGKFSDFSEA-------------ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            +N PT+     +R  +  I     L K  +   T   +  S + D +  I+      SH++ +S   ++SD +               A   + + EE +  +    W V+    LP WLKDNDFLL GHRP + SF+ACF SIFRIHTET NIWTHLLG + F+ L I+++ +P    +  L EKVVF  FF+GAILCL FSW FHTV+CHSE V R+F+KLDY GI LL +GS +PWL+YSFYCN  P  IY I+I VLG   + +S  D FATP +R +RA VF+ LGLSG+IP  HY+I EGF  A     +GWL+LMA+LYITGA +YA R+PERFFPGK DIWF SHQ+
Sbjct:    1 MNEPTENRLGCSRTPEPDIR----LRKGHQLDGTRRGDNDSHQGDLEP-ILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQL 350          
BLAST of Adiponectin receptor protein vs. Ensembl Human
Match: ADIPOR1 (adiponectin receptor 1 [Source:HGNC Symbol;Acc:HGNC:24040])

HSP 1 Score: 301.597 bits (771), Expect = 6.247e-98
Identity = 152/267 (56.93%), Postives = 187/267 (70.04%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  +    W V+    LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLGF+ F+ L I  + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYC+  P++IY  ++ VLG   + ++  D FATP  R  RA VF+ LGLSGV+P  H+ I EGF  A     +GW  LMA +YITGA +YA R+PERFFPGKFDIWFQSHQI
Sbjct:   73 AHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQI 339          
BLAST of Adiponectin receptor protein vs. Ensembl Human
Match: ADIPOR1 (adiponectin receptor 1 [Source:HGNC Symbol;Acc:HGNC:24040])

HSP 1 Score: 201.445 bits (511), Expect = 1.035e-60
Identity = 104/193 (53.89%), Postives = 132/193 (68.39%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRS 863
            A   + + EE +  +    W V+    LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLGF+ F+ L I  + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYC+  P++IY  ++ VLG   + ++  D FATP  R 
Sbjct:   73 AHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQ 265          
BLAST of Adiponectin receptor protein vs. Ensembl Human
Match: ADIPOR1 (adiponectin receptor 1 [Source:HGNC Symbol;Acc:HGNC:24040])

HSP 1 Score: 139.428 bits (350), Expect = 6.001e-38
Identity = 74/133 (55.64%), Postives = 91/133 (68.42%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFN 683
            A   + + EE +  +    W V+    LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLGF+ F+ L I  + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+
Sbjct:   73 AHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFS 205          
BLAST of Adiponectin receptor protein vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 287.345 bits (734), Expect = 4.949e-92
Identity = 174/377 (46.15%), Postives = 227/377 (60.21%), Query Frame = 3
Query:   72 SPTKINESDNRFHKRS--ISHGPDLMKSAESVETLLNNGWSEKSDSKTNIVR-QRKTHSHNRSASFGG---KFSDFSEAASRVVGQAEELMINIISRG----WNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHC 1172
            SPT  ++ D  F   S  +         A S    +  G  +++  K  I+R +RK     R  +  G   K  D  +     V +       I+++     W V+    LP WL+DN+FL  GHRP L SF  CF SI+ +HTET NIWTHL+G +AF  LA +FLT+P + +   EKVVFS FF GA+LCLG S+ FHT+ CHS  V +IF KLDY GI+LL +GS IPW++Y FYC   P+I Y  M+SVLG   + +SL D F+   FR +RA VFV +G SGVIP  HYII +G +  F + S  WL+LMA LY+ GA +YA R PERFFPGK DIWFQSHQ+FH  VV+AA VH  G+ ++A  R  N+ C
Sbjct:   56 SPTNSDDEDADFCSDSELLPQQEGHRSRATSFAGRIRAGSDDEAMPKHTILRYRRKKGGQWREINLQGTPDKRKDDEDELEVDVKEDRSEQTGIVTKTYEARWKVLKYEHLPEWLQDNEFLRHGHRPPLPSFSECFKSIWSLHTETGNIWTHLIGCVAFFFLACWFLTRPDNHIQFQEKVVFSFFFAGAVLCLGLSFAFHTLSCHSVNVVKIFCKLDYMGISLLIIGSFIPWIYYGFYCRREPKITYIAMVSVLGIGAIVVSLWDKFSESRFRPIRAAVFVGMGCSGVIPTIHYIITDGVHSLFADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGISEMAFAR-LNEQC 431          
BLAST of Adiponectin receptor protein vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 287.345 bits (734), Expect = 4.949e-92
Identity = 174/377 (46.15%), Postives = 227/377 (60.21%), Query Frame = 3
Query:   72 SPTKINESDNRFHKRS--ISHGPDLMKSAESVETLLNNGWSEKSDSKTNIVR-QRKTHSHNRSASFGG---KFSDFSEAASRVVGQAEELMINIISRG----WNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHC 1172
            SPT  ++ D  F   S  +         A S    +  G  +++  K  I+R +RK     R  +  G   K  D  +     V +       I+++     W V+    LP WL+DN+FL  GHRP L SF  CF SI+ +HTET NIWTHL+G +AF  LA +FLT+P + +   EKVVFS FF GA+LCLG S+ FHT+ CHS  V +IF KLDY GI+LL +GS IPW++Y FYC   P+I Y  M+SVLG   + +SL D F+   FR +RA VFV +G SGVIP  HYII +G +  F + S  WL+LMA LY+ GA +YA R PERFFPGK DIWFQSHQ+FH  VV+AA VH  G+ ++A  R  N+ C
Sbjct:   56 SPTNSDDEDADFCSDSELLPQQEGHRSRATSFAGRIRAGSDDEAMPKHTILRYRRKKGGQWREINLQGTPDKRKDDEDELEVDVKEDRSEQTGIVTKTYEARWKVLKYEHLPEWLQDNEFLRHGHRPPLPSFSECFKSIWSLHTETGNIWTHLIGCVAFFFLACWFLTRPDNHIQFQEKVVFSFFFAGAVLCLGLSFAFHTLSCHSVNVVKIFCKLDYMGISLLIIGSFIPWIYYGFYCRREPKITYIAMVSVLGIGAIVVSLWDKFSESRFRPIRAAVFVGMGCSGVIPTIHYIITDGVHSLFADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGISEMAFAR-LNEQC 431          
BLAST of Adiponectin receptor protein vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 287.345 bits (734), Expect = 4.949e-92
Identity = 174/377 (46.15%), Postives = 227/377 (60.21%), Query Frame = 3
Query:   72 SPTKINESDNRFHKRS--ISHGPDLMKSAESVETLLNNGWSEKSDSKTNIVR-QRKTHSHNRSASFGG---KFSDFSEAASRVVGQAEELMINIISRG----WNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHC 1172
            SPT  ++ D  F   S  +         A S    +  G  +++  K  I+R +RK     R  +  G   K  D  +     V +       I+++     W V+    LP WL+DN+FL  GHRP L SF  CF SI+ +HTET NIWTHL+G +AF  LA +FLT+P + +   EKVVFS FF GA+LCLG S+ FHT+ CHS  V +IF KLDY GI+LL +GS IPW++Y FYC   P+I Y  M+SVLG   + +SL D F+   FR +RA VFV +G SGVIP  HYII +G +  F + S  WL+LMA LY+ GA +YA R PERFFPGK DIWFQSHQ+FH  VV+AA VH  G+ ++A  R  N+ C
Sbjct:   56 SPTNSDDEDADFCSDSELLPQQEGHRSRATSFAGRIRAGSDDEAMPKHTILRYRRKKGGQWREINLQGTPDKRKDDEDELEVDVKEDRSEQTGIVTKTYEARWKVLKYEHLPEWLQDNEFLRHGHRPPLPSFSECFKSIWSLHTETGNIWTHLIGCVAFFFLACWFLTRPDNHIQFQEKVVFSFFFAGAVLCLGLSFAFHTLSCHSVNVVKIFCKLDYMGISLLIIGSFIPWIYYGFYCRREPKITYIAMVSVLGIGAIVVSLWDKFSESRFRPIRAAVFVGMGCSGVIPTIHYIITDGVHSLFADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGISEMAFAR-LNEQC 431          
BLAST of Adiponectin receptor protein vs. Ensembl Celegans
Match: paqr-2 (Progestin and AdipoQ Receptor family [Source:UniProtKB/TrEMBL;Acc:Q9N536])

HSP 1 Score: 290.426 bits (742), Expect = 2.045e-91
Identity = 128/246 (52.03%), Postives = 179/246 (72.76%), Query Frame = 3
Query:  348 WNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            W   +  +LP WL+DN++L  GHRP L SF +CF SIF +HTET NIWTH+ G +AF  + I+FLT+P  +M   EK+++SAFF+GA++CLG S+ FHTV CHS ++ ++F+KLDY GI+LL VGS +PW++++FYC   P IIY  MI +LG   M +SL D FA P FR +RA VF+A+GLS V+P  H ++++G ++    + +  +++M A+YI GA +YA RVPER FPGK DIWFQSHQ+
Sbjct:  268 WKATNFETLPEWLQDNEYLRTGHRPPLPSFSSCFKSIFALHTETGNIWTHMYGCVAFFGIGIWFLTRPHDQMQWVEKLIYSAFFLGAVICLGMSFLFHTVACHSIEMAKLFSKLDYTGISLLIVGSFVPWIYFAFYCRPQPMIIYNGMIIILGIAAMVVSLWDKFAEPKFRPVRAAVFIAMGLSAVVPAFHLLVVDGVHYMVEESQVHLMIMMGAMYIGGATLYATRVPERCFPGKCDIWFQSHQL 513          
BLAST of Adiponectin receptor protein vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 278.87 bits (712), Expect = 3.997e-90
Identity = 165/331 (49.85%), Postives = 211/331 (63.75%), Query Frame = 3
Query:  204 KTNIVR-QRKTHSHNRSASFGG---KFSDFSEAASRVVGQAEELMINIISRG----WNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHC 1172
            K  I+R +RK     R  +  G   K  D  +     V +       I+++     W V+    LP WL+DN+FL  GHRP L SF  CF SI+ +HTET NIWTHL+G +AF  LA +FLT+P + +   EKVVFS FF GA+LCLG S+ FHT+ CHS  V +IF KLDY GI+LL +GS IPW++Y FYC   P+I Y  M+SVLG   + +SL D F+   FR +RA VFV +G SGVIP  HYII +G +  F + S  WL+LMA LY+ GA +YA R PERFFPGK DIWFQSHQ+FH  VV+AA VH  G+ ++A  R  N+ C
Sbjct:    3 KHTILRYRRKKGGQWREINLQGTPDKRKDDEDELEVDVKEDRSEQTGIVTKTYEARWKVLKYEHLPEWLQDNEFLRHGHRPPLPSFSECFKSIWSLHTETGNIWTHLIGCVAFFFLACWFLTRPDNHIQFQEKVVFSFFFAGAVLCLGLSFAFHTLSCHSVNVVKIFCKLDYMGISLLIIGSFIPWIYYGFYCRREPKITYIAMVSVLGIGAIVVSLWDKFSESRFRPIRAAVFVGMGCSGVIPTIHYIITDGVHSLFADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGISEMAFAR-LNEQC 332          
BLAST of Adiponectin receptor protein vs. Ensembl Fly
Match: AdipoR (gene:FBgn0038984 transcript:FBtr0084284)

HSP 1 Score: 341.658 bits (875), Expect = 4.363e-114
Identity = 170/299 (56.86%), Postives = 217/299 (72.58%), Query Frame = 3
Query:  276 DFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHC 1172
            D    A     QAEE +  +    W V H  +LP WL+DNDFL  GHRP L SF+ACF SIFR+HTET NIWTHLLG IAFI +A+YF+++P  E+   EK+VF AFFIGAI+CLGFS+ FHT+ CHS ++GR+F+KLDYCGI LL +GS +PWL+Y FYC+  P++IY  ++S+LG + + +SL D F+ P  R +RA VF++ GLSGVIP  HY I+EG++     ASLGWL+LM  LYI GA +YALRVPER+FPGKFDIW QSHQIFH+ V+ AA VH  G+ ++A YR     C
Sbjct:   55 DLGALAHNAAEQAEEFVRKVWEASWKVCHYKNLPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQPKVIYLSVVSILGILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAMYRVMYSEC 353          
BLAST of Adiponectin receptor protein vs. Ensembl Fly
Match: AdipoR (gene:FBgn0038984 transcript:FBtr0308848)

HSP 1 Score: 343.969 bits (881), Expect = 9.426e-114
Identity = 170/299 (56.86%), Postives = 217/299 (72.58%), Query Frame = 3
Query:  276 DFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHC 1172
            D    A     QAEE +  +    W V H  +LP WL+DNDFL  GHRP L SF+ACF SIFR+HTET NIWTHLLG IAFI +A+YF+++P  E+   EK+VF AFFIGAI+CLGFS+ FHT+ CHS ++GR+F+KLDYCGI LL +GS +PWL+Y FYC+  P++IY  ++S+LG + + +SL D F+ P  R +RA VF++ GLSGVIP  HY I+EG++     ASLGWL+LM  LYI GA +YALRVPER+FPGKFDIW QSHQIFH+ V+ AA VH  G+ ++A YR     C
Sbjct:  137 DLGALAHNAAEQAEEFVRKVWEASWKVCHYKNLPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQPKVIYLSVVSILGILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAMYRVMYSEC 435          
BLAST of Adiponectin receptor protein vs. Ensembl Fly
Match: AdipoR (gene:FBgn0038984 transcript:FBtr0084282)

HSP 1 Score: 343.969 bits (881), Expect = 9.426e-114
Identity = 170/299 (56.86%), Postives = 217/299 (72.58%), Query Frame = 3
Query:  276 DFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHC 1172
            D    A     QAEE +  +    W V H  +LP WL+DNDFL  GHRP L SF+ACF SIFR+HTET NIWTHLLG IAFI +A+YF+++P  E+   EK+VF AFFIGAI+CLGFS+ FHT+ CHS ++GR+F+KLDYCGI LL +GS +PWL+Y FYC+  P++IY  ++S+LG + + +SL D F+ P  R +RA VF++ GLSGVIP  HY I+EG++     ASLGWL+LM  LYI GA +YALRVPER+FPGKFDIW QSHQIFH+ V+ AA VH  G+ ++A YR     C
Sbjct:  137 DLGALAHNAAEQAEEFVRKVWEASWKVCHYKNLPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQPKVIYLSVVSILGILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAMYRVMYSEC 435          
BLAST of Adiponectin receptor protein vs. Ensembl Fly
Match: AdipoR (gene:FBgn0038984 transcript:FBtr0084283)

HSP 1 Score: 343.969 bits (881), Expect = 9.426e-114
Identity = 170/299 (56.86%), Postives = 217/299 (72.58%), Query Frame = 3
Query:  276 DFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHC 1172
            D    A     QAEE +  +    W V H  +LP WL+DNDFL  GHRP L SF+ACF SIFR+HTET NIWTHLLG IAFI +A+YF+++P  E+   EK+VF AFFIGAI+CLGFS+ FHT+ CHS ++GR+F+KLDYCGI LL +GS +PWL+Y FYC+  P++IY  ++S+LG + + +SL D F+ P  R +RA VF++ GLSGVIP  HY I+EG++     ASLGWL+LM  LYI GA +YALRVPER+FPGKFDIW QSHQIFH+ V+ AA VH  G+ ++A YR     C
Sbjct:  137 DLGALAHNAAEQAEEFVRKVWEASWKVCHYKNLPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQPKVIYLSVVSILGILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAMYRVMYSEC 435          
BLAST of Adiponectin receptor protein vs. Ensembl Fly
Match: AdipoR (gene:FBgn0038984 transcript:FBtr0334561)

HSP 1 Score: 343.969 bits (881), Expect = 9.426e-114
Identity = 170/299 (56.86%), Postives = 217/299 (72.58%), Query Frame = 3
Query:  276 DFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHC 1172
            D    A     QAEE +  +    W V H  +LP WL+DNDFL  GHRP L SF+ACF SIFR+HTET NIWTHLLG IAFI +A+YF+++P  E+   EK+VF AFFIGAI+CLGFS+ FHT+ CHS ++GR+F+KLDYCGI LL +GS +PWL+Y FYC+  P++IY  ++S+LG + + +SL D F+ P  R +RA VF++ GLSGVIP  HY I+EG++     ASLGWL+LM  LYI GA +YALRVPER+FPGKFDIW QSHQIFH+ V+ AA VH  G+ ++A YR     C
Sbjct:  137 DLGALAHNAAEQAEEFVRKVWEASWKVCHYKNLPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQPKVIYLSVVSILGILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAMYRVMYSEC 435          
BLAST of Adiponectin receptor protein vs. Ensembl Zebrafish
Match: adipor2 (adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-041210-60])

HSP 1 Score: 299.286 bits (765), Expect = 1.985e-97
Identity = 161/302 (53.31%), Postives = 204/302 (67.55%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHCIASTSV 1190
            A   + + EE +  +    W V+    LP WLKDNDFLL GHRP + SF+ACF SIFRIHTET NIWTHLLG + F+ L I ++ +P    +    EK+V   FF+GAILCL FSW FHTV+CHSE V R+F+KLDY GI  L +GS +PWL+YSFYC+  P  IY I++ +LG   + +S  D+FATP +R +RA VFV LGLSGV+P  H++I EGF  A     +GWL LMA LYITGAC+YA R+PERFFPGK DIWF SHQ+FH+ VV  A VH  G+  +  +R +     A  +V
Sbjct:   57 AHHAMERMEEFVHKMWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCLFFLCLGIVYMFRPNMSFVAPFQEKIVIGMFFLGAILCLSFSWLFHTVYCHSEGVSRVFSKLDYSGIAFLIMGSFVPWLYYSFYCSPQPCFIYLIVVCILGIAAITVSQCDFFATPQYRGVRAGVFVGLGLSGVVPTLHFMIAEGFLKATTMGQMGWLFLMAVLYITGACLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVHFHGVSNLQEFRYEAGGGCAENAV 358          
BLAST of Adiponectin receptor protein vs. Ensembl Zebrafish
Match: adipor2 (adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-041210-60])

HSP 1 Score: 299.286 bits (765), Expect = 1.985e-97
Identity = 161/302 (53.31%), Postives = 204/302 (67.55%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHCIASTSV 1190
            A   + + EE +  +    W V+    LP WLKDNDFLL GHRP + SF+ACF SIFRIHTET NIWTHLLG + F+ L I ++ +P    +    EK+V   FF+GAILCL FSW FHTV+CHSE V R+F+KLDY GI  L +GS +PWL+YSFYC+  P  IY I++ +LG   + +S  D+FATP +R +RA VFV LGLSGV+P  H++I EGF  A     +GWL LMA LYITGAC+YA R+PERFFPGK DIWF SHQ+FH+ VV  A VH  G+  +  +R +     A  +V
Sbjct:   57 AHHAMERMEEFVHKMWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCLFFLCLGIVYMFRPNMSFVAPFQEKIVIGMFFLGAILCLSFSWLFHTVYCHSEGVSRVFSKLDYSGIAFLIMGSFVPWLYYSFYCSPQPCFIYLIVVCILGIAAITVSQCDFFATPQYRGVRAGVFVGLGLSGVVPTLHFMIAEGFLKATTMGQMGWLFLMAVLYITGACLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVHFHGVSNLQEFRYEAGGGCAENAV 358          
BLAST of Adiponectin receptor protein vs. Ensembl Zebrafish
Match: adipor1b (adiponectin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2896])

HSP 1 Score: 294.278 bits (752), Expect = 6.063e-96
Identity = 148/267 (55.43%), Postives = 186/267 (69.66%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  I    W V+  H LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLG I F+ L    + +P    +  + EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYC+  P++IY  ++ VLG   + ++  D FATP  RS RA VF+ LGLSG++P  H+ I EGF  A     +GW  LM A+YI+GA +YA R+PER+FPG+ DIWFQSHQI
Sbjct:   27 AHHAMEKMEEFVHKIWEGHWRVIPYHLLPDWLKDNDYLLHGHRPPMPSFRACFGSIFRIHTETGNIWTHLLGLILFLCLGTLTMLRPNVSFMAPVQEKVVFGVFFLGAVLCLCFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSVVCVLGVAAIIVAQWDRFATPRHRSTRAGVFLGLGLSGLVPTMHFTIAEGFVKATTVGQMGWFYLMGAMYISGAALYAARIPERYFPGRCDIWFQSHQI 293          
BLAST of Adiponectin receptor protein vs. Ensembl Zebrafish
Match: adipor1a (adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-040718-169])

HSP 1 Score: 293.123 bits (749), Expect = 7.453e-95
Identity = 147/267 (55.06%), Postives = 184/267 (68.91%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  +    W V+  H LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLG I F+ L    + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYC+  P++IY  ++ VLG   + ++  D F+TP  R  RA VF+ LGLSG++P  H+ I EGF  A     +GW  LM A+YITGA +YA R+PER+FPGK DIWF SHQI
Sbjct:   73 AHHAMEKMEEFVHKVWEGRWRVIPFHVLPEWLKDNDYLLHGHRPPMPSFRACFGSIFRIHTETGNIWTHLLGLILFLCLGTLTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLTIVCVLGIAAIIVAQWDRFSTPRHRPTRAGVFMGLGLSGIVPTMHFTIEEGFVKATTVGQMGWFYLMGAMYITGAGLYAARIPERYFPGKCDIWFHSHQI 339          
BLAST of Adiponectin receptor protein vs. Ensembl Zebrafish
Match: adipor1a (adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-040718-169])

HSP 1 Score: 293.123 bits (749), Expect = 7.453e-95
Identity = 147/267 (55.06%), Postives = 184/267 (68.91%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  +    W V+  H LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLG I F+ L    + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYC+  P++IY  ++ VLG   + ++  D F+TP  R  RA VF+ LGLSG++P  H+ I EGF  A     +GW  LM A+YITGA +YA R+PER+FPGK DIWF SHQI
Sbjct:   73 AHHAMEKMEEFVHKVWEGRWRVIPFHVLPEWLKDNDYLLHGHRPPMPSFRACFGSIFRIHTETGNIWTHLLGLILFLCLGTLTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLTIVCVLGIAAIIVAQWDRFSTPRHRPTRAGVFMGLGLSGIVPTMHFTIEEGFVKATTVGQMGWFYLMGAMYITGAGLYAARIPERYFPGKCDIWFHSHQI 339          
BLAST of Adiponectin receptor protein vs. Ensembl Xenopus
Match: adipor1 (adiponectin receptor 1 [Source:NCBI gene;Acc:493308])

HSP 1 Score: 316.235 bits (809), Expect = 1.211e-103
Identity = 160/290 (55.17%), Postives = 201/290 (69.31%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYR 1154
            A   + + EE +  +    W V+    LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLGF+ F+ L +  + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYC+  P++IY  ++ VLG   + ++  D FATP  R  RA VF+ LGLSG++P  H+ I EGF  A     +GW  LMA +YITGA +YA R+PERFFPGKFDIWFQSHQIFHV VV AA +H  G+  +  +R
Sbjct:   77 AHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFRSIFRIHTETGNIWTHLLGFVLFLSLGVLTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGITAIVVAQWDRFATPKHRPTRAGVFLGLGLSGIVPTLHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFIHFYGISNLQEFR 366          
BLAST of Adiponectin receptor protein vs. Ensembl Xenopus
Match: atg4a (autophagy related 4A cysteine peptidase [Source:Xenbase;Acc:XB-GENE-922674])

HSP 1 Score: 98.9821 bits (245), Expect = 2.140e-22
Identity = 79/257 (30.74%), Postives = 128/257 (49.81%), Query Frame = 3
Query:  333 IISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTK--PMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCH-SEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGAC---IYALRVPERFFPGKFDIWFQSHQI 1085
            ++ RG  +     +P +LKDN ++  G+R  L S K C  S+F +  ETVNIW+HLLGF+ F  L +Y +    P +     + V+ S       +C+  S  +H   CH SEK  R +  LDY GI++  +G  +  + Y+FYCN   + +Y I +  +        +   + T  +  +R+ +F ++   G+IP  H+I L G             V++  +YI  A     Y  +VPER+FPG+ +    SHQ+
Sbjct:   23 LLPRGIRLYTYEQIPVFLKDNPYITDGYRAYLPS-KLCLKSLFILSNETVNIWSHLLGFLLFFSLGVYDMMSVLPSANASREDFVICSICLFCFQVCMLCSVGYHLFCCHRSEKTSRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPSYLTQQWHRLRSVIFCSVSGYGIIPTVHWIWLNGGVGTSIVQEFAPRVIV--MYIIAAVAFLFYISKVPERYFPGQLNYLGSSHQL 276          
BLAST of Adiponectin receptor protein vs. Ensembl Xenopus
Match: rec8 (REC8 meiotic recombination protein [Source:Xenbase;Acc:XB-GENE-957047])

HSP 1 Score: 57.3806 bits (137), Expect = 1.676e-8
Identity = 70/244 (28.69%), Postives = 100/244 (40.98%), Query Frame = 3
Query:  369 SLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCH--SEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGA---ICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            S P  L+ N F+L G+RP + S   C  S+F +H E  NI+TH  G      L +  L  P  +  LS   +    ++  +     S  +H    H     V      LD CGI L+     +P ++ +  C    + +  +  S L +    C   +  +     +F    AF F    L             GF H    +SL   +LM  L + G  I   R+PER  PGKFD WF SHQI
Sbjct:   46 SSPPHLQFNKFVLTGYRP-VASGAECMRSLFYLHNELGNIYTH--GIPLLGFLLLLPLQIPWLQ--LSVPWLGLVHYLACVSPQLGSVVYHLFMNHHGGAPVYHKLLTLDMCGICLVNTLGALPIIYCTLLCYPSTRTLALLAYSALSSYVIFCAVSAHSNISRLCSFAWQAAFRFFIFYLRWAD--------LGFGHP---SSLRCYLLMDGLALLGGIINISRLPERLHPGKFDYWFNSHQI 273          
BLAST of Adiponectin receptor protein vs. Ensembl Xenopus
Match: hspa1l (heat shock protein family A (Hsp70) member 1 like [Source:Xenbase;Acc:XB-GENE-6045069])

HSP 1 Score: 53.9138 bits (128), Expect = 3.359e-7
Identity = 65/254 (25.59%), Postives = 104/254 (40.94%), Query Frame = 3
Query:  393 NDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPM-SEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSF--------------YCNLLPQIIYTIM-------ISVLGAICMGISLMDYFATPNF-RSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
             D ++ G+R   +S  AC  S+F++  ETVNIWTH +    F+   + FL      +  L   +V+    +   +    S   HT    S K   I   LDY  ++L ++G+ I +  Y F              +C ++   I T +       + VL    + I  +   A P   + +R   F    L   IP  + + L        NA+L   +  + L    A ++A  +PER  PG FD    SHQ+
Sbjct:   46 EDSIICGYRSPCSSATACILSLFQMTNETVNIWTHFIPTWYFLWKMLSFLYSGFWDDPFLWPLLVYQ---LSCCIYPLMSTCAHTFSVMSTKARHICFFLDYGAVSLYSLGAAIAYSAYVFPDRWVGGTFHRWYVFCAVMNTGICTALACYSRLGVPVLHYNQLVIERIPEVARPRLSKVLRTTAFAYPYLFDSIPLFYRLFLCSGSGCAQNAALPMHIWHSILAFLTAFLFATHLPERLAPGCFDYVGHSHQL 296          
BLAST of Adiponectin receptor protein vs. Ensembl Xenopus
Match: PAQR9 (progestin and adipoQ receptor family member IX [Source:NCBI gene;Acc:100495753])

HSP 1 Score: 53.5286 bits (127), Expect = 4.094e-7
Identity = 66/268 (24.63%), Postives = 110/268 (41.04%), Query Frame = 3
Query:  399 FLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFI--VLAIYFLTKPMSEMLLSEKVVFS--AFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLP--------------------QIIYTIMISVLGAICMGISLM----DYFATPNFR--------SMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALY---ITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            F+L G+R    + + C +SIF+   ET+N WTH +  + F+     ++FL    +E+      +     +  G +L    S T H   C S ++   F  LDY  I+     ST+    YS+Y  LLP                    Q+ Y++++ + G + + ++ +       A    R        ++R FVF A+ LS   P    +++E         +    V     Y   +  A     ++PER  PG FDI   SHQ+
Sbjct:   53 FILSGYRRLHLTAQECLASIFQPTNETLNFWTHFIPLVLFVSKFYHVFFLA---TELPFHHPALLPLWCYASGVLLTFAMSCTAHVFSCRSLRLRAAFFFLDYASISYYGFASTV---AYSYY--LLPRLSLLDPAVMTPYLQSLGWHQVDYSMLMGLYGKLVLPVAFILAVTCTVACCKSRAEDCSYPFAIRTFVF-AMPLSMACP----VMIESLLFDLRKRNPTLFVHFYRRYFWLLVAAFFNVSKIPERIHPGLFDIIGHSHQL 307          
BLAST of Adiponectin receptor protein vs. Ensembl Mouse
Match: Adipor2 (adiponectin receptor 2 [Source:MGI Symbol;Acc:MGI:93830])

HSP 1 Score: 320.857 bits (821), Expect = 2.014e-105
Identity = 165/312 (52.88%), Postives = 205/312 (65.71%), Query Frame = 3
Query:  156 SVETLLNNGWSEKSDSKTNIVRQRKTHSHNRSASFGGKFSDFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            S+ET + + + E S  +       + H  N     G         A   + + EE +  +    W V+    LP WLKDNDFLL GHRP + SF+ACF SIFRIHTET NIWTHLLG + F+ L I+++ +P    +  L EKVVF  FF+GAILCL FSW FHTV+CHSE V R+F+KLDY GI LL +GS +PWL+YSFYCN  P  IY I+I VLG   + +S  D FATP +R +RA VFV LGLSG+IP  HY+I EGF  A     +GWL+LMA+LYITGA +YA R+PERFFPGK DIWF SHQ+
Sbjct:   45 SLETPVCSSYYENSPEEP------ECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQL 350          
BLAST of Adiponectin receptor protein vs. Ensembl Mouse
Match: Adipor2 (adiponectin receptor 2 [Source:MGI Symbol;Acc:MGI:93830])

HSP 1 Score: 320.857 bits (821), Expect = 2.014e-105
Identity = 165/312 (52.88%), Postives = 205/312 (65.71%), Query Frame = 3
Query:  156 SVETLLNNGWSEKSDSKTNIVRQRKTHSHNRSASFGGKFSDFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            S+ET + + + E S  +       + H  N     G         A   + + EE +  +    W V+    LP WLKDNDFLL GHRP + SF+ACF SIFRIHTET NIWTHLLG + F+ L I+++ +P    +  L EKVVF  FF+GAILCL FSW FHTV+CHSE V R+F+KLDY GI LL +GS +PWL+YSFYCN  P  IY I+I VLG   + +S  D FATP +R +RA VFV LGLSG+IP  HY+I EGF  A     +GWL+LMA+LYITGA +YA R+PERFFPGK DIWF SHQ+
Sbjct:   45 SLETPVCSSYYENSPEEP------ECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQL 350          
BLAST of Adiponectin receptor protein vs. Ensembl Mouse
Match: Adipor1 (adiponectin receptor 1 [Source:MGI Symbol;Acc:MGI:1919924])

HSP 1 Score: 301.982 bits (772), Expect = 3.103e-98
Identity = 152/267 (56.93%), Postives = 187/267 (70.04%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  +    W V+    LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLGF+ F+ L I  + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYC+  P++IY  ++ VLG   + ++  D FATP  R  RA VF+ LGLSGV+P  H+ I EGF  A     +GW  LMA +YITGA +YA R+PERFFPGKFDIWFQSHQI
Sbjct:   73 AHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQI 339          
BLAST of Adiponectin receptor protein vs. Ensembl Mouse
Match: Adipor1 (adiponectin receptor 1 [Source:MGI Symbol;Acc:MGI:1919924])

HSP 1 Score: 301.982 bits (772), Expect = 3.103e-98
Identity = 152/267 (56.93%), Postives = 187/267 (70.04%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  +    W V+    LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLGF+ F+ L I  + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYC+  P++IY  ++ VLG   + ++  D FATP  R  RA VF+ LGLSGV+P  H+ I EGF  A     +GW  LMA +YITGA +YA R+PERFFPGKFDIWFQSHQI
Sbjct:   73 AHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQI 339          
BLAST of Adiponectin receptor protein vs. Ensembl Mouse
Match: Paqr3 (progestin and adipoQ receptor family member III [Source:MGI Symbol;Acc:MGI:2679683])

HSP 1 Score: 102.449 bits (254), Expect = 1.130e-23
Identity = 79/255 (30.98%), Postives = 127/255 (49.80%), Query Frame = 3
Query:  333 IISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTK--PMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCH-SEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLG-WLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            ++ RG  +     +P  LKDN ++  G+R  L S + C  S+F +  ETVNIW+HLLGF  F  L IY +T   P +     + V+ S       +C+  S  +H   CH SEK  R +  LDY GI++  +G  +  + Y+FYCN   + +Y I +  +        +   + T  ++ +R  +F ++   GVIP  H++ L G   A         +++M  + +     Y  +VPER+FPG+ +    SHQI
Sbjct:   23 LVPRGIRLYTYEQIPVSLKDNPYITDGYRAYLPS-RLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPSYLTQQWQRLRPIIFCSVSGYGVIPTLHWVWLNGGVSAPIVQDFAPRVIVMYVIALLAFLFYISKVPERYFPGQLNYLGSSHQI 276          
BLAST of Adiponectin receptor protein vs. UniProt/SwissProt
Match: sp|Q9VCY8|ADRL_DROME (Adiponectin receptor protein OS=Drosophila melanogaster OX=7227 GN=AdipoR PE=1 SV=2)

HSP 1 Score: 343.969 bits (881), Expect = 9.449e-113
Identity = 170/299 (56.86%), Postives = 217/299 (72.58%), Query Frame = 3
Query:  276 DFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHC 1172
            D    A     QAEE +  +    W V H  +LP WL+DNDFL  GHRP L SF+ACF SIFR+HTET NIWTHLLG IAFI +A+YF+++P  E+   EK+VF AFFIGAI+CLGFS+ FHT+ CHS ++GR+F+KLDYCGI LL +GS +PWL+Y FYC+  P++IY  ++S+LG + + +SL D F+ P  R +RA VF++ GLSGVIP  HY I+EG++     ASLGWL+LM  LYI GA +YALRVPER+FPGKFDIW QSHQIFH+ V+ AA VH  G+ ++A YR     C
Sbjct:  137 DLGALAHNAAEQAEEFVRKVWEASWKVCHYKNLPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQPKVIYLSVVSILGILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAMYRVMYSEC 435          
BLAST of Adiponectin receptor protein vs. UniProt/SwissProt
Match: sp|Q86V24|PAQR2_HUMAN (Adiponectin receptor protein 2 OS=Homo sapiens OX=9606 GN=ADIPOR2 PE=1 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 1.030e-104
Identity = 172/355 (48.45%), Postives = 222/355 (62.54%), Query Frame = 3
Query:   66 LNSPTKINESDNRFHKRSISHGPDLMKSAESVETLLNNGWSEKSDSKTNIVRQRKTHSHNRSASFGGKFSDFSEA-------------ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            +N PT+     +R  +  I     L K  +   T   +  S + D +  I+      SH++ +S   ++SD +               A   + + EE +  +    W V+    LP WLKDNDFLL GHRP + SF+ACF SIFRIHTET NIWTHLLG + F+ L I+++ +P    +  L EKVVF  FF+GAILCL FSW FHTV+CHSE V R+F+KLDY GI LL +GS +PWL+YSFYCN  P  IY I+I VLG   + +S  D FATP +R +RA VF+ LGLSG+IP  HY+I EGF  A     +GWL+LMA+LYITGA +YA R+PERFFPGK DIWF SHQ+
Sbjct:    1 MNEPTENRLGCSRTPEPDIR----LRKGHQLDGTRRGDNDSHQGDLEP-ILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQL 350          
BLAST of Adiponectin receptor protein vs. UniProt/SwissProt
Match: sp|Q8BQS5|PAQR2_MOUSE (Adiponectin receptor protein 2 OS=Mus musculus OX=10090 GN=Adipor2 PE=1 SV=2)

HSP 1 Score: 320.857 bits (821), Expect = 1.409e-104
Identity = 165/312 (52.88%), Postives = 205/312 (65.71%), Query Frame = 3
Query:  156 SVETLLNNGWSEKSDSKTNIVRQRKTHSHNRSASFGGKFSDFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            S+ET + + + E S  +       + H  N     G         A   + + EE +  +    W V+    LP WLKDNDFLL GHRP + SF+ACF SIFRIHTET NIWTHLLG + F+ L I+++ +P    +  L EKVVF  FF+GAILCL FSW FHTV+CHSE V R+F+KLDY GI LL +GS +PWL+YSFYCN  P  IY I+I VLG   + +S  D FATP +R +RA VFV LGLSG+IP  HY+I EGF  A     +GWL+LMA+LYITGA +YA R+PERFFPGK DIWF SHQ+
Sbjct:   45 SLETPVCSSYYENSPEEP------ECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQL 350          
BLAST of Adiponectin receptor protein vs. UniProt/SwissProt
Match: sp|Q91VH1|PAQR1_MOUSE (Adiponectin receptor protein 1 OS=Mus musculus OX=10090 GN=Adipor1 PE=1 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 2.171e-97
Identity = 152/267 (56.93%), Postives = 187/267 (70.04%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  +    W V+    LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLGF+ F+ L I  + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYC+  P++IY  ++ VLG   + ++  D FATP  R  RA VF+ LGLSGV+P  H+ I EGF  A     +GW  LMA +YITGA +YA R+PERFFPGKFDIWFQSHQI
Sbjct:   73 AHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQI 339          
BLAST of Adiponectin receptor protein vs. UniProt/SwissProt
Match: sp|Q96A54|PAQR1_HUMAN (Adiponectin receptor protein 1 OS=Homo sapiens OX=9606 GN=ADIPOR1 PE=1 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 3.000e-97
Identity = 152/267 (56.93%), Postives = 187/267 (70.04%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  +    W V+    LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLGF+ F+ L I  + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYC+  P++IY  ++ VLG   + ++  D FATP  R  RA VF+ LGLSGV+P  H+ I EGF  A     +GW  LMA +YITGA +YA R+PERFFPGKFDIWFQSHQI
Sbjct:   73 AHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQI 339          
BLAST of Adiponectin receptor protein vs. TrEMBL
Match: A0A267EQ28 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005687g1 PE=4 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 3.114e-131
Identity = 203/331 (61.33%), Postives = 248/331 (74.92%), Query Frame = 3
Query:  204 KTNIVRQRKTHSHNRSASFGGKFSD------FSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHCIA 1178
            +T+ V +R+ H    S     K SD      F E A+R    AE+ M ++ +RGW +     LP WLKDNDFL+ GHRPQLN+F ACF SIFRIHTET NIWTH+LG IAF  +A+YFLT+P  E+   EKVVF+AFF+GA+LC+GFS+ FHTV+CHSE+VGR+FNKLDYCGI LLT+GS +PWL+YSFYC L P+IIY  +ISVLG   + +S+ D FA P +R +RA VF+ALGLSGVIP  HY+ILEGFY A  +AS+GWLVLMA LYITGA IYA+R PER FPGKFD+WFQSHQIFHVFVV AA VH  G+ ++A+YR     CIA
Sbjct:  124 ETSRVTKRRGHHRKNSDPLPHKPSDLTLLQQFDELATRAKDSAEQFMHHVWTRGWRLTPHCRLPDWLKDNDFLVQGHRPQLNTFAACFKSIFRIHTETGNIWTHMLGCIAFSGIAVYFLTRPSIEVQWQEKVVFAAFFLGAVLCMGFSFIFHTVYCHSERVGRLFNKLDYCGIALLTMGSFVPWLYYSFYCQLSPKIIYLSLISVLGTTAIVVSMFDKFAAPQYRPLRAGVFIALGLSGVIPALHYVILEGFYSAIYHASMGWLVLMALLYITGAVIYAVRFPERLFPGKFDLWFQSHQIFHVFVVAAAFVHFHGISEIANYRLTAGDCIA 454          
BLAST of Adiponectin receptor protein vs. TrEMBL
Match: A0A1I8G473 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 3.576e-131
Identity = 203/331 (61.33%), Postives = 248/331 (74.92%), Query Frame = 3
Query:  204 KTNIVRQRKTHSHNRSASFGGKFSD------FSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHCIA 1178
            +T+ V +R+ H    S     K SD      F E A+R    AE+ M ++ +RGW +     LP WLKDNDFL+ GHRPQLN+F ACF SIFRIHTET NIWTH+LG IAF  +A+YFLT+P  E+   EKVVF+AFF+GA+LC+GFS+ FHTV+CHSE+VGR+FNKLDYCGI LLT+GS +PWL+YSFYC L P+IIY  +ISVLG   + +S+ D FA P +R +RA VF+ALGLSGVIP  HY+ILEGFY A  +AS+GWLVLMA LYITGA IYA+R PER FPGKFD+WFQSHQIFHVFVV AA VH  G+ ++A+YR     CIA
Sbjct:  113 ETSRVTKRRGHHRKNSDPLPHKPSDLTLLQQFDELATRAKDSAEQFMHHVWTRGWRLTPHCRLPDWLKDNDFLVQGHRPQLNTFAACFKSIFRIHTETGNIWTHMLGCIAFSGIAVYFLTRPSIEVQWQEKVVFAAFFLGAVLCMGFSFIFHTVYCHSERVGRLFNKLDYCGIALLTMGSFVPWLYYSFYCQLSPKIIYLSLISVLGTTAIVVSMFDKFAAPQYRPLRAGVFIALGLSGVIPALHYVILEGFYSAIYHASMGWLVLMALLYITGAVIYAVRFPERLFPGKFDLWFQSHQIFHVFVVAAAFVHFHGISEIANYRLTAGDCIA 443          
BLAST of Adiponectin receptor protein vs. TrEMBL
Match: A0A2T7NUS7 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15424 PE=4 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 1.634e-130
Identity = 196/298 (65.77%), Postives = 235/298 (78.86%), Query Frame = 3
Query:  294 SRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHCIASTS 1187
            S+   QAEE +  + + GWNVVH H+LP WLKDNDFLL GHR   NSF ACF SIFRIHTET NIWTHLLG IAF+ +A+YF+T+P  E+   EK VFSAFFIGAILCLGFSW FHTV+CHSE+VGR FNKLDYCGI LLT+GS +PWL+YSFYC L P+I Y ++I VLG++C+ +S+ D FA P +R +RA VFVALGLSGVIP  HY+I +GF+HA   A+LGWLVLMA LYI GA IYA+R+PER FPGKFDIWFQSHQIFH+FV+ AA VH  G+ ++A+YR     C+ S S
Sbjct:  120 SKCAEQAEEFVRKVWAAGWNVVHHHTLPDWLKDNDFLLRGHRTPTNSFVACFKSIFRIHTETGNIWTHLLGMIAFLGIAVYFVTRPTIEVQWQEKAVFSAFFIGAILCLGFSWIFHTVYCHSERVGRFFNKLDYCGIALLTIGSFVPWLYYSFYCRLEPKITYLVLIFVLGSLCIVVSMWDKFAQPQYRPLRAGVFVALGLSGVIPALHYVITDGFWHAIHKAALGWLVLMAILYILGAVIYAVRIPERIFPGKFDIWFQSHQIFHMFVLAAAFVHYHGISEIANYRLTLGDCLESRS 417          
BLAST of Adiponectin receptor protein vs. TrEMBL
Match: A0A1I8G9P3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 8.319e-129
Identity = 195/303 (64.36%), Postives = 236/303 (77.89%), Query Frame = 3
Query:  270 FSDFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHCIA 1178
               F E A+R    AE+ M ++ +RGW +     LP WLKDNDFL+ GHRPQLN+F ACF SIFRIHTET NIWTH+LG IAF  +A+YFLT+P  E+   EKVVF+AFF+GA+LC+GFS+ FHTV+CHSE+VGR+FNKLDYCGI LLT+GS +PWL+YSFYC L P+IIY  +ISVLG   + +S+ D FA P +R +RA VF+ALGLSGVIP  HY+ILEGFY A  +AS+GWLVLMA LYITGA IYA+R PER FPGKFD+WFQSHQIFHVFVV AA VH  G+ ++A+YR     CIA
Sbjct:  142 LQQFDELATRAKDSAEQFMHHVWTRGWRLTPHCRLPDWLKDNDFLVQGHRPQLNTFAACFKSIFRIHTETGNIWTHMLGCIAFSGIAVYFLTRPSIEVQWQEKVVFAAFFLGAVLCMGFSFIFHTVYCHSERVGRLFNKLDYCGIALLTMGSFVPWLYYSFYCQLSPKIIYLSLISVLGTTAIVVSMFDKFAAPQYRPLRAGVFIALGLSGVIPALHYVILEGFYSAIYHASMGWLVLMALLYITGAVIYAVRFPERLFPGKFDLWFQSHQIFHVFVVAAAFVHFHGISEIANYRLTAGDCIA 444          
BLAST of Adiponectin receptor protein vs. TrEMBL
Match: A0A210Q0U6 (ADIPOR-like receptor OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11944 PE=4 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 1.645e-128
Identity = 196/302 (64.90%), Postives = 233/302 (77.15%), Query Frame = 3
Query:  276 DFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHCIAS 1181
            DF     +   QAEE +  + +  W VVH HSLP WLKDNDFL  GHRP  NSF  CF SIFRIHTET NIWTHLLG IAFI +A YF+T+P  E+   EK VFSAFF+GAILCLGFSW FHTV+CHSE+VGR+FNKLDYCGI LLT+GS +PWL+YSFYC+L P+I Y ++I VLG  C+ +SL D FA P +R++RA VF+ALGLSGVIP  HY+I+EGFY+A   A+LGWLVLMA LYI GA IYA+R+PER FPGKFDIWFQSHQIFHVFV+ AA VH  G+ ++A YR     C+A+
Sbjct:   96 DFLAGTCKAAEQAEEFVKKVWAGAWRVVHHHSLPDWLKDNDFLHTGHRPPTNSFIQCFKSIFRIHTETGNIWTHLLGMIAFIGVAGYFMTRPSIEVQWQEKAVFSAFFVGAILCLGFSWLFHTVYCHSERVGRLFNKLDYCGIALLTMGSFVPWLYYSFYCDLGPKIAYLVLIFVLGTSCIVVSLWDKFAQPQYRAVRAGVFIALGLSGVIPALHYVIIEGFYNAINFAALGWLVLMAFLYIAGAVIYAVRIPERLFPGKFDIWFQSHQIFHVFVLAAAFVHFHGISKIATYRLTLGDCLAT 397          
BLAST of Adiponectin receptor protein vs. Ensembl Cavefish
Match: adipor2 (adiponectin receptor 2 [Source:NCBI gene;Acc:103034013])

HSP 1 Score: 302.753 bits (774), Expect = 9.788e-99
Identity = 151/267 (56.55%), Postives = 188/267 (70.41%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  +    W V+    LP WLKDNDFLL GHRP + SF+ACF SIFRIHTET NIWTHLLG + F+ L I+++ +P    +    EK+V   FF+GAILCL FSW FHTV+CHSE V R+F+KLDY GI  L +GS +PWL+YSFYC+  P  IY I++ VLG   + +S  D+FATP +R +RA VFV LGLSGV+P  H++I EGF  A     +GWL LMA LYITGAC+YA R+PERFFPGK DIWF SHQ+
Sbjct:   66 AHHAMEKMEEFVHKMWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCLFFLCLGIFYMFRPNMSFVAPFQEKIVIGMFFLGAILCLSFSWLFHTVYCHSEGVSRVFSKLDYSGIAFLIMGSFVPWLYYSFYCSPQPCFIYLIVVCVLGLAAITVSQCDFFATPQYRGVRAGVFVGLGLSGVVPSLHFVITEGFLRATTMGQMGWLFLMAVLYITGACLYAARIPERFFPGKCDIWFHSHQL 332          
BLAST of Adiponectin receptor protein vs. Ensembl Cavefish
Match: adipor1b (adiponectin receptor 1 [Source:NCBI gene;Acc:103027515])

HSP 1 Score: 295.819 bits (756), Expect = 7.348e-96
Identity = 159/290 (54.83%), Postives = 199/290 (68.62%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYR 1154
            A   + + EE +  +    W V+    LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIW+H+LG I F+ L    + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYC+  P++IY  ++ VLG   + ++  D FATP  R  RA VF+ LGLSGVIP  H+ I EGF  A     +GW +LM A+YITGA +YA R+PERFFPGK DIWFQSHQIFHV VV AA +H  G+  +  +R
Sbjct:   79 AHHAMEKMEEFVHKVWEGRWRVIPYQLLPDWLKDNDYLLHGHRPPMPSFRACFGSIFRIHTETGNIWSHMLGLILFLFLGTLTMLRPNVSFMAPLQEKVVFGMFFLGAVLCLCFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSVVCVLGISAIIVAQWDRFATPRHRPTRAGVFLGLGLSGVIPTMHFTIAEGFVKATTVGQMGWFILMGAMYITGAGLYAARIPERFFPGKCDIWFQSHQIFHVLVVAAAFIHFYGISNLQEFR 368          
BLAST of Adiponectin receptor protein vs. Ensembl Cavefish
Match: adipor1a (adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-040718-169])

HSP 1 Score: 220.32 bits (560), Expect = 3.979e-67
Identity = 138/290 (47.59%), Postives = 171/290 (58.97%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYR 1154
            A   + + EE +  +    W V+  H LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLG I F+ L    + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+K  Y  +T    G     L Y++ C L  ++I                           S R  VF+ LGLSG++P  H+ I EGF  A     +GW  LM A+YITGA +YA R+PERFFPGK DIWF SHQIFHV VV AA +H  G+  +  +R
Sbjct:   74 AHHAMEKMEEFVHKVWEGRWRVIPFHVLPEWLKDNDYLLHGHRPPMPSFRACFGSIFRIHTETGNIWTHLLGLILFLFLGTLTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKY-YMPLT----GCFFFLLCYTYICRLSNKLI---------------------------SKRYGVFMGLGLSGIVPTMHFTIEEGFVKATTVGQMGWFYLMGAMYITGAGLYAARIPERFFPGKCDIWFHSHQIFHVLVVAAAFIHFYGVSNLQEFR 331          
BLAST of Adiponectin receptor protein vs. Ensembl Cavefish
Match: adipor1a (adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-040718-169])

HSP 1 Score: 218.394 bits (555), Expect = 2.120e-66
Identity = 135/293 (46.08%), Postives = 171/293 (58.36%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFR---SMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYR 1154
            A   + + EE +  +    W V+  H LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLG I F+ L    + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+K  Y     + + + + + H +        I Y                     +P  R   S   F+F+ LGLSG++P  H+ I EGF  A     +GW  LM A+YITGA +YA R+PERFFPGK DIWF SHQIFHV VV AA +H  G+  +  +R
Sbjct:   66 AHHAMEKMEEFVHKVWEGRWRVIPFHVLPEWLKDNDYLLHGHRPPMPSFRACFGSIFRIHTETGNIWTHLLGLILFLFLGTLTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSK--YAADVGMHIPAVLAYKHKNLVSYNYLHINYN--------------------SPEKRLLWSETLFLFMGLGLSGIVPTMHFTIEEGFVKATTVGQMGWFYLMGAMYITGAGLYAARIPERFFPGKCDIWFHSHQIFHVLVVAAAFIHFYGVSNLQEFR 336          
BLAST of Adiponectin receptor protein vs. Ensembl Cavefish
Match: adipor1a (adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-040718-169])

HSP 1 Score: 216.083 bits (549), Expect = 1.447e-65
Identity = 123/267 (46.07%), Postives = 150/267 (56.18%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  +    W V+  H LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLG I F+ L    + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+K  Y     L +     W                                D     +  + R  VF+ LGLSG++P  H+ I EGF  A     +GW  LM A+YITGA +YA R+PERFFPGK DIWF SHQI
Sbjct:   71 AHHAMEKMEEFVHKVWEGRWRVIPFHVLPEWLKDNDYLLHGHRPPMPSFRACFGSIFRIHTETGNIWTHLLGLILFLFLGTLTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSK--YAPHRRLVLSDITLW-------------------------------SDVARERHLPTQREQVFMGLGLSGIVPTMHFTIEEGFVKATTVGQMGWFYLMGAMYITGAGLYAARIPERFFPGKCDIWFHSHQI 304          
BLAST of Adiponectin receptor protein vs. Ensembl Sea Lamprey
Match: adipor1b (adiponectin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2896])

HSP 1 Score: 311.227 bits (796), Expect = 9.282e-103
Identity = 154/320 (48.12%), Postives = 203/320 (63.44%), Query Frame = 3
Query:  132 PDLMKSAESVETLLNNGWSEKSDSKTNIVRQRKTHSHNRSASFGGKFSDFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            PD +  AE    L+  G +  S  + + V   +    +       +       A   + + EE +  +    W V+    LP WL+DN+FLL GHRP + SF+ACF SIFR+HTET NIWTHL+GF  F+VLA+ +L +P    +  L EKVVF  FF+GAILCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYCN  P++IY + I VLG   + +S  + F+TP +R +RA VF++LG SG++P  H++++EGF  A      GWL LM  LY  GA +YA R+PERFFPG  DIWF SHQI
Sbjct:   19 PDDVGLAELGPLLVTTGQATCSVREVDQVHADRERDEDGPEPL--RVITLPLQAHHAMEKMEEFVCKVWQGRWRVIPHDVLPSWLQDNEFLLQGHRPPMPSFRACFRSIFRLHTETGNIWTHLIGFFLFVVLAVIYLFRPNMSFVAPLQEKVVFGVFFMGAILCLCFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPRLIYLVTICVLGIAAIVVSQWERFSTPQYRVLRAAVFLSLGFSGIVPTVHFMVVEGFMRATTAGQTGWLFLMGLLYSMGAALYAARIPERFFPGMCDIWFHSHQI 336          
BLAST of Adiponectin receptor protein vs. Ensembl Sea Lamprey
Match: adipor2 (adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-041210-60])

HSP 1 Score: 302.753 bits (774), Expect = 9.413e-100
Identity = 153/269 (56.88%), Postives = 193/269 (71.75%), Query Frame = 3
Query:  285 EAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            + A + + + EE +  +    W V+    LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHL+GF+ F++L   +L +P    +  L EKVVF  FF+GAILCL FSW FHTV+CHSE V +IF+KLDY GI LL +GS +PWL+YSFYC+  P+IIY +  SVLG   + +S  D FATP +R++RA VF+ LGLSG++P  H++I EGF  A     +GWL LMA LYITGA +YA R+PERFFPGK DIWF SHQI
Sbjct:   37 QQAHQAMERVEEFVCKVWEGRWPVLSHDLLPDWLKDNDYLLHGHRPPMPSFRACFRSIFRIHTETGNIWTHLIGFLLFLILGTIYLLRPNIAFIAPLQEKVVFGTFFLGAILCLCFSWLFHTVYCHSESVSKIFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRIIYMVTTSVLGVAAIVVSQWDRFATPEYRAVRAGVFLGLGLSGIVPTIHFMIAEGFIKAATVGQIGWLFLMAVLYITGAALYAARIPERFFPGKCDIWFHSHQI 305          
BLAST of Adiponectin receptor protein vs. Ensembl Sea Lamprey
Match: paqr3b (progestin and adipoQ receptor family member IIIb [Source:ZFIN;Acc:ZDB-GENE-050913-128])

HSP 1 Score: 94.7449 bits (234), Expect = 6.958e-22
Identity = 76/256 (29.69%), Postives = 125/256 (48.83%), Query Frame = 3
Query:  342 RGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKA-----CFSSIFRIHTETVNIWTHLLGFIAFIVLAIY--FLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCH-SEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACI-YALRVPERFFPGKFDIWFQSHQ 1082
            RG  +     +P +LK N ++  G+R  L S        C +S+F +  ETVNIW+HL GF+ F  L +Y   +  P ++    + ++++ F     +C+  S  +H   CH SEK  R +  LDY GI++  +G  IP + Y+FYC    + ++ I I  +  +     +   + +P + + R  +   + L GVIP  H+I+L G             V++  L    A + Y  +VPER+FPG  +    SHQ
Sbjct:   26 RGIRLYTYEQVPCFLKGNPYITDGYRAYLPSRLCLKRCRCVNSVFIVSNETVNIWSHLFGFLLFFFLGVYDTLVMLPAAQASHDDYIIYTIFLFCFQVCMLCSTGYHLFCCHRSEKTSRRWLALDYAGISVGLLGCYIPGVFYAFYCE---EFVFLINIVNIMLLVFFAHIHPQYFSPQWYTTRLVILSCVSLYGVIPTVHWIVLNGGPTTTIVQDFSPRVMIMYLLAGVAFVFYVGKVPERYFPGHVNFVGSSHQ 278          
BLAST of Adiponectin receptor protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003422.1 (pep scaffold:Pmarinus_7.0:GL479692:543133:563138:1 gene:ENSPMAG00000003131.1 transcript:ENSPMAT00000003422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 1.141e-13
Identity = 68/242 (28.10%), Postives = 101/242 (41.74%), Query Frame = 3
Query:  369 SLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWL---VLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            S P  L+ N F+L G+RP +++   C  S+F +H E+ NI++H  G      L +   + P   +                      +     H     V R    LD CGI  +T    +  ++ SF C  + Q +  +  SVL  I +  ++    A+ N   +RAF + A        C         +      SLG L   VLM  + + G  I   RVPER+ PG+FD WF SHQI
Sbjct:   14 SCPPHLRFNKFVLAGYRP-VSTGSDCLHSLFYLHNESGNIYSH--GLPLLWFLLVLPPSLPWGRLHTPWLAAAHCLACACPPLGSVFYHLFMNHTGGPAVYRRLLCLDMCGICAITSLGALSIIYCSFLCRPVLQTLGMLGYSVLSLIALHRAVS---ASTNNARLRAFGWQAAFRMACYTCR--------WAGLATTSLGALRHYVLMDLVAMAGGAINVSRVPERWLPGRFDYWFNSHQI 241          
BLAST of Adiponectin receptor protein vs. Ensembl Sea Lamprey
Match: paqr5a (progestin and adipoQ receptor family member Va [Source:NCBI gene;Acc:393156])

HSP 1 Score: 64.3142 bits (155), Expect = 1.613e-11
Identity = 64/256 (25.00%), Postives = 108/256 (42.19%), Query Frame = 3
Query:  366 HSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPM----SEMLLSEKVVFS--AFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIP---------WLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSM-RAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            H +P   ++ D ++ G+R   +S   C  S+F +  ET+NIWTH L        A YF+ + +    S   L E   +   A+     L L  S   HT    S +   +    DY  ++L ++GS I          W+H + +   +P  +   ++    A     + +D    P+F  + R   F    L   IP  + ++L        N +  W      L +  AC++++ +PER  PG+FD    SHQ+
Sbjct:   13 HQVPKAFQE-DGIISGYRCPKSSAFDCILSLFHLTNETLNIWTHFLP-------ACYFMRRLLGFSQSLDFLGEAYTWPLLAYLFTCCLYLLASSLAHTFSTMSVRSLHVCFFFDYAALSLYSLGSGIAYAAYIFPEQWVHGTLHAYFVPTAVMNTLLCTSLACYSRFTELD---QPHFSKLIRMLAFFCPYLLDNIPLFYRVLLCSGEGCSQNETFPWHYAHILLAVLTACLFSMHLPERLLPGRFDYVGHSHQL 257          
BLAST of Adiponectin receptor protein vs. Ensembl Yeast
Match: IZH2 (Plasma membrane receptor for plant antifungal osmotin; involved in zinc ion homeostasis, apoptosis; negatively regulates ZRT1 and other functionally divergent genes through CCCTC promoter motif (IzRE); modulates FET3 activity in iron-independent manner; affects gene expression by influencing balance of competition between Msn2p/Msn4p and Nrg1p/Nrg2p for binding to IzRE; transcription regulated by Zap1p, zinc, fatty acid levels; homolog of mammalian adiponectin receptor [Source:SGD;Acc:S000005362])

HSP 1 Score: 154.451 bits (389), Expect = 2.026e-43
Identity = 100/294 (34.01%), Postives = 161/294 (54.76%), Query Frame = 3
Query:  303 VGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLS----EKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMV---QVAHYRNQN 1163
            V +A++++  + S  W+      +P W +DNDF+L G+  + +SF   F S+F +H E+VNI++HL+  + F    +  L K   ++  +    + +V   F+ GA  CL  S +FH +  HS ++  + NKLDY GI +L V S +  L+Y ++       ++ ++    G  C  +SL D F    +R  RA +FV  GLS +IP    +    F   +    L W++L   LYI GA +Y +R PE+  PGKFDIW  SHQ+FH  VV+AA+ HL G++   ++ H + +N
Sbjct:   29 VAKAKKVLRRLYS--WD-----EIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGF--FTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKMEN 313          
BLAST of Adiponectin receptor protein vs. Ensembl Yeast
Match: IZH1 (Membrane protein involved in zinc ion homeostasis; member of the four-protein IZH family; transcription is regulated directly by Zap1p, expression induced by zinc deficiency and fatty acids; deletion increases sensitivity to elevated zinc; IZH1 has a paralog, IZH4, that arose from the whole genome duplication [Source:SGD;Acc:S000002900])

HSP 1 Score: 149.058 bits (375), Expect = 1.937e-41
Identity = 95/270 (35.19%), Postives = 135/270 (50.00%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVH-IHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAI----YFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A+R   + E +    +     ++H    LP W KDND +L G+  +  S+K C  S+F  + ETVNI+THL+  I + V AI    YFL         S+  V + F +GA  CL  S  FH +  HSEK    ++KLDY GI  L   S IP +++ ++ ++    ++TI+  VL   C    L D F T  FR  RA  F+  G SG++P        G         + ++   A  YI+GA IY  R+PE   PGKFD +  SHQI
Sbjct:   18 ATRASIKVEAVSGQTVFEKQKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQI 287          
BLAST of Adiponectin receptor protein vs. Ensembl Yeast
Match: IZH3 (Membrane protein involved in zinc ion homeostasis; member of the four-protein IZH family, expression induced by zinc deficiency; deletion reduces sensitivity to elevated zinc and shortens lag phase, overexpression reduces Zap1p activity [Source:SGD;Acc:S000004013])

HSP 1 Score: 78.5666 bits (192), Expect = 5.681e-16
Identity = 91/334 (27.25%), Postives = 140/334 (41.92%), Query Frame = 3
Query:   78 TKINESDNRFHKRSISHGPDLMKSAESVETLLNNGWSEKSDSKTNIVRQRKTHSHNRSASFGGKFSDFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRI---HTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSA------FFIGAILCLGFSWTFHTVHCHS-EKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAAL--YITGACIYALRVPERF 1043
            TKI E +N         GP + KS    E L+    +  +D K+ I     +++H ++ S               +G+ + L            H + LP   ++N +++ G+R   N+      SIF     H ET NIW+HLLG I  I LAIY    P SE+  + +V   A      F   A+ C+  S  +HT +  S  K+   F  +DY GIT+L   S +     + Y        Y  +   LG   + ++    F  P  R +R   F+ L   GV+   H I L   ++A   A+L   V   ++  Y+ G   Y   +PERF
Sbjct:  155 TKIKEENNYISSVKDYCGP-MRKSMVKTEILIEEPLNPTTDIKSFI----NSYNHGKAYS---------------LGETQHL------------HYYQLPFPWRENRYIIHGYR-FYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYDF--PQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLHYA---ATLFSPVTYKSVVWYLVGVVFYGSFIPERF 450          
BLAST of Adiponectin receptor protein vs. Ensembl Nematostella
Match: EDO36050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS3])

HSP 1 Score: 279.256 bits (713), Expect = 7.156e-91
Identity = 151/290 (52.07%), Postives = 197/290 (67.93%), Query Frame = 3
Query:  309 QAEELMINIIS---RGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMS-----EMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYR 1154
            +AE++   +I     GW  +    LP WL+DN+FL   HRP LNSFK+CF S+F+IHTET NIWTH +GF+AFI   +Y   +P+S         +EK+VF AFF GAILCLGFSW FHTV+CHS  V ++F++LDY GI LL +GS IP L+Y FYC+   + +Y  +I  +G + + +SL   F TP +R +RA VF+  G SGV+P  H++   G   A   AS+GW+ LM  LYI GA  YA R+PERFFPG+F+IWFQSHQIFHV VV AA VHL G+ Q+A+YR
Sbjct:    7 KAEKIRKRVIEAGRSGWYTLSHIELPHWLRDNEFLEDSHRPPLNSFKSCFKSMFKIHTETGNIWTHFIGFLAFIAAMLYMYIRPVSADNPFPKDWTEKLVFGAFFAGAILCLGFSWIFHTVYCHSANVSKVFSRLDYSGIALLIMGSFIPPLYYGFYCDTTTRNVYMGVIVSMGLLSVLVSLWSKFNTPKYRCLRAGVFLTFGCSGVVPAIHFVAAHGVAIAHRQASVGWMALMGLLYILGAIAYASRMPERFFPGRFNIWFQSHQIFHVLVVAAAAVHLYGICQMAYYR 296          
BLAST of Adiponectin receptor protein vs. Ensembl Nematostella
Match: EDO36051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS3])

HSP 1 Score: 279.256 bits (713), Expect = 7.156e-91
Identity = 151/290 (52.07%), Postives = 197/290 (67.93%), Query Frame = 3
Query:  309 QAEELMINIIS---RGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMS-----EMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYR 1154
            +AE++   +I     GW  +    LP WL+DN+FL   HRP LNSFK+CF S+F+IHTET NIWTH +GF+AFI   +Y   +P+S         +EK+VF AFF GAILCLGFSW FHTV+CHS  V ++F++LDY GI LL +GS IP L+Y FYC+   + +Y  +I  +G + + +SL   F TP +R +RA VF+  G SGV+P  H++   G   A   AS+GW+ LM  LYI GA  YA R+PERFFPG+F+IWFQSHQIFHV VV AA VHL G+ Q+A+YR
Sbjct:    7 KAEKIRKRVIEAGRSGWYTLSHIELPHWLRDNEFLEDSHRPPLNSFKSCFKSMFKIHTETGNIWTHFIGFLAFIAAMLYMYIRPVSADNPFPKDWTEKLVFGAFFAGAILCLGFSWIFHTVYCHSANVSKVFSRLDYSGIALLIMGSFIPPLYYGFYCDTTTRNVYMGVIVSMGLLSVLVSLWSKFNTPKYRCLRAGVFLTFGCSGVVPAIHFVAAHGVAIAHRQASVGWMALMGLLYILGAIAYASRMPERFFPGRFNIWFQSHQIFHVLVVAAAAVHLYGICQMAYYR 296          
BLAST of Adiponectin receptor protein vs. Ensembl Nematostella
Match: EDO36328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIY6])

HSP 1 Score: 130.568 bits (327), Expect = 3.617e-34
Identity = 80/248 (32.26%), Postives = 131/248 (52.82%), Query Frame = 3
Query:  351 NVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIY---FLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFY-HAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQ 1082
            N+   H +P +L+ N ++  G+R  L   + C  S+F    ET+NIWTHLLGF+ F  L +Y    +   +    +++ +VFSA  IG  +CL  S  +H  +CHSEK+   +  LD  GI+L      IP ++Y++YC++  Q +Y + + +L  I + +     F +  + + R  +F  L   GV+P  H+  L G +        +  +++M  L +     YAL+VPER+FPGK +    SHQ
Sbjct:   28 NLFDYHEIPYFLRGNVYVTNGYRAYL-PVRMCIKSLFVWSNETINIWTHLLGFLVFSFLFLYNNIVVLPHIKGATIADHMVFSALLIGFQICLLCSTGYHLFNCHSEKIFHRWFSLDLAGISLGLCSCYIPAVYYAYYCHVGLQTLYLVGVGILTTITLTLQFHPRFLSSVWATRRLLLFCCLVAYGVVPSVHWAYLSGGWDQPVVQIFIPKVIVMYVLGVLALVFYALKVPERYFPGKMNFIGSSHQ 274          
BLAST of Adiponectin receptor protein vs. Ensembl Nematostella
Match: EDO46359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQG1])

HSP 1 Score: 70.4774 bits (171), Expect = 2.590e-13
Identity = 67/266 (25.19%), Postives = 109/266 (40.98%), Query Frame = 3
Query:  297 RVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKL---DYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            R + + EE   N       +  +   P WL+ N F+L G+R    +   C  S+  +H E+VNI++H  G    +++ +  LT   S+  L     FS  +         S  +H   CH +     +N L   D CGI  +     +  +  + +C  + ++   I   ++  I +   L        F  +  F  +     GV     Y+     Y    + +L + VLM      G  I   RVPE++FPG+FDI   SHQI
Sbjct:   66 RALEKDEETKENACDLPPKLCSLQCCPSWLQFNKFVLTGYRCDY-TVSECLDSLLYVHNESVNIYSH--GIPCVLMMILIPLTA--SQACLESSFWFSLHYFACFAPFFSSPIYHLFMCHKQG-STAYNGLLTFDMCGIWAVNTFGALCGIRATLFCFPIWRMTALITYILISFISLYFILGARTPKERFVPLTVFGVMRYLFIGVRLFLRYL----GYGCGSDGALPYCVLMDLFACVGGVINIARVPEKWFPGQFDIIGNSHQI 321          
BLAST of Adiponectin receptor protein vs. Ensembl Nematostella
Match: EDO49851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REV2])

HSP 1 Score: 63.929 bits (154), Expect = 3.551e-11
Identity = 64/248 (25.81%), Postives = 106/248 (42.74%), Query Frame = 3
Query:  399 FLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFI--VLAIYFL-----TKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYT--IMISVLGAICMGISLMDYFATPNFRS----MRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASL-------GWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQ 1082
            F++ G+R    SFK C  S F  H ET+N+W+H+L  + F+   L ++ L     T P    LLS  +  SA F+        S + H  +C S KV  I    DY  I+  T  + + + +YS   N   +++ +  + + +  AI +  + +   +   +      +R   FV   L   +P     I       +C++ L        +       +   A    +R+PERF PG FD + QSH 
Sbjct:   33 FIVSGYRRPGFSFKQCIHSAFYAHNETINVWSHILALVGFLYHCLPVFCLRSNPFTDPFVYPLLSFSLGISAMFL-------MSSSAHLFNCMSAKVRHICFFFDYAAISTYTFTAGLVFYYYSRPTNTDLKLMNSNCLFLCISAAISLATTYLCCASRHKWVQHKFLLRTGTFVISWLFNTLPFTTRAI-------YCDSKLECNTVAFAYFKRQVFYFFLAALSNVIRIPERFIPGLFDFFGQSHH 266          
BLAST of Adiponectin receptor protein vs. Ensembl Medaka
Match: adipor1a (adiponectin receptor 1 [Source:NCBI gene;Acc:101170340])

HSP 1 Score: 307.76 bits (787), Expect = 9.986e-101
Identity = 159/290 (54.83%), Postives = 198/290 (68.28%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYR 1154
            A   + + EE +  +    W V+  H LP WLKDND+LL GHRP + SF+ACF SIFRIHTET NIWTHLLG I F+ L    + +P    +  L EKVVF  FF+GA+LCL FSW FHTV+CHSEKV R F+KLDY GI LL +GS +PWL+YSFYC+  P++IY  ++ VLG   + ++  D F+TP  R  RA VF+ LGLSG++P  H+ I EGF  A     +GW  LM A+YITGA +YA R+PERFFPGK DIWF SHQIFHV VV AA VH  G+  +  +R
Sbjct:   69 AHHAMEKMEEFVHKVWEGRWRVIPFHVLPEWLKDNDYLLHGHRPPMPSFRACFGSIFRIHTETGNIWTHLLGLILFVCLGTLTMLRPNIYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLTIVCVLGIAAIIVAQWDRFSTPRHRPTRAGVFMGLGLSGIVPTMHFTIEEGFVKATTVGQMGWFYLMGAMYITGAGLYAARIPERFFPGKCDIWFHSHQIFHVLVVAAAFVHFYGVSNLQEFR 358          
BLAST of Adiponectin receptor protein vs. Ensembl Medaka
Match: adipor2 (adiponectin receptor 2 [Source:NCBI gene;Acc:101161688])

HSP 1 Score: 290.812 bits (743), Expect = 4.465e-94
Identity = 146/267 (54.68%), Postives = 185/267 (69.29%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  +    W V+    LP WLKDNDFLL GHRP + SF+ACF SIFRIHTET NIWTHLLG + F+ L + ++ +P    +  + EKVV   FF+GAILCL FSW FHTV+CHSE V ++F+KLDY GI  L +GS +PWL+YSFYC      IY +++ VLG   + +S  D+F+TP +R +RA VFV LGLSGV+P  H++I EG   A     +GWL LMA LYITGAC+YA R+PERFFPGK DIWF SHQ+
Sbjct:   72 AHHAMEKMEEFVHKMWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCLFFLCLGLMYMFRPNMSFVAPVQEKVVIGVFFLGAILCLSFSWLFHTVYCHSEGVSKVFSKLDYSGIAFLIMGSFVPWLYYSFYCTPQSCFIYLMIVCVLGMAAIFVSQCDFFSTPQYRGVRAGVFVGLGLSGVVPTLHFVISEGLIKATTIGQIGWLFLMATLYITGACLYAARIPERFFPGKCDIWFHSHQL 338          
BLAST of Adiponectin receptor protein vs. Ensembl Medaka
Match: adipor2 (adiponectin receptor 2 [Source:NCBI gene;Acc:101161688])

HSP 1 Score: 290.812 bits (743), Expect = 4.465e-94
Identity = 146/267 (54.68%), Postives = 185/267 (69.29%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  +    W V+    LP WLKDNDFLL GHRP + SF+ACF SIFRIHTET NIWTHLLG + F+ L + ++ +P    +  + EKVV   FF+GAILCL FSW FHTV+CHSE V ++F+KLDY GI  L +GS +PWL+YSFYC      IY +++ VLG   + +S  D+F+TP +R +RA VFV LGLSGV+P  H++I EG   A     +GWL LMA LYITGAC+YA R+PERFFPGK DIWF SHQ+
Sbjct:   72 AHHAMEKMEEFVHKMWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCLFFLCLGLMYMFRPNMSFVAPVQEKVVIGVFFLGAILCLSFSWLFHTVYCHSEGVSKVFSKLDYSGIAFLIMGSFVPWLYYSFYCTPQSCFIYLMIVCVLGMAAIFVSQCDFFSTPQYRGVRAGVFVGLGLSGVVPTLHFVISEGLIKATTIGQIGWLFLMATLYITGACLYAARIPERFFPGKCDIWFHSHQL 338          
BLAST of Adiponectin receptor protein vs. Ensembl Medaka
Match: adipor2 (adiponectin receptor 2 [Source:NCBI gene;Acc:101161688])

HSP 1 Score: 289.271 bits (739), Expect = 6.624e-94
Identity = 146/267 (54.68%), Postives = 185/267 (69.29%), Query Frame = 3
Query:  291 ASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEML--LSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            A   + + EE +  +    W V+    LP WLKDNDFLL GHRP + SF+ACF SIFRIHTET NIWTHLLG + F+ L + ++ +P    +  + EKVV   FF+GAILCL FSW FHTV+CHSE V ++F+KLDY GI  L +GS +PWL+YSFYC      IY +++ VLG   + +S  D+F+TP +R +RA VFV LGLSGV+P  H++I EG   A     +GWL LMA LYITGAC+YA R+PERFFPGK DIWF SHQ+
Sbjct:   35 AHHAMEKMEEFVHKMWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCLFFLCLGLMYMFRPNMSFVAPVQEKVVIGVFFLGAILCLSFSWLFHTVYCHSEGVSKVFSKLDYSGIAFLIMGSFVPWLYYSFYCTPQSCFIYLMIVCVLGMAAIFVSQCDFFSTPQYRGVRAGVFVGLGLSGVVPTLHFVISEGLIKATTIGQIGWLFLMATLYITGACLYAARIPERFFPGKCDIWFHSHQL 301          
BLAST of Adiponectin receptor protein vs. Ensembl Medaka
Match: paqr3a (progestin and adipoQ receptor family member 3 [Source:NCBI gene;Acc:101161163])

HSP 1 Score: 101.679 bits (252), Expect = 1.531e-23
Identity = 75/259 (28.96%), Postives = 133/259 (51.35%), Query Frame = 3
Query:  333 IISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEK--VVFSAFFIGAILCLGFSWTFHTVHCH-SEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFY-----HAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            ++ RG  +     +P +L++N ++  G+R  L S + C  SIF +  ET NIW+HLLGF+ F  L +Y +   +  +  S +  V++        +C+  S  +H   CH SEK  R +  LDY G+++  +G  +P + Y+FYCN   + +Y + +  +        +   + +  ++ +R+  F  +   G++P  H+I + G +      AF    LG + L+AAL +     Y  +VPER+FPG+ +    SHQ+
Sbjct:   23 LVPRGIRLYTYEQIPAFLRENPYITDGYRAYLPS-RLCVKSIFILSNETGNIWSHLLGFLLFFCLGVYNMASVLPAVGASREDYVIYGIGLFCFQVCMLCSVGYHMFCCHRSEKTSRRWMALDYAGVSIGVLGCYVPGVFYTFYCNDYWRQVYLVTVLAMILAVFFAQIHPQYLSTAWKRLRSLTFGLVAGYGLVPTVHWICITGGFSSELVQAFVPRVLG-MYLIAALALV---FYVSKVPERYFPGQLNYLGSSHQV 276          
BLAST of Adiponectin receptor protein vs. Planmine SMEST
Match: SMESG000011535.1 (SMESG000011535.1)

HSP 1 Score: 780.4 bits (2014), Expect = 0.000e+0
Identity = 390/391 (99.74%), Postives = 391/391 (100.00%), Query Frame = 3
Query:   24 MTSRTSHIETKFDILNSPTKINESDNRFHKRSISHGPDLMKSAESVETLLNNGWSEKSDSKTNIVRQRKTHSHNRSASFGGKFSDFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHCIASTSVLQ 1196
            MTSRTS+IETKFDILNSPTKINESDNRFHKRSISHGPDLMKSAESVETLLNNGWSEKSDSKTNIVRQRKTHSHNRSASFGGKFSDFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIFHVFVVVAAVVHLIGMVQVAHYRNQNKHCIASTSVLQ
Sbjct:    1 MTSRTSYIETKFDILNSPTKINESDNRFHKRSISHGPDLMKSAESVETLLNNGWSEKSDSKTNIVRQRKTHSHNRSASFGGKFSDFSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIFHVFVVVAAVVHLIGMVQVAHYRNQNKHCIASTSVLQ 391          
BLAST of Adiponectin receptor protein vs. Planmine SMEST
Match: SMESG000005140.1 (SMESG000005140.1)

HSP 1 Score: 350.517 bits (898), Expect = 3.463e-117
Identity = 173/304 (56.91%), Postives = 225/304 (74.01%), Query Frame = 3
Query:  279 FSEAASRVVGQAEELMINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQIXXXXXXXXXXXXLIGMVQVAHYRNQNKHCIASTSV 1190
            F + A+ ++   E+ +  +  RGW +V    LP WLKDN+FL+  HRP+L S++ CF SIFR+HTETVNIWTHLLG++ F+ +A+  L +P   +   +K V   FF+GAILCLGFSW FHTV+CHS++VG+IFNKLDYCGI  LTVGS IPWL+YSFYC L+P+++Y  +I VLG+  + +S+ D FATP +R +RA VF+ALGL GV+PC HYII+EGF+ A   +S+GWL LMA LYITGA IYA R+PER  PG+FDI FQSHQIFHVFVVVAA+VH  G++ +  YR  N  C  S  +
Sbjct:   80 FQQMAALLMQGTEDFIRKVWRRGWGLVQHQHLPAWLKDNNFLVRSHRPELKSYRKCFKSIFRVHTETVNIWTHLLGWLGFLAIAVVILCQPADHLPWQDKAVIMCFFLGAILCLGFSWLFHTVYCHSQRVGKIFNKLDYCGIAFLTVGSFIPWLYYSFYCRLIPKLVYCSLIIVLGSFALIVSMFDKFATPPYRPLRAGVFIALGLCGVVPCLHYIIVEGFWSAIHQSSVGWLSLMALLYITGAVIYAARIPERILPGRFDIIFQSHQIFHVFVVVAALVHYYGIILITGYRLTNGDCSESVVI 383          
BLAST of Adiponectin receptor protein vs. Planmine SMEST
Match: SMESG000021251.1 (SMESG000021251.1)

HSP 1 Score: 116.316 bits (290), Expect = 5.306e-29
Identity = 76/247 (30.77%), Postives = 127/247 (51.42%), Query Frame = 3
Query:  369 SLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIY--FLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAF-----VFVALGLSGVIPCAHYIIL-EGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 1085
            S+P +LK N F+  G+R    + K C  SIF+   E+VNIWTHL+GFI FI   I    +  P+     ++ ++ S   +  I+C+  S  +H   CHSE + + +  +D  GI +  +G  +P +++++YC    Q  Y         + + IS++ +  +P +R   +F     +F+ L + GV+P  H+I L  GF     +  L  ++ +  L       Y  ++PERF+PG+FD    SHQI
Sbjct:   25 SIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHLIGFIIFIYYLIVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFF-----TLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQI 265          
BLAST of Adiponectin receptor protein vs. Planmine SMEST
Match: SMESG000021251.1 (SMESG000021251.1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.874e-16
Identity = 50/151 (33.11%), Postives = 85/151 (56.29%), Query Frame = 3
Query:  369 SLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIY--FLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYC-NLLPQIIYTIMISVLGAI 812
            S+P +LK N F+  G+R    + K C  SIF+   E+VNIWTHL+GFI FI   I    +  P+     ++ ++ S   +  I+C+  S  +H   CHSE + + +  +D  GI +  +G  +P +++++YC ++  Q +  I + VLGA+
Sbjct:   25 SIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHLIGFIIFIYYLIVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSIFLQRV--IRLYVLGAL 172          
The following BLAST results are available for this feature:
BLAST of Adiponectin receptor protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADIPOR22.145e-10548.45adiponectin receptor 2 [Source:HGNC Symbol;Acc:HGN... [more]
ADIPOR22.145e-10548.45adiponectin receptor 2 [Source:HGNC Symbol;Acc:HGN... [more]
ADIPOR16.247e-9856.93adiponectin receptor 1 [Source:HGNC Symbol;Acc:HGN... [more]
ADIPOR11.035e-6053.89adiponectin receptor 1 [Source:HGNC Symbol;Acc:HGN... [more]
ADIPOR16.001e-3855.64adiponectin receptor 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
paqr-14.949e-9246.15Progestin and adipoQ receptor-like protein 1 [Sou... [more]
paqr-14.949e-9246.15Progestin and adipoQ receptor-like protein 1 [Sou... [more]
paqr-14.949e-9246.15Progestin and adipoQ receptor-like protein 1 [Sou... [more]
paqr-22.045e-9152.03Progestin and AdipoQ Receptor family [Source:UniP... [more]
paqr-13.997e-9049.85Progestin and adipoQ receptor-like protein 1 [Sou... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AdipoR4.363e-11456.86gene:FBgn0038984 transcript:FBtr0084284[more]
AdipoR9.426e-11456.86gene:FBgn0038984 transcript:FBtr0308848[more]
AdipoR9.426e-11456.86gene:FBgn0038984 transcript:FBtr0084282[more]
AdipoR9.426e-11456.86gene:FBgn0038984 transcript:FBtr0084283[more]
AdipoR9.426e-11456.86gene:FBgn0038984 transcript:FBtr0334561[more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adipor21.985e-9753.31adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adipor21.985e-9753.31adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adipor1b6.063e-9655.43adiponectin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
adipor1a7.453e-9555.06adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
adipor1a7.453e-9555.06adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adipor11.211e-10355.17adiponectin receptor 1 [Source:NCBI gene;Acc:49330... [more]
atg4a2.140e-2230.74autophagy related 4A cysteine peptidase [Source:Xe... [more]
rec81.676e-828.69REC8 meiotic recombination protein [Source:Xenbase... [more]
hspa1l3.359e-725.59heat shock protein family A (Hsp70) member 1 like ... [more]
PAQR94.094e-724.63progestin and adipoQ receptor family member IX [So... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adipor22.014e-10552.88adiponectin receptor 2 [Source:MGI Symbol;Acc:MGI:... [more]
Adipor22.014e-10552.88adiponectin receptor 2 [Source:MGI Symbol;Acc:MGI:... [more]
Adipor13.103e-9856.93adiponectin receptor 1 [Source:MGI Symbol;Acc:MGI:... [more]
Adipor13.103e-9856.93adiponectin receptor 1 [Source:MGI Symbol;Acc:MGI:... [more]
Paqr31.130e-2330.98progestin and adipoQ receptor family member III [S... [more]
back to top
BLAST of Adiponectin receptor protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VCY8|ADRL_DROME9.449e-11356.86Adiponectin receptor protein OS=Drosophila melanog... [more]
sp|Q86V24|PAQR2_HUMAN1.030e-10448.45Adiponectin receptor protein 2 OS=Homo sapiens OX=... [more]
sp|Q8BQS5|PAQR2_MOUSE1.409e-10452.88Adiponectin receptor protein 2 OS=Mus musculus OX=... [more]
sp|Q91VH1|PAQR1_MOUSE2.171e-9756.93Adiponectin receptor protein 1 OS=Mus musculus OX=... [more]
sp|Q96A54|PAQR1_HUMAN3.000e-9756.93Adiponectin receptor protein 1 OS=Homo sapiens OX=... [more]
back to top
BLAST of Adiponectin receptor protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EQ283.114e-13161.33Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8G4733.576e-13161.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2T7NUS71.634e-13065.77Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1I8G9P38.319e-12964.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210Q0U61.645e-12864.90ADIPOR-like receptor OS=Mizuhopecten yessoensis OX... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adipor29.788e-9956.55adiponectin receptor 2 [Source:NCBI gene;Acc:10303... [more]
adipor1b7.348e-9654.83adiponectin receptor 1 [Source:NCBI gene;Acc:10302... [more]
adipor1a3.979e-6747.59adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
adipor1a2.120e-6646.08adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
adipor1a1.447e-6546.07adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adipor1b9.282e-10348.13adiponectin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
adipor29.413e-10056.88adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
paqr3b6.958e-2229.69progestin and adipoQ receptor family member IIIb [... [more]
ENSPMAT00000003422.11.141e-1328.10pep scaffold:Pmarinus_7.0:GL479692:543133:563138:1... [more]
paqr5a1.613e-1125.00progestin and adipoQ receptor family member Va [So... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
IZH22.026e-4334.01Plasma membrane receptor for plant antifungal osmo... [more]
IZH11.937e-4135.19Membrane protein involved in zinc ion homeostasis;... [more]
IZH35.681e-1627.25Membrane protein involved in zinc ion homeostasis;... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360507.156e-9152.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360517.156e-9152.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363283.617e-3432.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463592.590e-1325.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498513.551e-1125.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adipor1a9.986e-10154.83adiponectin receptor 1 [Source:NCBI gene;Acc:10117... [more]
adipor24.465e-9454.68adiponectin receptor 2 [Source:NCBI gene;Acc:10116... [more]
adipor24.465e-9454.68adiponectin receptor 2 [Source:NCBI gene;Acc:10116... [more]
adipor26.624e-9454.68adiponectin receptor 2 [Source:NCBI gene;Acc:10116... [more]
paqr3a1.531e-2328.96progestin and adipoQ receptor family member 3 [Sou... [more]
back to top
BLAST of Adiponectin receptor protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000011535.10.000e+099.74SMESG000011535.1[more]
SMESG000005140.13.463e-11756.91SMESG000005140.1[more]
SMESG000021251.15.306e-2930.77SMESG000021251.1[more]
SMESG000021251.11.874e-1633.11SMESG000021251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028925 ID=SMED30028925|Name=Adiponectin receptor protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1490bp
TCTATATAAATCTTATATGAAATATGACTTCTAGAACATCGCATATAGAA
ACAAAATTTGACATTCTAAATTCACCTACCAAAATTAATGAATCTGATAA
TCGTTTCCATAAAAGATCAATAAGCCATGGTCCAGATTTAATGAAATCTG
CAGAATCAGTTGAAACTTTGTTAAACAATGGATGGTCGGAAAAATCTGAT
TCAAAAACCAACATTGTTCGACAGAGGAAAACCCACTCTCATAATAGATC
AGCAAGTTTTGGAGGCAAATTTTCAGATTTTAGTGAAGCTGCATCACGTG
TCGTTGGTCAAGCGGAAGAATTAATGATAAACATCATTAGTCGAGGTTGG
AATGTTGTACATATTCACAGTTTACCGGGGTGGTTAAAGGATAATGATTT
CTTATTATGGGGTCATCGACCACAGTTGAATTCATTTAAAGCTTGTTTCA
GTTCTATTTTTAGAATTCACACGGAAACAGTCAACATTTGGACACATCTA
TTGGGATTTATTGCATTTATTGTCTTGGCAATTTATTTCTTAACAAAGCC
AATGAGTGAAATGCTACTATCAGAAAAGGTTGTGTTTTCTGCGTTCTTTA
TTGGAGCAATCTTATGCTTAGGGTTTTCGTGGACTTTTCATACAGTACAT
TGCCATTCAGAAAAAGTTGGAAGGATATTCAATAAGCTCGATTATTGTGG
TATTACTCTTTTAACAGTCGGATCAACTATTCCCTGGCTTCATTATTCCT
TCTATTGTAATCTTTTACCACAAATTATCTACACAATTATGATATCGGTT
CTGGGGGCTATTTGTATGGGGATTTCGCTTATGGACTATTTCGCTACACC
GAATTTTCGATCAATGCGAGCATTTGTTTTTGTGGCTTTGGGTTTAAGCG
GTGTTATTCCATGTGCTCATTATATCATTCTCGAAGGGTTTTATCATGCG
TTTTGCAACGCTTCTCTGGGTTGGCTAGTTTTAATGGCAGCACTTTATAT
CACTGGTGCTTGTATATATGCTCTTAGAGTGCCTGAAAGGTTCTTTCCAG
GGAAATTCGATATTTGGTTTCAAAGTCATCAAATCTTTCATGTGTTCGTC
GTAGTGGCAGCGGTGGTGCATCTTATTGGAATGGTTCAAGTTGCACATTA
TCGCAATCAGAACAAACATTGTATTGCTTCGACGTCCGTCCTACAATGAT
CAACTATTTCTCATTTGGGTGTGTGTGTGATGTGCATAGATAAATAAATT
GAAATTCGCCATCTTTCTCTATTTAGTTCAATATTTCGACGCGTTAAACT
TATATTTTTAATTGATTTGTATTTTTTCGATTTCAAAATAGAAAACTTAT
AATTTCGACCATTCTTTTCCAATCAGTGTTGATCAGTGCCTATCCTTGAG
CTGTAGAGAATTTTTTTAGAAGTGCTAAAATGTGAAATTATTCTCGAATT
TTCTCCCATTGAAAGATAATAAAATTTTGAAATAAAATCT
back to top

protein sequence of SMED30028925-orf-1

>SMED30028925-orf-1 ID=SMED30028925-orf-1|Name=SMED30028925-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=392bp
MTSRTSHIETKFDILNSPTKINESDNRFHKRSISHGPDLMKSAESVETLL
NNGWSEKSDSKTNIVRQRKTHSHNRSASFGGKFSDFSEAASRVVGQAEEL
MINIISRGWNVVHIHSLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHT
ETVNIWTHLLGFIAFIVLAIYFLTKPMSEMLLSEKVVFSAFFIGAILCLG
FSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQ
IIYTIMISVLGAICMGISLMDYFATPNFRSMRAFVFVALGLSGVIPCAHY
IILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQ
SHQIFHVFVVVAAVVHLIGMVQVAHYRNQNKHCIASTSVLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004254AdipoR/HlyIII-related
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane