Photolyase/cryptochrome alpha/beta domain-containing protein

Overview
NamePhotolyase/cryptochrome alpha/beta domain-containing protein
Smed IDSMED30028914
Length (bp)2951
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Photolyase/cryptochrome alpha/beta domain-containing protein (SMED30028914) t-SNE clustered cells

Violin plots show distribution of expression levels for Photolyase/cryptochrome alpha/beta domain-containing protein (SMED30028914) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Photolyase/cryptochrome alpha/beta domain-containing protein (SMED30028914) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Photolyase/cryptochrome alpha/beta domain-containing protein (SMED30028914) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028914

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028914SMESG000003495.1 SmedASXL_018404SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028914SMESG000003495.1 SmedASXL_018404SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30028914SMESG000003495.1 dd_Smed_v4_2829_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30028914SMESG000003495.1 dd_Smed_v4_2829_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028914SMESG000003495.1 SMED_30932_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30028914SMESG000003495.1 SMED_30932_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Fly
Match: phr (gene:FBgn0003082 transcript:FBtr0088839)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 280/529 (52.93%), Postives = 361/529 (68.24%), Query Frame = 3
Query:   81 MKRKRTNKPTTDTTSPKSVKRSKTILTNQSASTSTENFFTRNLKTE-NKMEFDSFTKNIECKR--KEYFIGSYLFNNKRIKTIRGSEESVTNS-KSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGDLP--EPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTY 1649
            MKR +  K      + K+ K S    ++Q +S    +     L ++ +   F+ F  ++E +R      I  + F  KR++ +  +E+   +S   V+YWMSRD RV DNWA  +AQ+L+LK +    V FCLVPKFL+ATIRHY F++ GLQEVE++CR L+I FHLL+G+A E++P+FV+  +I  VV DF PLR+P QW++DV   LPK + + QVDAHNVVP+W AS K E AARTIR+KIN KL E+L+ FPPV++HP           DW  A  SL  DM V EV    PGY+A  + L++F  S+RL++FN  RNDPT   LS +SPWLHFG ISAQRC LE    +   K   D F EE++VRRELADNFC+YN HYDSL G ++WA +TL+ HR D+R   Y++E+L+   T+D LWN+AQLQ+VREGKMHGFLRMYWAKKILEWT   P  AL+ AI LND+YS+DGRDPNGY G MWSI GVHD GW ERA+FGK+RYMNY+GC+RKFDV  F   Y
Sbjct:    1 MKRTKAQKAGPSKKAAKNEKASSEPKSDQESSDEEASTSKALLVSKPDYQNFEQFLTHLEHQRVCTAANIQEFSFRKKRVRVLSKTEDVKESSLGGVVYWMSRDGRVQDNWALLFAQRLALKLELPLTVVFCLVPKFLNATIRHYKFMMGGLQEVEQQCRALDIPFHLLMGSAVEKLPQFVKSKDIGAVVCDFAPLRLPRQWVEDVGKALPKSVPLVQVDAHNVVPLWVASDKQEYAARTIRNKINSKLGEYLSVFPPVVRHPHGTGCKNVNTVDWSAAYASLQCDMEVDEVQWAKPGYKAACQQLYEFC-SRRLRHFNDKRNDPTADALSGLSPWLHFGHISAQRCALEVQRFRGQHKASADAFCEEAIVRRELADNFCFYNEHYDSLKGLSSWAYQTLDAHRKDKRDPCYSLEELEKSLTYDDLWNSAQLQLVREGKMHGFLRMYWAKKILEWTAT-PEHALEYAILLNDKYSLDGRDPNGYVGCMWSIGGVHDMGWKERAIFGKVRYMNYQGCRRKFDVNAFVMRY 527          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Fly
Match: phr (gene:FBgn0003082 transcript:FBtr0088838)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 280/525 (53.33%), Postives = 361/525 (68.76%), Query Frame = 3
Query:   90 KRTNKPTTDTTSPKSVKRSKTILTNQSASTSTENFFTRNLKTENKMEFDSFTKNIECKR--KEYFIGSYLFNNKRIKTIRGSEESVTNS-KSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGDLP--EPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTY 1649
            K+  K    ++ PKS + S    +++ ASTS     ++     +   F+ F  ++E +R      I  + F  KR++ +  +E+   +S   V+YWMSRD RV DNWA  +AQ+L+LK +    V FCLVPKFL+ATIRHY F++ GLQEVE++CR L+I FHLL+G+A E++P+FV+  +I  VV DF PLR+P QW++DV   LPK + + QVDAHNVVP+W AS K E AARTIR+KIN KL E+L+ FPPV++HP           DW  A  SL  DM V EV    PGY+A  + L++F  S+RL++FN  RNDPT   LS +SPWLHFG ISAQRC LE    +   K   D F EE++VRRELADNFC+YN HYDSL G ++WA +TL+ HR D+R   Y++E+L+   T+D LWN+AQLQ+VREGKMHGFLRMYWAKKILEWT   P  AL+ AI LND+YS+DGRDPNGY G MWSI GVHD GW ERA+FGK+RYMNY+GC+RKFDV  F   Y
Sbjct:   33 KKAAKNEKASSEPKSDQES----SDEEASTSKALLVSK----PDYQNFEQFLTHLEHQRVCTAANIQEFSFRKKRVRVLSKTEDVKESSLGGVVYWMSRDGRVQDNWALLFAQRLALKLELPLTVVFCLVPKFLNATIRHYKFMMGGLQEVEQQCRALDIPFHLLMGSAVEKLPQFVKSKDIGAVVCDFAPLRLPRQWVEDVGKALPKSVPLVQVDAHNVVPLWVASDKQEYAARTIRNKINSKLGEYLSVFPPVVRHPHGTGCKNVNTVDWSAAYASLQCDMEVDEVQWAKPGYKAACQQLYEFC-SRRLRHFNDKRNDPTADALSGLSPWLHFGHISAQRCALEVQRFRGQHKASADAFCEEAIVRRELADNFCFYNEHYDSLKGLSSWAYQTLDAHRKDKRDPCYSLEELEKSLTYDDLWNSAQLQLVREGKMHGFLRMYWAKKILEWTAT-PEHALEYAILLNDKYSLDGRDPNGYVGCMWSIGGVHDMGWKERAIFGKVRYMNYQGCRRKFDVNAFVMRY 547          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Fly
Match: CG18853 (gene:FBgn0042173 transcript:FBtr0089426)

HSP 1 Score: 226.868 bits (577), Expect = 1.915e-66
Identity = 104/154 (67.53%), Postives = 124/154 (80.52%), Query Frame = 3
Query: 1188 ADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTY 1649
            ADNFC+YN HYDSL G ++WA +TL+ HR D+R   Y++E+L+   T+D LWN+AQLQ+VREGKMHGFLRMYWAKKILEWT   P  AL+ AI LND+YS+DGRDPNGY G MWSI GVHD GW ERA+FGK+RYMNY+GC+RKFDV  F   Y
Sbjct:  170 ADNFCFYNEHYDSLKGLSSWAYQTLDAHRKDKRDPCYSLEELEKSLTYDDLWNSAQLQLVREGKMHGFLRMYWAKKILEWTAT-PEHALEYAILLNDKYSLDGRDPNGYVGCMWSIGGVHDMGWKERAIFGKVRYMNYQGCRRKFDVNAFVMRY 322          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Zebrafish
Match: cpdp (CPD photolyase [Source:ZFIN;Acc:ZDB-GENE-040426-1644])

HSP 1 Score: 531.561 bits (1368), Expect = 2.867e-179
Identity = 261/453 (57.62%), Postives = 317/453 (69.98%), Query Frame = 3
Query:  294 FNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGD-LPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTY 1649
            FN KR++ +  +++   +S+ VLYWMSRDQR+ DNWA  Y+Q+L+L  K   H+CFCLVPKFLDAT R Y F+L+GLQEV KEC+ L+I FHLL G     +P FV+  NI  VV DF PLR+ LQWI  V   LP DI   QVDAHNVVP W+AS KLE  ARTIR KI   L EFLT+ P V  HP       +  DWE    SL+VD  V EV    PG   GM  L  FI  +RL  F  HRN+P    +S++SPW+H GQ+SAQR +++   +K  A E V  FIEE +VRRELADNFC+YN +YD++SG  +WA++TL+ H  D R Y YT ++L+S +THD LWNAAQ Q++ EGKMHGFLRMYWAKKILEWT   P EAL  AI+LNDR S+DG DPNGY G MWSICG+HDQGWAER +FGKIRYMNY GC+RKFDV+ FE  Y
Sbjct:   52 FNKKRLRYLSDTQKVKQSSQGVLYWMSRDQRIQDNWALIYSQQLALAEKLPLHICFCLVPKFLDATYRQYAFMLKGLQEVVKECKSLDIEFHLLSGEPVHNLPAFVKSWNIGAVVTDFNPLRISLQWIDTVKKHLPSDIPFIQVDAHNVVPCWEASTKLEYGARTIRGKITKHLQEFLTDMPLVDTHPYCASRAAKIIDWEEVLSSLEVDHNVCEVEWAQPGTTGGMFMLESFI-DQRLHIFATHRNNPNSDAVSHLSPWIHAGQLSAQRVVMQV-KRKKNASESVASFIEEIVVRRELADNFCFYNQNYDNISGAYDWAKKTLQEHAKDRRQYLYTKKELESAETHDQLWNAAQRQLLLEGKMHGFLRMYWAKKILEWT-ASPEEALSIAIYLNDRLSLDGCDPNGYVGCMWSICGIHDQGWAERPIFGKIRYMNYAGCKRKFDVEQFERKY 501          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Zebrafish
Match: cpdp (CPD photolyase [Source:ZFIN;Acc:ZDB-GENE-040426-1644])

HSP 1 Score: 531.561 bits (1368), Expect = 3.707e-179
Identity = 261/453 (57.62%), Postives = 317/453 (69.98%), Query Frame = 3
Query:  294 FNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGD-LPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTY 1649
            FN KR++ +  +++   +S+ VLYWMSRDQR+ DNWA  Y+Q+L+L  K   H+CFCLVPKFLDAT R Y F+L+GLQEV KEC+ L+I FHLL G     +P FV+  NI  VV DF PLR+ LQWI  V   LP DI   QVDAHNVVP W+AS KLE  ARTIR KI   L EFLT+ P V  HP       +  DWE    SL+VD  V EV    PG   GM  L  FI  +RL  F  HRN+P    +S++SPW+H GQ+SAQR +++   +K  A E V  FIEE +VRRELADNFC+YN +YD++SG  +WA++TL+ H  D R Y YT ++L+S +THD LWNAAQ Q++ EGKMHGFLRMYWAKKILEWT   P EAL  AI+LNDR S+DG DPNGY G MWSICG+HDQGWAER +FGKIRYMNY GC+RKFDV+ FE  Y
Sbjct:   62 FNKKRLRYLSDTQKVKQSSQGVLYWMSRDQRIQDNWALIYSQQLALAEKLPLHICFCLVPKFLDATYRQYAFMLKGLQEVVKECKSLDIEFHLLSGEPVHNLPAFVKSWNIGAVVTDFNPLRISLQWIDTVKKHLPSDIPFIQVDAHNVVPCWEASTKLEYGARTIRGKITKHLQEFLTDMPLVDTHPYCASRAAKIIDWEEVLSSLEVDHNVCEVEWAQPGTTGGMFMLESFI-DQRLHIFATHRNNPNSDAVSHLSPWIHAGQLSAQRVVMQV-KRKKNASESVASFIEEIVVRRELADNFCFYNQNYDNISGAYDWAKKTLQEHAKDRRQYLYTKKELESAETHDQLWNAAQRQLLLEGKMHGFLRMYWAKKILEWT-ASPEEALSIAIYLNDRLSLDGCDPNGYVGCMWSICGIHDQGWAERPIFGKIRYMNYAGCKRKFDVEQFERKY 511          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Xenopus
Match: engase (endo-beta-N-acetylglucosaminidase [Source:Xenbase;Acc:XB-GENE-981873])

HSP 1 Score: 318.161 bits (814), Expect = 1.870e-100
Identity = 156/274 (56.93%), Postives = 201/274 (73.36%), Query Frame = 3
Query:  540 ECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGDL-PEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQL 1358
            EC++LNI FHLL+G AK+ +P FV+K+ I  VV DF PLRVPLQW++DVS  LPKD+ + QVDAHN+VP W AS K E  ARTIR KI+ +L++FLTEFPPVIKHP    L  EP DW+    SL+VD T+ EV    PG  AG   L  FI S+RL++FN  RN+P ++ LSN+SPW HFGQ+S QR ILE    +S  K+ VD F+EE++VRRELADNFC+YN +YD + G  +WA+ TL+ H  D+R + YT+E+L++GKTHD LWNAAQ+
Sbjct:    1 ECKELNIPFHLLIGYAKDILPNFVKKHAIGGVVTDFSPLRVPLQWVEDVSKRLPKDVPLVQVDAHNIVPCWVASNKQEYGARTIRKKIHDQLSQFLTEFPPVIKHPYEPKLEAEPVDWDNCYNSLEVDRTIGEVEWAKPGTNAGFNVLQSFI-SERLRHFNSDRNNPNQNALSNLSPWFHFGQLSVQRAILEVQKYRSKCKDSVDSFVEEAVVRRELADNFCFYNKNYDKIEGAYDWAKNTLKDHAKDKRTHLYTLEKLEAGKTHDPLWNAAQV 273          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000046952.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:108996576:108999205:1 gene:ENSXETG00000020216.1 transcript:ENSXETT00000046952.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 2.408e-29
Identity = 48/85 (56.47%), Postives = 64/85 (75.29%), Query Frame = 3
Query:  279 IGSYLFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEV 533
            +  + FN KR++ +    +   +++ ++YWMSRDQRV DNWAF YAQ+L+LK K   HV FCLVPKFLDATIRHY F+++GLQEV
Sbjct:   16 VSEFKFNKKRVRLVSTEADLKDDAQGIVYWMSRDQRVQDNWAFLYAQRLALKQKLPLHVTFCLVPKFLDATIRHYGFMVKGLQEV 100          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. UniProt/SwissProt
Match: sp|Q28811|PHR_POTTR (Deoxyribodipyrimidine photo-lyase OS=Potorous tridactylus OX=9310 GN=PHR PE=2 SV=1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 267/452 (59.07%), Postives = 326/452 (72.12%), Query Frame = 3
Query:  288 YLFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGDL-PEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFE 1640
            + FN +R++ I         S++ +YWMSRDQRV DNWAF YAQ+L+LK K   HVCFCL P FL ATIRHYDF+LRGL+EV +EC +L I FHLLLG  K+ +P FV+ + I  +V DF PL    QW+KDV D LP+ +   QVDAHN+VP W AS K E  ARTIR KI+ +L  FLTEFPPVI HP + ++  EP DW   R  L VD +VKEV    PG  +G+  L  FI ++RL  F   RN+P K  LSN+SPW HFGQ+S QR ILE    +S   + V  F+EE++VRRELADNFC+YN +YD L G  +WA+ TL +H  D+RP+ Y++EQL+SGKTHD LWNAAQ+Q V+EGKMHGFLRMYWAKKILEWT   P EAL+ AI+LNDR+ +DG DPNGY G MWSICG+HDQGWAER +FGKIRYMNY GC+RKFDV  FE
Sbjct:   76 FRFNKQRVRLISQDCHLQDQSQAFVYWMSRDQRVQDNWAFLYAQRLALKQKLPLHVCFCLAPCFLGATIRHYDFMLRGLEEVAEECEKLCIPFHLLLGLPKDVLPAFVQTHGIGGIVTDFSPLLHHTQWVKDVQDALPRQVPFVQVDAHNIVPCWVASDKQEYGARTIRHKIHDRLPHFLTEFPPVICHPYTSNVQAEPVDWNGCRAGLQVDRSVKEVSWAKPGTASGLTMLQSFI-AERLPYFGSDRNNPNKDALSNLSPWFHFGQVSVQRAILEVQKHRSRYPDSVTNFVEEAVVRRELADNFCFYNKNYDKLEGAYDWAQTTLRLHAKDKRPHLYSLEQLESGKTHDPLWNAAQMQTVKEGKMHGFLRMYWAKKILEWT-RSPEEALEFAIYLNDRFQLDGWDPNGYVGCMWSICGIHDQGWAEREIFGKIRYMNYAGCKRKFDVAEFE 525          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. UniProt/SwissProt
Match: sp|P34205|PHR_CARAU (Deoxyribodipyrimidine photo-lyase OS=Carassius auratus OX=7957 GN=phr PE=2 SV=1)

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 267/456 (58.55%), Postives = 319/456 (69.96%), Query Frame = 3
Query:  297 NNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGD-LPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTYRQSK 1661
            N KR++ +  +++    S   LYWMSRDQRV DNWA  YAQ+L+L  K   H+CFCLVP++LDAT R Y F+L+GLQEV KEC+ L+I FHLL G   + +P FVEK     VV DF PLR+PLQWI+ V   LP D+   QVDAHNVVP W+AS KLE  ARTIR KI   L EFLTE P V  HP S     EP DWE    SL+V+ +V EV    PG   GM  L  FI  +RL+ F  HRN+P    LS++SPW+H GQ+SAQR + +   +K+ A E V  FIEE +VRRELADNFC+YNP YD++SG  +WA++TL+ H  D R Y YT EQL++ KTHD LWNAAQ Q+V EGKMHGFLRMYWAKKILEWT   P EAL  AI+LNDR S+DG DPNGY G MWSICG+HDQGWAER +FGKIR+MNY GC+RKFDV  FE  Y   K
Sbjct:   90 NKKRLRYLSDTQKIKQGSDGFLYWMSRDQRVQDNWALIYAQQLALAEKLPLHICFCLVPRYLDATYRQYAFMLKGLQEVAKECKSLDIQFHLLSGEPGQNLPSFVEKWKFGAVVTDFNPLRIPLQWIETVKKHLPADVPFIQVDAHNVVPCWEASGKLEYGARTIRGKITKLLPEFLTEIPLVDTHPHSASRAAEPVDWEEVLSSLEVERSVGEVDWAQPGTSGGMNMLESFI-DQRLRLFATHRNNPNYDALSHLSPWIHTGQLSAQRVVKQVKREKN-ASESVASFIEELVVRRELADNFCFYNPSYDNISGAYDWAKKTLQDHAKDSRQYLYTKEQLENAKTHDQLWNAAQRQLVSEGKMHGFLRMYWAKKILEWT-ASPEEALSIAIYLNDRLSLDGCDPNGYVGCMWSICGIHDQGWAERPIFGKIRFMNYAGCKRKFDVAQFERKYTAVK 542          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9SB00|PHR_ARATH (Deoxyribodipyrimidine photo-lyase OS=Arabidopsis thaliana OX=3702 GN=PHR1 PE=2 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 2.966e-142
Identity = 229/438 (52.28%), Postives = 296/438 (67.58%), Query Frame = 3
Query:  357 VLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPK---SGDLPEP-TDWE-LARKSLDVDMTVKEVVEFIPGYQAGMENLW---KFIYSKRLKNFNLHRNDPTK-SCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFES 1643
            V+YWM RDQR+ DNWA  +A  L+ +  +   V F L  +FLDA  R   F+L+GL+++  +   L I F LL G AKE IP F+ +   S +V DF PLR   +   +V       + I +VDAHNVVP+W AS KLE +ARTIR KIN  L ++L EFP  ++ PK   +G + +   DW+ L  K +     V E+   +PG  AG+E L        +KRLKN++  RN+P K   LS +SP+LHFGQ+SAQRC LEA   +ST+ + VD F+EE +VRREL+DNFCYY PHYDSL G   WAR++L  H  D+R + Y++EQL+ G T D LWNA+QL+MV +GKMHGF+RMYWAKKILEWT +GP EAL  +I+LN++Y IDGRDP+GY G MWSICGVHDQGW ER VFGKIRYMNY GC+RKF+V  + S
Sbjct:   30 VVYWMFRDQRLKDNWALIHAVDLANRTNAPVAVVFNLFDQFLDAKARQLGFMLKGLRQLHHQIDSLQIPFFLLQGDAKETIPNFLTECGASHLVTDFSPLREIRRCKDEVVKRTSDSLAIHEVDAHNVVPMWAASSKLEYSARTIRGKINKLLPDYLIEFPK-LEPPKKKWTGMMDKKLVDWDSLIDKVVREGAEVPEIEWCVPGEDAGIEVLMGNKDGFLTKRLKNYSTDRNNPIKPKALSGLSPYLHFGQVSAQRCALEARKVRSTSPQAVDTFLEELIVRRELSDNFCYYQPHYDSLKGAWEWARKSLMDHASDKREHIYSLEQLEKGLTADPLWNASQLEMVYQGKMHGFMRMYWAKKILEWT-KGPEEALSISIYLNNKYEIDGRDPSGYVGCMWSICGVHDQGWKERPVFGKIRYMNYAGCKRKFNVDSYIS 465          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6F6A2|PHR_ORYSJ (Deoxyribodipyrimidine photo-lyase OS=Oryza sativa subsp. japonica OX=39947 GN=PHR PE=1 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 3.038e-130
Identity = 227/442 (51.36%), Postives = 287/442 (64.93%), Query Frame = 3
Query:  357 VLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPK--FLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKD---IYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFP--PVIKHPKSGDLPEPTDWE--LARKSLDVDMTVKEVVEFIPGYQAGMENLWKF---IYSKRLKNFNLHRNDPTKS-CLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFES 1643
            V+YWM RDQR+ DNWA  +A  L+    S   V F L P+   L A  R   FLLRGL+ +  +    ++ F L  G   E IP  V +   S +V DF PLR   + +  V   L ++   + + QVDAHNVVPVW AS K+E +A+T R K++  ++E+L EFP  P +  P   + PE  DW+  +AR   + +  V E+    PG +A +E L        +KR+K++   RNDPTK   LS +SP+LHFG ISAQRC LEA   +  + + VD F+EE +VRRELADNFCYY P YDSLSG   WAR+TL  H  D+R + YT EQL++ KTHD LWNA+QL+MV  GKMHGF+RMYWAKKILEWT  GP EAL  AI+LND+Y IDGRDP+GY G MWSICG+HDQGW ER VFGKIRYMNY GC+RKFDV  + S
Sbjct:   40 VVYWMLRDQRLADNWALLHAAGLAAASASPLAVAFALFPRPFLLSARRRQLGFLLRGLRRLAADAAARHLPFFLFTGGPAE-IPALVRRLGASTLVADFSPLRPVREALDAVVGDLRREAPGVAVHQVDAHNVVPVWTASAKMEYSAKTFRGKVSKVMDEYLVEFPELPAVV-PWDREQPEGVDWDALIARVCSEAE-NVPEIDWCEPGEEAAIEALLGSKDGFLTKRIKSYETDRNDPTKPRALSGLSPYLHFGHISAQRCALEAKKCRHLSPKSVDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIYTREQLENAKTHDPLWNASQLEMVHHGKMHGFMRMYWAKKILEWT-SGPEEALSTAIYLNDKYEIDGRDPSGYVGCMWSICGLHDQGWKERPVFGKIRYMNYAGCKRKFDVDAYIS 477          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. UniProt/SwissProt
Match: sp|P12769|PHR_METTH (Deoxyribodipyrimidine photo-lyase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=phr PE=3 SV=2)

HSP 1 Score: 291.197 bits (744), Expect = 1.651e-87
Identity = 176/448 (39.29%), Postives = 249/448 (55.58%), Query Frame = 3
Query:  291 LFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEK--NNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGDLPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDV 1628
            + + +RI+ + G E  +  S  V+YWM    R H N A  YA + +   K    V F L   F +A  RHY FL+ GL++V    R+  I     L   ++  P  + K  ++ +  V D   L +  +W+ + +  L   I + QV+++ +VPV  AS K E +A T + KI   L  F+           S DL    ++E A +       ++  V F  G    +    +F+  K L+ F  +RNDP K+CLSN+SP+LHFGQIS     L A S+     E    F+EE +VRREL+ NF +Y+  Y S+S    WA+ TL  H  D R Y+Y++ +L+S  THD  WNAAQ +MV  GKMHG++RMYW KKILEWT+  P  A   A++LNDRY IDGRDPNG+ G+ W   G HD+ WAER +FGK+RYMN +G +RKF +
Sbjct:    1 MIHAERIRNLNGEEPDLRGS-YVVYWMQASVRSHWNHALEYAIETANSLKKPLIVVFGLTDDFPNANSRHYRFLIEGLRDVRSNLRERGIQ----LVVERDSPPSVLLKYADDAAAAVTDRGYLDIQKEWVDEAAGAL--HIPLTQVESNVIVPVETASDKEEYSAGTFKPKIKRHLKRFMVPLRMRTLKMDSLDLEPGPEFEDAVRDFRAPEDLEPSV-FRGGTSTALSIFSEFLREK-LECFERYRNDPVKNCLSNMSPYLHFGQISPLYLALRA-SEAGECPE----FLEELIVRRELSMNFVHYSDSYSSISCLPEWAQRTLMDHVADPREYEYSLRELESASTHDPYWNAAQQEMVITGKMHGYMRMYWGKKILEWTDH-PARAYDIALYLNDRYEIDGRDPNGFAGVAWCF-GKHDRAWAEREIFGKVRYMNDRGLKRKFRI 432          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. TrEMBL
Match: A0A075F4M7 (CPD photolyase (Fragment) OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 290/491 (59.06%), Postives = 366/491 (74.54%), Query Frame = 3
Query:  198 TRNLKTENKMEFDSFTKNIECKRKEYF--IGSYLFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHP-KSGDLPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTYRQSK 1661
             + +KTE +     F + IE +R++    +  + FN KR++ +   +E    +K ++YWMSRDQRV DNWAF YAQKL+LK +   HVCFCLVPKFL+ATIRHY F+L+GL+EVE+ECR+L+INFHLL+G AK+++PEFV++  I  VV DF P+RVP  W+ +V  +LPKD+  CQVDAHN+VP W+ASPKLE  ARTIRSKI+  L+ + TEFPPVI+HP K+   PEP D+E  ++SLDVD TV EV    PG   G+ NL  FI  +RLK FN  RNDP K+ LS++SPW HFGQ+S QR +L     ++  KEGV+ +IEE ++RRELADNFCYYN +YD++ G   WAR+TL  H+ D+R + Y+ EQL+  KTHD LWNAAQ+QMV EGKMHGFLRMYWAKKILEWT E P +AL  AI+LNDR+++DGRDPNGY G MWSICG+HDQGW ER VFGKIR+MNYKGCQRKFDV  F   YR  K
Sbjct:   37 AKKIKTEEEKVEKDFLQKIENQRRDTAKSVADFKFNKKRVRVLSSQQEFPDENKGIVYWMSRDQRVQDNWAFLYAQKLALKAEVPLHVCFCLVPKFLEATIRHYGFMLKGLREVEEECRKLDINFHLLIGYAKDKLPEFVKEQKIGGVVTDFSPMRVPAGWVNEVKKLLPKDVPFCQVDAHNIVPCWEASPKLEYGARTIRSKIHKVLSTYFTEFPPVIRHPHKATAKPEPIDFEAVQESLDVDRTVGEVDWVTPGTTGGLRNLESFI-KQRLKYFNADRNDPNKNALSHMSPWYHFGQVSVQRGMLMVRQYRNKYKEGVEGYIEEGIIRRELADNFCYYNENYDNIDGAYEWARKTLNDHKKDKRTHIYSREQLEKAKTHDDLWNAAQMQMVTEGKMHGFLRMYWAKKILEWT-ESPEKALADAIYLNDRFNLDGRDPNGYVGCMWSICGIHDQGWKEREVFGKIRFMNYKGCQRKFDVAAFVRKYRAKK 525          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. TrEMBL
Match: A0A2I0U149 (Deoxyribodipyrimidine photo-lyase-like OS=Limosa lapponica baueri OX=1758121 GN=llap_9885 PE=4 SV=1)

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 282/464 (60.78%), Postives = 351/464 (75.65%), Query Frame = 3
Query:  261 KRKEYFIGSYLFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGDLP-EPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTY 1649
            +R    +  + +N KR++ I    +   +++ +LYWMSRDQRV DNWAF YAQ+L+LK +   HVCFCLVPKFLDATIRHY F+L+GL+EV +EC +LNI FHLLLG AK+ +P FV +  +  +V DFCPLR+P QW++DV + LP+D+   QVDAHN+VP W ASPK E +ARTIR KI+ +L EFLTEFPPVI+HP +   P EP  WE    SL VD TVKEV    PG  AG+  L  FI  +RLK+F+ +RNDP K+ LSN+SPW HFGQ+S QR ILE    ++  KE VD F+EE++VRRELA+NFCYYN +YDS+ G  +WA+ TL++H  D+RP+ Y +++L+ G THD LWNAAQLQMVREGKMHGFLRMYWAKKILEWT   P EAL+ AI+LNDRY +DGRDPNGY G +WSICG+HDQGWAERA+FGKIRYMNY GC+RKFDV  FE  Y
Sbjct:   34 RRAAPSVQEFKYNKKRVRLISQGSDLKDDAQCILYWMSRDQRVQDNWAFLYAQRLALKQELPLHVCFCLVPKFLDATIRHYGFMLKGLREVAEECAELNIPFHLLLGYAKDVLPAFVVERGVGGLVTDFCPLRLPRQWVEDVKERLPEDVPFAQVDAHNIVPCWVASPKQEYSARTIRGKIHAQLPEFLTEFPPVIRHPYAPSCPTEPIAWEACYSSLQVDRTVKEVEWATPGTAAGLAMLQSFIM-ERLKSFSSYRNDPNKAALSNLSPWFHFGQVSTQRAILEVQKHRAKYKESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLYKLQELEQGTTHDPLWNAAQLQMVREGKMHGFLRMYWAKKILEWT-RSPEEALQFAIYLNDRYELDGRDPNGYVGCLWSICGIHDQGWAERAIFGKIRYMNYAGCKRKFDVAQFECRY 495          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. TrEMBL
Match: J3S999 (Deoxyribodipyrimidine photo-lyase-like OS=Crotalus adamanteus OX=8729 PE=2 SV=1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 292/521 (56.05%), Postives = 370/521 (71.02%), Query Frame = 3
Query:  117 TTSPKSVKRSKTILTNQSASTSTENFFTRNLKTENKMEFDSFTKNIECKRKE--YFIGSYLFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHP-KSGDLPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTYRQSKSLQ 1670
            T+SP S++  +   +  + + S     T+  K++      S  K ++  R      +  + +N KR++ I  + +    ++ +LYWMSR+QRV DNWAF YAQ+L+LK +   HVCFCLVPKFLDATIRH+ FLL+GL+EV +ECR L+I FHLL G AK+R+P FV ++ I  VV DF PLRVPLQW++DV + LP D+ + QVDAHN+VP W AS K E  ARTIR KI  +L EFLTEFPP++KHP ++G   EP +WE    SL VD +VKEV    PG  +G++ L  FI   RLK F   RN+P +  LSN+SPW HFGQ++ QR ILE    ++  KE V+ FIEE++VRRELADNFC+YNP+YD + G  +WA+ TL++H  D+RPY YT+EQL+ GKTHD LWNAAQLQMV EGKMHGFLRMYWAKKILEWT   P EAL+ +I+LNDRY +DGRDPNGY G MWSICG+HDQGWAERAVFGKIRYMNY GC+RKFDV  FE  Y   +  Q
Sbjct:   12 TSSPDSLEEGRKPDSADTEALSG----TKKFKSQEDPRTQSLAKTVKETRMSAGLSVAEFPYNKKRVRLISPAPDLKEGAQGILYWMSREQRVQDNWAFLYAQRLALKQRLPLHVCFCLVPKFLDATIRHFGFLLKGLEEVAEECRMLDIPFHLLTGFAKDRVPHFVTQHGIGGVVTDFSPLRVPLQWVRDVQEQLPSDVPLAQVDAHNIVPCWVASDKQEYGARTIRRKIQDRLAEFLTEFPPLVKHPFRAGLQAEPINWEACYASLQVDRSVKEVEWARPGSASGLKVLEGFI-KDRLKFFASDRNNPNRMALSNLSPWFHFGQVAVQRAILEVRKHRARYKESVEGFIEEAVVRRELADNFCFYNPNYDKIEGAYDWAKTTLKLHAKDKRPYLYTLEQLEEGKTHDLLWNAAQLQMVHEGKMHGFLRMYWAKKILEWT-RSPEEALQFSIYLNDRYELDGRDPNGYVGCMWSICGIHDQGWAERAVFGKIRYMNYAGCKRKFDVAQFERKYSPQRFTQ 526          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. TrEMBL
Match: A0A0K8RWA2 (Deoxyribodipyrimidine photo-lyase-like OS=Crotalus horridus OX=35024 PE=4 SV=1)

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 292/521 (56.05%), Postives = 370/521 (71.02%), Query Frame = 3
Query:  117 TTSPKSVKRSKTILTNQSASTSTENFFTRNLKTENKMEFDSFTKNIECKR--KEYFIGSYLFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHP-KSGDLPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTYRQSKSLQ 1670
            T+SP S++  + + +  + + S     T+  K++      S  +  +  R      +  + +N KR++ I  + E    ++ +LYWMSR+QRV DNWAF YAQ+L+LK +   HVCFCLVPKFLDATIRH+ FLL+GL+EV +ECR L+I FHLL G AK+R+P FV ++ I  VV DF PLRVPLQW++DV + LP D+ + QVDAHN+VP W AS K E  ARTIR KI  +L EFLTEFPP++KHP ++G   EP +WE    SL VD +VKEV    PG  +G++ L  FI   RLK F   RN+P +  LSN+SPW HFGQ++ QR ILE    ++  KE V+ FIEE++VRRELADNFC+YNP+YD + G  +WA+ TL++H  D+RPY YT+EQL+ GKTHD LWNAAQLQMV EGKMHGFLRMYWAKKILEWT   P EAL+ +I+LNDRY +DGRDPNGY G MWSICG+HDQGWAERAVFGKIRYMNY GC+RKFDV  FE  Y   +  Q
Sbjct:   12 TSSPDSLEEGRKLDSADTEALSG----TKKFKSQEDPRTQSLAETAKETRLSAGLSVAEFPYNKKRVRLISPAPELKEGAQGILYWMSREQRVQDNWAFLYAQRLALKQRLPLHVCFCLVPKFLDATIRHFGFLLKGLEEVAEECRMLDIPFHLLTGFAKDRVPHFVTQHGIGGVVTDFSPLRVPLQWVRDVQEQLPSDVPLAQVDAHNIVPCWVASDKQEYGARTIRRKIQDRLAEFLTEFPPLVKHPFRAGLQAEPINWEACYASLQVDRSVKEVEWARPGSASGLKVLEGFI-KDRLKFFASDRNNPNRPALSNLSPWFHFGQVAVQRAILEVRKHRTRYKESVEGFIEEAVVRRELADNFCFYNPNYDKIEGAYDWAKTTLKLHAKDKRPYLYTLEQLEEGKTHDLLWNAAQLQMVHEGKMHGFLRMYWAKKILEWT-RSPEEALQFSIYLNDRYELDGRDPNGYVGCMWSICGIHDQGWAERAVFGKIRYMNYAGCKRKFDVAQFERKYSPQRFTQ 526          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. TrEMBL
Match: A0A3S1H928 (Photolyase/cryptochrome alpha/beta domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_017623 PE=4 SV=1)

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 290/525 (55.24%), Postives = 371/525 (70.67%), Query Frame = 3
Query:   84 KRKRTNKPTTDTTSPKSVKRSKTILTNQSASTSTENFFTRNLKTENKMEFDSFTKNIECKRKEYF--IGSYLFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHP-KSGDLPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTY 1649
            K ++  +P       K  K  +   T + +    +N  T   +     + + F   I  +R +    +  + FN KR++ I   E+   +S  V+YWMSRDQRV DNWAF YAQ+L++K +   HVCFCLVPK+LDATIR Y F+++GL +VEKECR+LNI FHLL G A + IP F++++NI  VV DF PLRV ++W+ D+ + LP D+ +CQVDAHN+VP W+ASPKLE  ARTIR+KI+ +L +FLTEFPP++KHP     +P+ TDW+ A  SL VD TV EV    PG QAG + L  F   KRLK+F   RNDP K  LSN+SPW+HFGQIS QRCIL     +S + + V+ FIEE+++RRELADNFCYYN HYDS+ G  +WA+++L +H+ D+RPY YT ++L+  KTHD LWNAAQ Q+V EGKMHGFLRMYWAKKILEWT   P EAL  AI+LNDR+S+DGRDPNGY G MWSICG+HDQGWAERAVFGKIRYMNY+GC+RKFDV  F   Y
Sbjct:  130 KSEKKERPARTVEKRKLEKHQEEEATAKKSKIEDQNGATEPAEDVGNTDNEEFINKINQRRIDVCEDVSKFKFNKKRVRVISEEEDFCEDSNGVVYWMSRDQRVQDNWAFLYAQRLAMKLEVPLHVCFCLVPKYLDATIRMYGFMMKGLAQVEKECRELNIPFHLLCGEASKSIPAFLKEHNIGGVVTDFSPLRVNVKWVDDLKNALPADVPLCQVDAHNLVPCWEASPKLEYGARTIRNKIHNQLGQFLTEFPPLVKHPHPPKKMPQITDWKKADGSLKVDRTVLEVAWAKPGTQAGYKMLQSFC-EKRLKHFATARNDPNKQALSNLSPWIHFGQISVQRCILTVRLYRSKSSDSVNAFIEEAVIRRELADNFCYYNKHYDSVKGAYDWAKKSLALHKDDKRPYLYTRDELEESKTHDDLWNAAQYQLVSEGKMHGFLRMYWAKKILEWT-TSPEEALAFAIYLNDRFSLDGRDPNGYVGCMWSICGIHDQGWAERAVFGKIRYMNYQGCKRKFDVPGFVLRY 652          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Cavefish
Match: cpdp (deoxyribodipyrimidine photo-lyase [Source:NCBI gene;Acc:103043726])

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 263/470 (55.96%), Postives = 324/470 (68.94%), Query Frame = 3
Query:  243 TKNIECKRKEYFIGSYLFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHP-KSGDLPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTY 1649
             KN  CK          FN+KR++ +   ++   +   VLYWMSRDQRV DNWA  YAQ+L+L  +   H+CFCLVP++LDA  R Y F++RGLQEV KEC+ L+I FH L G  ++ + +FV+  NI  +V DF PLR+ LQWI++V   LP +I   QVDAHNVVP W+ASPKLE  ARTIR KI  +L +FLTEFPPV  HP  S    +  +WE    S++VD TV EV    PG   GM  L  FI  +RL+ F   RN+P    +S++SPWLH GQ+SAQR + E       A+E V  F EE +VRRELADNFCYYN  YDS++G  +WA+ TL+IH  D+R Y YT EQL++GKTHD LWNAAQ Q++ EGKMHGF+RMYWAKKILEWT   P EAL  A++LND YS+DG DPNGY G MWSICG+HDQGWAER VFGK+RYMNY GC+RKFDV  FE  Y
Sbjct:   88 AKNTGCK----------FNDKRVRFLSEEQKVKQSCSGVLYWMSRDQRVQDNWALIYAQRLALAEELPLHICFCLVPRYLDAAYRQYAFMIRGLQEVAKECKSLDIQFHFLRGDPEQLLLDFVKSWNIGALVTDFNPLRLHLQWIENVRKGLPSNIPFLQVDAHNVVPCWEASPKLEYGARTIRGKITKQLPDFLTEFPPVDTHPHASKKTAKSVNWEEVLDSVEVDRTVGEVEWARPGTSGGMAMLESFI-QQRLRLFATERNNPNSEAVSHLSPWLHAGQLSAQRVVKEVQRWGKNARESVASFTEELVVRRELADNFCYYNKEYDSIAGAYDWAKTTLKIHAKDKRAYLYTQEQLETGKTHDQLWNAAQRQLLLEGKMHGFMRMYWAKKILEWTSS-PEEALTIALYLNDHYSLDGCDPNGYVGCMWSICGIHDQGWAERPVFGKVRYMNYAGCKRKFDVSRFERKY 545          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Sea Lamprey
Match: cpdp (CPD photolyase [Source:ZFIN;Acc:ZDB-GENE-040426-1644])

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 282/459 (61.44%), Postives = 343/459 (74.73%), Query Frame = 3
Query:  288 YLFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHP-KSGDLPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTYRQSK 1661
            + FN KR++ +  +++   N+  +LYWMSRDQRV DNWA  YAQ+L+LK +   +VCFCLVPKF+DATIRH+ F+LRGLQEVEKE R L+I+FHLL G AK+ +P FV + NI  VV DF PLRVP QW+KD+   LPK++ + QVDAHNVVP W  S KLE  ARTIR KI+ KL +F TEFPP IKH   +  LPE TDWE A +SL+VD +V EV    PG  AG+E L  FI ++RLK F+  RN+P  + LSN+SPW+HFGQIS QRC LE    K   +E VD++IEE++VRREL DNFC+YN +YDSL G  +WA+ +L+ H  D R Y Y+++QL+  KTHD LWNAAQLQMV EGKMHGF+RMYWAKKILEWT   P EAL+ AI+LNDRY +DG DPNGY G MWSICG HDQGWAERAVFGKIRYMNY GC+RKFDV  +ES Y   K
Sbjct:   22 FRFNKKRVRAVSNADDMAANASGILYWMSRDQRVQDNWALLYAQRLALKQRLPLYVCFCLVPKFMDATIRHFGFMLRGLQEVEKEFRSLDISFHLLKGYAKDVLPPFVNEKNIGAVVTDFLPLRVPRQWVKDLKKALPKNVPLAQVDAHNVVPCWVTSDKLEYGARTIRRKIHDKLPQFFTEFPPAIKHTYPAKSLPEETDWEAAWQSLEVDRSVGEVAWAQPGTSAGLEMLNSFI-NERLKLFSTDRNNPNSNALSNLSPWIHFGQISVQRCALEVSKLKPKYRESVDMYIEEAIVRRELGDNFCFYNKNYDSLDGAYDWAKRSLDAHTQDNREYIYSLQQLEEAKTHDPLWNAAQLQMVVEGKMHGFMRMYWAKKILEWT-SSPEEALRIAIYLNDRYQLDGSDPNGYVGCMWSICGTHDQGWAERAVFGKIRYMNYAGCKRKFDVGAYESRYSSKK 478          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Nematostella
Match: EDO44191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWM4])

HSP 1 Score: 443.736 bits (1140), Expect = 9.133e-148
Identity = 225/383 (58.75%), Postives = 273/383 (71.28%), Query Frame = 3
Query:  510 LLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPK-SGDLPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYY-NPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTYR 1652
            +++GLQEVEKE ++L I+FHLLLG   + +PEFV+   I  +V DFCPLR+P QW+ DV   +PKD+ +CQVDAHN+VP W ASPKLE  ARTIR KI+  L EFLTEFPPVIKH   SG+  + TDW+     ++VD +V EV    PG   G+  L  F    RLK F+  RNDPTK  LSN+SPW H GQIS QR IL     +S  +E V+ FIEE ++RREL+DNFCYY N  YDS+ G   WAR+TL  H  D+R Y Y   +L+  +THD LWNAAQ Q+VREGK+HGFLRMYWAKKILEWT + P  AL  AI+ ND+Y++DG DPNGY G MWS+CG+HDQGWAER VFGKIRYMNYKGCQRKF V  F   Y+
Sbjct:    1 MIKGLQEVEKELKELEISFHLLLGDPGKVLPEFVKSAGIGGIVVDFCPLRLPTQWVNDVVKAVPKDVPVCQVDAHNIVPCWHASPKLEYGARTIRPKIHKVLTEFLTEFPPVIKHSHVSGEKTKTTDWDAVDTFIEVDRSVGEVDWAKPGTAEGLFMLESFC-KDRLKYFHSSRNDPTKRALSNLSPWFHTGQISPQRAILRVRDFRSKFRESVESFIEECIIRRELSDNFCYYNNEKYDSIEGTNEWARKTLNDHAKDKREYLYARGKLEKAQTHDDLWNAAQRQLVREGKLHGFLRMYWAKKILEWT-DSPETALSDAIYFNDKYALDGIDPNGYVGCMWSVCGIHDQGWAERPVFGKIRYMNYKGCQRKFAVAEFVKRYK 381          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Nematostella
Match: EDO28332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6S3])

HSP 1 Score: 244.973 bits (624), Expect = 7.804e-73
Identity = 151/377 (40.05%), Postives = 186/377 (49.34%), Query Frame = 3
Query:  534 EKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGDLPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFG---QISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYN-PHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTYR 1652
            ++E ++L I+FHLLLG   + +PEFV+   I  +V DFCPLR+P QW+ DV   +PKD+ ICQVDAHN+VP W ASPKLE  ARTIR KI+    + LTEF                                 + EF P            I    +         PT      + P  H     QI  QR IL     +S  +E V+ FIEE ++RREL+DNFCYYN   YDS+ G   WAR+TL  H  D+R Y Y   +L+  +THD LWNAAQ+          FL                                DGR        MWS+CG+HDQGWAER VFGKIRYMNYKGCQRKF V  F   Y+
Sbjct:   79 QRELKELEISFHLLLGDPGKVLPEFVKTAGIGGIVVDFCPLRLPTQWVNDVVKAVPKDVPICQVDAHNIVPCWHASPKLEYGARTIRPKIH----KVLTEF---------------------------------LTEFPP-----------VIKHSHVSGEKTKITRPTCYTPILVHPPRHMHDTYQILPQRAILRVRDFRSKFRESVESFIEECIIRRELSDNFCYYNNEKYDSIEGTNEWARKTLNDHAKDKREYLYARGKLEKAQTHDDLWNAAQVM--------AFLFCNIP---------------------------DGR-------CMWSVCGIHDQGWAERPVFGKIRYMNYKGCQRKFAVAEFVKRYK 365          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Medaka
Match: cpdp (photolyase [Source:NCBI gene;Acc:100049426])

HSP 1 Score: 524.628 bits (1350), Expect = 3.877e-176
Identity = 262/454 (57.71%), Postives = 315/454 (69.38%), Query Frame = 3
Query:  294 FNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLV-PKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSG-DLPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTY 1649
            F+ KR + I  +++    S  VLYWM RDQRV DNWA   AQ+L+ K     HVCFCLV PK   +T+RHY FLL+GL+EV+KEC+ LNI FHLL G A + +P FV  +N   VV DF PLR PLQW++ V   LP+DI   QVDAHN+VP W ASPKLE +ARTIR KI   L+EFLT+FP V KHP S     +  DW+    SL VD TV E     PG +AG+  L  FI   RLK F   RNDP  + LS +SPWL FGQ+SAQR  L+     S +   V  FIEE +VRREL DNFC+YN +YDS++G   WA++TL+ H  D+R Y YT EQ +  +THD LWNAAQ+QMV EGKMHGFLRMYWAKKILEW+   P EAL  A++LNDRY +DG+DPNG+ G MWSICG+HDQGWAERAVFGKIR+MNYKGC RKF+V  FE  Y
Sbjct:  105 FSKKRQRFISETQKVRQGSGGVLYWMLRDQRVQDNWALIRAQQLAAKESLPLHVCFCLVVPKSELSTLRHYSFLLKGLEEVQKECKHLNIQFHLLHGAAGDVLPGFVTGHNFGAVVTDFSPLREPLQWLEAVKKGLPEDIPFIQVDAHNIVPCWVASPKLEYSARTIRGKITNLLSEFLTDFPLVDKHPFSATKTAKAVDWDKTLASLKVDRTVGEPKWAKPGTEAGLAMLESFI-DVRLKLFGTQRNDPNAAALSQLSPWLRFGQLSAQRVALQVRKNSSPS---VPAFIEELVVRRELTDNFCFYNKNYDSVTGAYEWAQKTLKDHAKDKREYLYTREQFEKAQTHDKLWNAAQIQMVTEGKMHGFLRMYWAKKILEWS-TSPEEALSIALYLNDRYELDGQDPNGFVGCMWSICGIHDQGWAERAVFGKIRFMNYKGCLRKFNVAQFERKY 553          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Planmine SMEST
Match: SMESG000003495.1 (SMESG000003495.1)

HSP 1 Score: 1104.35 bits (2855), Expect = 0.000e+0
Identity = 526/529 (99.43%), Postives = 527/529 (99.62%), Query Frame = 3
Query:   81 MKRKRTNKPTTDTTSPKSVKRSKTILTNQSASTSTENFFTRNLKTENKMEFDSFTKNIECKRKEYFIGSYLFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGDLPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTYRQSKSL 1667
            MKRKRTNKPTTDTTSPKSVKRSKT+LTNQSASTSTENFFTRNLKTENKMEFDSFTKNIECKRKEYFIGSYLFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGDLPE TDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTYR SKSL
Sbjct:    1 MKRKRTNKPTTDTTSPKSVKRSKTVLTNQSASTSTENFFTRNLKTENKMEFDSFTKNIECKRKEYFIGSYLFNNKRIKTIRGSEESVTNSKSVLYWMSRDQRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQEVEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIKDVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLTEFPPVIKHPKSGDLPESTDWELARKSLDVDMTVKEVVEFIPGYQAGMENLWKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKSTAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHDERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWTEEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFGKIRYMNYKGCQRKFDVKLFESTYRPSKSL 529          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Planmine SMEST
Match: SMESG000059177.1 (SMESG000059177.1)

HSP 1 Score: 62.3882 bits (150), Expect = 7.339e-10
Identity = 28/50 (56.00%), Postives = 39/50 (78.00%), Query Frame = -1
Query: 2355 KVNQDNRKYLRFLLVEKKKLEYHEFERLVFGFNMSPLLE*FLTRENAEQF 2504
            KVN+++RKYLRFL     ++E +EFERLVFG N+SP+LE  +TR + E+F
Sbjct:  244 KVNEEDRKYLRFLWANSGEIEGYEFERLVFGLNVSPILEQLVTRRSEEEF 293          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Planmine SMEST
Match: SMESG000017840.1 (SMESG000017840.1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.464e-7
Identity = 29/52 (55.77%), Postives = 33/52 (63.46%), Query Frame = -1
Query: 2349 KVNQDNRKYLRFLLVEKKKLEYHEFERLVFGFNMSPLLE*FLTRENAEQFQE 2504
            KV    RKYLRFL  E   +E  EFERLVFG N+SP L   +TR NAE+F  
Sbjct:  508 KVTPVERKYLRFLWEEGGNIEGFEFERLVFGLNISPFLAQLVTRRNAEKFHS 559          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Planmine SMEST
Match: SMESG000052011.1 (SMESG000052011.1)

HSP 1 Score: 54.6842 bits (130), Expect = 3.060e-7
Identity = 24/53 (45.28%), Postives = 38/53 (71.70%), Query Frame = -1
Query: 2343 VNQDNRKYLRFLLVEKKKLEYHEFERLVFGFNMSPLLE*FLTRENAEQFQEAF 2501
            +N+ +RKYLRFL     +L+++EF RL+FG N +P L   +T+ENA +F+E +
Sbjct:  374 INKKDRKYLRFLWKRDNQLKFYEFNRLMFGLNAAPFLAQLVTQENARKFKEKY 426          
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Planmine SMEST
Match: SMESG000031512.1 (SMESG000031512.1)

HSP 1 Score: 53.9138 bits (128), Expect = 6.410e-7
Identity = 24/53 (45.28%), Postives = 36/53 (67.92%), Query Frame = -1
Query: 2343 VNQDNRKYLRFLLVEKKKLEYHEFERLVFGFNMSPLLE*FLTRENAEQFQEAF 2501
            +N+ NRKYLRFL     +L ++EF RLVFG N +P L   + +ENA +F++ +
Sbjct:  395 INKKNRKYLRFLWKRDNQLRFYEFNRLVFGLNAAPYLAQLVAQENARKFKQKY 447          
The following BLAST results are available for this feature:
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
phr0.000e+052.93gene:FBgn0003082 transcript:FBtr0088839[more]
phr0.000e+053.33gene:FBgn0003082 transcript:FBtr0088838[more]
CG188531.915e-6667.53gene:FBgn0042173 transcript:FBtr0089426[more]
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cpdp2.867e-17957.62CPD photolyase [Source:ZFIN;Acc:ZDB-GENE-040426-16... [more]
cpdp3.707e-17957.62CPD photolyase [Source:ZFIN;Acc:ZDB-GENE-040426-16... [more]
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
engase1.870e-10056.93endo-beta-N-acetylglucosaminidase [Source:Xenbase;... [more]
ENSXETT00000046952.12.408e-2956.47pep primary_assembly:Xenopus_tropicalis_v9.1:5:108... [more]
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28811|PHR_POTTR0.000e+059.07Deoxyribodipyrimidine photo-lyase OS=Potorous trid... [more]
sp|P34205|PHR_CARAU0.000e+058.55Deoxyribodipyrimidine photo-lyase OS=Carassius aur... [more]
sp|Q9SB00|PHR_ARATH2.966e-14252.28Deoxyribodipyrimidine photo-lyase OS=Arabidopsis t... [more]
sp|Q6F6A2|PHR_ORYSJ3.038e-13051.36Deoxyribodipyrimidine photo-lyase OS=Oryza sativa ... [more]
sp|P12769|PHR_METTH1.651e-8739.29Deoxyribodipyrimidine photo-lyase OS=Methanothermo... [more]
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075F4M70.000e+059.06CPD photolyase (Fragment) OS=Platynereis dumerilii... [more]
A0A2I0U1490.000e+060.78Deoxyribodipyrimidine photo-lyase-like OS=Limosa l... [more]
J3S9990.000e+056.05Deoxyribodipyrimidine photo-lyase-like OS=Crotalus... [more]
A0A0K8RWA20.000e+056.05Deoxyribodipyrimidine photo-lyase-like OS=Crotalus... [more]
A0A3S1H9280.000e+055.24Photolyase/cryptochrome alpha/beta domain-containi... [more]
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cpdp0.000e+055.96deoxyribodipyrimidine photo-lyase [Source:NCBI gen... [more]
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cpdp0.000e+061.44CPD photolyase [Source:ZFIN;Acc:ZDB-GENE-040426-16... [more]
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO441919.133e-14858.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283327.804e-7340.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cpdp3.877e-17657.71photolyase [Source:NCBI gene;Acc:100049426][more]
back to top
BLAST of Photolyase/cryptochrome alpha/beta domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003495.10.000e+099.43SMESG000003495.1[more]
SMESG000059177.17.339e-1056.00SMESG000059177.1[more]
SMESG000017840.11.464e-755.77SMESG000017840.1[more]
SMESG000052011.13.060e-745.28SMESG000052011.1[more]
SMESG000031512.16.410e-745.28SMESG000031512.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028914 ID=SMED30028914|Name=Photolyase/cryptochrome alpha/beta domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2951bp
TTTATGAATTTGCAACTAAATTTTAATTTATTATTAATTACTGTAGATTA
TAATAATAAGAAAAATATAGATCAGCATAAATGAAAAGAAAACGCACAAA
CAAACCAACTACAGATACAACTAGTCCAAAAAGTGTGAAAAGGAGCAAAA
CAATATTAACGAATCAATCTGCATCGACATCAACTGAAAATTTTTTTACT
AGAAATTTAAAAACTGAGAACAAAATGGAATTTGATTCATTTACTAAAAA
TATTGAATGCAAACGGAAAGAATATTTTATTGGCTCCTATTTATTTAATA
ACAAGCGAATTAAAACTATTCGAGGTTCCGAAGAGTCTGTAACGAATAGT
AAATCTGTGCTATACTGGATGTCTCGTGATCAGCGAGTTCATGATAATTG
GGCGTTTCACTATGCCCAGAAGTTATCACTGAAATTCAAATCCAATTTTC
ATGTCTGCTTCTGTTTGGTGCCGAAATTTCTCGATGCGACAATTAGACAT
TACGATTTCCTTCTCAGAGGGCTTCAAGAAGTAGAAAAGGAATGCCGACA
GCTGAACATAAATTTTCATTTGCTGCTCGGTACAGCTAAAGAACGCATTC
CAGAGTTTGTAGAGAAGAATAATATTAGTGTTGTCGTTAACGATTTCTGT
CCATTGCGAGTTCCATTGCAATGGATTAAGGATGTATCAGATGTGTTACC
GAAAGACATTTATATTTGCCAAGTTGATGCTCACAATGTTGTGCCAGTGT
GGGATGCCAGTCCGAAATTAGAAGTCGCAGCTCGTACGATTCGATCAAAA
ATAAATGGAAAATTAAATGAATTTCTTACTGAGTTTCCACCAGTAATTAA
GCATCCAAAATCGGGAGATTTACCTGAGCCGACCGATTGGGAATTAGCCA
GGAAATCTCTTGATGTCGACATGACAGTGAAAGAAGTGGTTGAATTTATT
CCCGGTTACCAAGCTGGGATGGAAAATTTATGGAAATTTATTTATTCGAA
ACGTTTGAAAAATTTCAATTTACACAGAAATGATCCCACAAAAAGTTGCT
TGAGTAACATTTCTCCTTGGCTGCATTTTGGCCAAATCTCAGCTCAGAGG
TGTATTTTAGAAGCTCATTCCCAGAAATCCACGGCTAAAGAGGGAGTTGA
TATTTTCATTGAGGAATCTCTAGTCCGCAGAGAACTAGCTGATAATTTCT
GTTACTATAACCCGCATTATGATAGTTTATCGGGAGGGGCTAATTGGGCT
CGTGAGACGCTTGAGATCCACAGGCACGACGAGAGACCATACAAGTACAC
TATTGAACAGCTGGACTCAGGAAAGACACATGACCATTTATGGAATGCGG
CCCAATTGCAGATGGTTAGGGAGGGCAAAATGCACGGGTTTTTACGCATG
TATTGGGCGAAAAAGATCCTTGAATGGACTGAAGAAGGGCCGGGTGAAGC
TTTGAAGAGAGCGATCTGGTTGAACGATCGATATAGTATAGATGGGCGGG
ATCCAAATGGGTACACGGGGATCATGTGGTCTATTTGCGGTGTCCATGAC
CAGGGCTGGGCTGAGCGAGCGGTATTCGGTAAAATACGCTACATGAACTA
CAAGGGCTGTCAACGGAAATTCGACGTGAAATTGTTTGAGTCGACTTATA
GGCAATCAAAATCACTCCAATAGTTGATGTCGATGAAGTGATACATGTAT
TAGTGAATAAATGTTCTAGTTGAGCTTGGTTTTGATTTGTTTTCTTAGAC
TGCCAATTTATTAATTTCACGGCATTTTGCTTCATTTTCAAAAAGGTAAG
ATTATTATATTTTTATTTAATCACAGTTTTAAAGCTTTTCTAAAGTGTTT
TCATTCACAAATAATTTGTAGTATTGGTTTTTTTGTTATTGCAGTAATTG
TCCAAGAATTCTTTGACTTCGATCAACCTTATTTTTGTTTATTACTTTAG
CAGTATCCATTTAGGACGCCCCGTAAGAAAGGGAGGGAAGGGGTCTTCGC
AAAAGGGGCAATTGGGGATACTAAGGAGGGAAGGGGTCCAAGCGCTTAGG
AAATCTCCAGTATGTCACCTATTTTCACCATTTGATCAATTTAATGATGT
ATGTATGTTTTATCTCTATTTTCCAACCAATATTGTGTACTATTACATTT
TAATGTTAAAATTAAATTTATCCTAAATGCTTATAAATTATTAAAATTTC
TTTTGAAAATAAAGGATATCTAATTTTGGAGAAGGGCAAAGGGAATCAAA
AATTGCTTTTTTGGTGGATGTCCTTAATGTGTGGTCCCTTTCAATGCTTT
TCTGCTTCATTTTTATAATTAACGGTAATTTCATCTGCTTTTGAATGCTT
CTTGAAATTGTTCGGCATTTTCCCTGGTCAAAAACTACTCCAGTAATGGT
GACATATTAAACCCGAAAACCAATCTTTCAAACTCATGATATTCAAGTTT
TTTCTTTTCTACCAAAAGAAATCGTAAATATTTCCTGTTATCCTGATTTA
CCTTTTTATATTTATTTAACACATTTTTAAAACTTTTCTAAACTATTTTC
CTTCACAAATAATTTCTAGAAATTTGAATTATTTAAAATTTATATTGCTC
CTGTCGAGAAATACATACTTTTAAAATATCTTAAAGTTTTTTGTATATAA
ATTAATCATCTGTAATAATTTGTGATTAAATTGCTAATAATTTATGAATG
CCGGTTTAACACAAATTCACTGAGGTTGAACAGGGCTACAAGGCTTTACT
TATTCAGTTCTGTTACACCAGAAACAACAATGAAGTATTACAGAAATAGA
TTGAAGACTTTCAAGAAGACAATGAAGACTTTTTAAATAAAATTTGTAAT
TGAATTTGTATTTACATTTTGTGTTTGATTTTAAAACTTGATGTTCGCTT
ACTAGTAAGTCTGTATCTAGTTAGTAACTTTGTGTTGATATCCAGTTGCT
G
back to top

protein sequence of SMED30028914-orf-1

>SMED30028914-orf-1 ID=SMED30028914-orf-1|Name=SMED30028914-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=531bp
MKRKRTNKPTTDTTSPKSVKRSKTILTNQSASTSTENFFTRNLKTENKME
FDSFTKNIECKRKEYFIGSYLFNNKRIKTIRGSEESVTNSKSVLYWMSRD
QRVHDNWAFHYAQKLSLKFKSNFHVCFCLVPKFLDATIRHYDFLLRGLQE
VEKECRQLNINFHLLLGTAKERIPEFVEKNNISVVVNDFCPLRVPLQWIK
DVSDVLPKDIYICQVDAHNVVPVWDASPKLEVAARTIRSKINGKLNEFLT
EFPPVIKHPKSGDLPEPTDWELARKSLDVDMTVKEVVEFIPGYQAGMENL
WKFIYSKRLKNFNLHRNDPTKSCLSNISPWLHFGQISAQRCILEAHSQKS
TAKEGVDIFIEESLVRRELADNFCYYNPHYDSLSGGANWARETLEIHRHD
ERPYKYTIEQLDSGKTHDHLWNAAQLQMVREGKMHGFLRMYWAKKILEWT
EEGPGEALKRAIWLNDRYSIDGRDPNGYTGIMWSICGVHDQGWAERAVFG
KIRYMNYKGCQRKFDVKLFESTYRQSKSLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR006050DNA_photolyase_N
IPR014729Rossmann-like_a/b/a_fold
IPR032673DNA_photolyase_2_CS
IPR005101Cryptochr/Photolyase_FAD-bd
Vocabulary: molecular function
TermDefinition
GO:0003904deoxyribodipyrimidine photo-lyase activity
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair