Nidogen 2a (osteonidogen)

Overview
NameNidogen 2a (osteonidogen)
Smed IDSMED30028912
Length (bp)756
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nidogen 2a (osteonidogen) (SMED30028912) t-SNE clustered cells

Violin plots show distribution of expression levels for Nidogen 2a (osteonidogen) (SMED30028912) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nidogen 2a (osteonidogen) (SMED30028912) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nidogen 2a (osteonidogen) (SMED30028912) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028912

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 SmedASXL_004239SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 SmedASXL_004239SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 dd_Smed_v4_25_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 dd_Smed_v4_25_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 dd_Smed_v4_25_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 dd_Smed_v4_25_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 dd_Smed_v4_25_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 dd_Smed_v4_25_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 dd_Smed_v4_25_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028912SMESG000031644.1 SMESG000031639.1 Contig745GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028912SMESG000010581.1 SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 Contig45586uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028912SMESG000010581.1 SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 Contig45586newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 Contig745GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 dd_Smed_v6_25_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
goblet cellSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 dd_Smed_v6_25_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028912SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 dd_Smed_v4_25_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Human
Match: NID2 (nidogen 2 [Source:HGNC Symbol;Acc:HGNC:13389])

HSP 1 Score: 59.6918 bits (143), Expect = 1.497e-9
Identity = 41/123 (33.33%), Postives = 63/123 (51.22%), Query Frame = 2
Query:  284 GAR--APSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKCAKERD-------EYLKSHLIGRYFG----------CNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            GAR   P C+E G++  LQC GS   C+C D +G E+ G  TP   S   +C  + E         E  + +L+  Y G          C+ LG++   QCHG    C+C D+DG++V+G+++
Sbjct:  955 GARFHIPQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPG-STPPHCGPSPEPTQRPPTICERWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRS 1076          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Human
Match: NID2 (nidogen 2 [Source:HGNC Symbol;Acc:HGNC:13389])

HSP 1 Score: 58.9214 bits (141), Expect = 2.271e-9
Identity = 41/123 (33.33%), Postives = 63/123 (51.22%), Query Frame = 2
Query:  284 GAR--APSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKCAKERD-------EYLKSHLIGRYFG----------CNHLGNYEKAQCHG--SVCYCADEDGKKVEGSQT 583
            GAR   P C+E G++  LQC GS   C+C D +G E+ G  TP   S   +C  + E         E  + +L+  Y G          C+ LG++   QCHG    C+C D+DG++V+G+++
Sbjct:  224 GARFHIPQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPG-STPPHCGPSPEPTQRPPTICERWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRS 345          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Human
Match: NID2 (nidogen 2 [Source:HGNC Symbol;Acc:HGNC:13389])

HSP 1 Score: 58.9214 bits (141), Expect = 2.607e-9
Identity = 41/123 (33.33%), Postives = 63/123 (51.22%), Query Frame = 2
Query:  284 GAR--APSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKCAKERD-------EYLKSHLIGRYFG----------CNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            GAR   P C+E G++  LQC GS   C+C D +G E+ G  TP   S   +C  + E         E  + +L+  Y G          C+ LG++   QCHG    C+C D+DG++V+G+++
Sbjct:  549 GARFHIPQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPG-STPPHCGPSPEPTQRPPTICERWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRS 670          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Zebrafish
Match: nid2a (nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-030827-2])

HSP 1 Score: 62.003 bits (149), Expect = 1.766e-10
Identity = 41/118 (34.75%), Postives = 58/118 (49.15%), Query Frame = 2
Query:  281 LGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNC--------KCAKERDEYLKSH----LIGRYF-GCNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            +GA  P C+E G Y+ LQC GS   C+C D  G E +G  TP   S  +NC         C + RD     +    ++G +   C+  G Y   QCHGS   C+C D  G++  G++T
Sbjct:  856 VGAFIPQCDEEGQYRPLQCHGSTGHCWCVDNRGQERAGTRTPPG-SPPRNCDEPVRPKTHCEQHRDSLQSENGGVPVVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDNRGQERAGTRT 972          

HSP 2 Score: 58.9214 bits (141), Expect = 1.508e-9
Identity = 40/119 (33.61%), Postives = 56/119 (47.06%), Query Frame = 2
Query:  278 ILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNC--------KCAKERDEYLKSH----LIGRYF-GCNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            ++GA  P C+E G Y+  QC GS   C+C D  G E +G  TP   S   NC         C + RD          ++G +   C+  G Y   QCHGS   C+C D  G++  G++T
Sbjct: 1083 VVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDSRGQERAGTRTPPG-SPRVNCDQPVRSKTHCEQHRDSLQSGDGGVPVVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDNRGQERAGTRT 1200          

HSP 3 Score: 58.9214 bits (141), Expect = 1.669e-9
Identity = 40/119 (33.61%), Postives = 56/119 (47.06%), Query Frame = 2
Query:  278 ILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNC--------KCAKERDEYLKSH----LIGRYF-GCNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            ++GA  P C+E G Y+  QC GS   C+C D  G E +G  TP   S   NC        +C + RD           +G +   C+  G Y   QCHGS   C+C D  G++  G++T
Sbjct:  931 VVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDNRGQERAGTRTPPG-SPRVNCDQPVHLRTRCEQHRDSLQSGDGGVPAVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDNRGQERAGTRT 1048          

HSP 4 Score: 57.7658 bits (138), Expect = 4.042e-9
Identity = 40/118 (33.90%), Postives = 55/118 (46.61%), Query Frame = 2
Query:  281 LGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCK--------CAKERDEYLKSH----LIGRYF-GCNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            +GA  P C+E G Y+  QC GS   C+C D  G E +G  TP   S   NC         C + RD          ++G +   C+  G Y   QCHGS   C+C D  G++  G++T
Sbjct: 1008 VGAFIPQCDEEGQYRPQQCHGSTGHCWCVDNRGQERAGTRTPPG-SPRVNCDQPVRPKTHCEQHRDSLQSGDGGIPVVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDSRGQERAGTRT 1124          

HSP 5 Score: 53.9138 bits (128), Expect = 7.023e-8
Identity = 39/125 (31.20%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  278 ILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCK-----CAKERDEYL----KSHLIGRYFG----------CNHLGNYEKAQCHG--SVCYCADEDGKKVEGSQT 583
            ++GA  P C+E G Y+  QC GS   C+C D  G E +G  TP   S   NC         +R E +    ++ L+ +Y G          C+  G +   QC+G  S C+C D +G++V G+++
Sbjct: 1159 VVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDNRGQERAGTRTPPG-SPRVNCDQPVIVPPTQRPESVCERWRASLLQQYGGQPDSQHYLPQCDSAGEFNPVQCYGGSSYCWCVDANGREVPGTRS 1282          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Zebrafish
Match: nid2a (nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-030827-2])

HSP 1 Score: 59.6918 bits (143), Expect = 3.377e-10
Identity = 43/130 (33.08%), Postives = 62/130 (47.69%), Query Frame = 2
Query:  281 LGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCK--------CAKERDEYLKSH----LIGRYFG-CNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQTVHIVDFDKLKCD 619
            +GA  P C+E G Y+ LQC GS   C+C D  G E +G  TP   S  +NC         C + RD     +    ++G +   C+  G Y   QCHGS   C+C D  G++  G++T       ++ CD
Sbjct:   71 VGAFIPQCDEEGQYRPLQCHGSTGHCWCVDNRGQERAGTRTPP-GSPPRNCDEPVRPKTHCEQHRDSLQSENGGVPVVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDNRGQERAGTRT--PPGSPRVNCD 197          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Zebrafish
Match: nid2a (nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-030827-2])

HSP 1 Score: 58.9214 bits (141), Expect = 6.738e-10
Identity = 42/131 (32.06%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  278 ILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNC--------KCAKERDEYLKSH----LIGRYFG-CNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQTVHIVDFDKLKCD 619
            ++GA  P C+E G Y+  QC GS   C+C D  G E +G  TP   S   NC        +C + RD     +    ++G +   C+  G Y   QCHGS   C+C D  G++  G++T       ++ CD
Sbjct:   54 VVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDNRGQERAGTRTPP-GSPRVNCDQPVRPKTQCEQHRDSLQSGNDGVPVVGAFIPQCDEEGQYRTQQCHGSTGHCWCVDNRGQERAGTRT--PPGSPRVNCD 181          

HSP 2 Score: 57.7658 bits (138), Expect = 1.920e-9
Identity = 42/131 (32.06%), Postives = 60/131 (45.80%), Query Frame = 2
Query:  278 ILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNC--------KCAKERDEYLKS----HLIGRYFG-CNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQTVHIVDFDKLKCD 619
            ++GA  P C+E G Y+  QC GS   C+C D  G E +G  TP   S   NC        +C + RD           +G +   C+  G Y   QCHGS   C+C D  G++  G++T       ++ CD
Sbjct:  130 VVGAFIPQCDEEGQYRTQQCHGSTGHCWCVDNRGQERAGTRTPP-GSPRVNCDQPVRPKTQCEQHRDSLQSGDGGVPAVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDSRGQERAGTRT--PPGSPRVNCD 257          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Zebrafish
Match: nid2a (nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-030827-2])

HSP 1 Score: 55.4546 bits (132), Expect = 1.267e-8
Identity = 39/125 (31.20%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  278 ILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCK-----CAKERDEYL----KSHLIGRYFG----------CNHLGNYEKAQCHG--SVCYCADEDGKKVEGSQT 583
            ++GA  P C+E G Y+  QC GS   C+C D  G E +G  TP   S   NC         +R E +    ++ L+ +Y G          C+  G +   QC+G  S C+C D +G++V G+++
Sbjct:   14 VVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDSRGQERAGTRTPPG-SPRVNCDQPVIVPPTQRPESVCERWRASLLQQYGGQPDSQHYLPQCDSAGEFNPVQCYGGSSYCWCVDANGREVPGTRS 137          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Zebrafish
Match: nid2a (nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-030827-2])

HSP 1 Score: 55.0694 bits (131), Expect = 1.345e-8
Identity = 39/125 (31.20%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  278 ILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCK-----CAKERDEYL----KSHLIGRYFG----------CNHLGNYEKAQCHG--SVCYCADEDGKKVEGSQT 583
            ++GA  P C+E G Y+  QC GS   C+C D  G E +G  TP   S   NC         +R E +    ++ L+ +Y G          C+  G +   QC+G  S C+C D +G++V G+++
Sbjct:    5 VVGAFIPQCDEEGQYRTQQCHGSTGHCWCVDNRGQERAGTRTPPG-SPRVNCDQPVIVPPTQRPESVCERWRASLLQQYGGQPDSQHYLPQCDSAGEFNPVQCYGGSSYCWCVDANGREVPGTRS 128          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Xenopus
Match: nid2 (nidogen 2 [Source:NCBI gene;Acc:100036716])

HSP 1 Score: 66.6254 bits (161), Expect = 6.750e-12
Identity = 47/147 (31.97%), Postives = 69/147 (46.94%), Query Frame = 2
Query:  200 KVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKCAKERD-----EYLKSHLIGRYFG----------CNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            +VC E  + P C ++   +  R     +G   P C+  G+Y  LQC GS   C+C D  G EI+G  TP    A    +    R      E  K  LI  Y G          C+  G++   QCHG+   C+C D++G+++EGS+T
Sbjct: 1029 RVCPEPLKTP-CLEKRQQLHPRGPRPAVGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEITGTRTPPGRPAPNCGETEPTRRPQTVCERWKQSLIEHYGGKPGGEHYVPQCDQYGDFSPLQCHGNSGYCWCVDKEGREIEGSRT 1174          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Xenopus
Match: nid2 (nidogen 2 [Source:NCBI gene;Acc:100036716])

HSP 1 Score: 65.0846 bits (157), Expect = 2.252e-11
Identity = 45/155 (29.03%), Postives = 71/155 (45.81%), Query Frame = 2
Query:  185 GLSCDKVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRY-------FG-----------CNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            G  C ++   +     C ++   +  R     +G   P C+  G+Y  LQC GS   C+C D  G EI+G  TP    A     C +   E LK+ L  R+       +G           C+  G++   QCHG+   C+C D++G+++EGS+T
Sbjct:  870 GFQCTQILGPEPLKTPCLEKRQQLHPRGPRPAVGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEITGTRTPPGRPAP---NCGERGPEPLKTPLCERWKQSLIEHYGGKPGGEHYVPQCDQYGDFSPLQCHGNSGYCWCVDKEGREIEGSRT 1021          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Xenopus
Match: nid2 (nidogen 2 [Source:NCBI gene;Acc:100036716])

HSP 1 Score: 63.5438 bits (153), Expect = 6.620e-11
Identity = 46/148 (31.08%), Postives = 70/148 (47.30%), Query Frame = 2
Query:  206 CKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRY-------FG-----------CNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            C E  + P C ++   +  R     +G   P C+  G+Y  LQC GS   C+C D  G EI+G  TP    A     C +   E LK+ L  R+       +G           C+  G++   QCHG+   C+C D++G+++EGS+T
Sbjct:  886 CPEPLKTP-CLEKRQQLHPRGPRPAVGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEITGTRTPPGRPAP---NCGERGPEPLKTPLCERWKQSLIEHYGGKPGGEHYVPQCDQYGDFSPLQCHGNSGYCWCVDKEGREIEGSRT 1029          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Xenopus
Match: nid2 (nidogen 2 [Source:NCBI gene;Acc:100036716])

HSP 1 Score: 61.6178 bits (148), Expect = 3.319e-10
Identity = 45/155 (29.03%), Postives = 69/155 (44.52%), Query Frame = 2
Query:  185 GLSCDKVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNC----------KCAKERDEYL-------KSHLIGRYFG-CNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            G  C ++   +     C ++   +  R     +G   P C+  G+Y  LQC GS   C+C D  G EI+G  TP    A  NC           C + R + L           +G++   C+  GNY   QCHGS   C+C D+ G+++ G++T
Sbjct:  912 GFQCTQILGPEPLKTPCLEKRQQLHPRGPRPAVGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEITGTRTPPGRPA-PNCGETGPEPLKTPCLERRQQLLGQLHPRGPRPAVGQFVPECDAEGNYVSLQCHGSTGHCWCVDKLGEEIAGTRT 1065          

HSP 2 Score: 58.151 bits (139), Expect = 3.945e-9
Identity = 41/126 (32.54%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  263 RWKEHILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKCAKERD-----EYLKSHLIGRYFG----------CNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            R     +G   P C+  G+Y +LQC GS   C+C D  G EI+G  TP         +    R      E  K  LI  Y G          C+  G++   QCHG+   C+C D++G+++EGS+T
Sbjct: 1019 RGPRPAVGQFVPECDAEGNYVSLQCHGSTGHCWCVDKLGEEIAGTRTPPGRPGPNCGETEPTRRPQTVCERWKQSLIEHYGGKPGGEHYVPQCDQYGDFSPLQCHGNSGYCWCVDKEGREIEGSRT 1144          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Xenopus
Match: nid2 (nidogen 2 [Source:NCBI gene;Acc:100036716])

HSP 1 Score: 60.8474 bits (146), Expect = 4.750e-10
Identity = 46/142 (32.39%), Postives = 67/142 (47.18%), Query Frame = 2
Query:  242 QHLAVRRRWKEHILGAR------APSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRY-------FG-----------CNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            Q L   +R + H  G R       P C+  G+Y  LQC GS   C+C D  G EI+G  TP    A     C +   E LK+ L  R+       +G           C+  G++   QCHG+   C+C D++G+++EGS+T
Sbjct:  776 QILGTEKRQQLHPRGPRPAVGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEITGTRTPPGRPAP---NCGERGPEPLKTPLCERWKQSLIEHYGGKPGGEHYVPQCDQYGDFSPLQCHGNSGYCWCVDKEGREIEGSRT 914          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Mouse
Match: Nid2 (nidogen 2 [Source:MGI Symbol;Acc:MGI:1298229])

HSP 1 Score: 55.4546 bits (132), Expect = 2.211e-8
Identity = 36/117 (30.77%), Postives = 59/117 (50.43%), Query Frame = 2
Query:  296 PSCEENGDYKALQCVGSV--CYCSDINGVEISGFITP-----------IHLSANKNCKCAKERDEYLKSHLIG-----RYF-GCNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            P C++ G++  LQC GS   C+C D NG E+ G  TP              +      C + R+  L+ H  G     +Y   C+ LG++   QCHG    C+C D+DG++++G+++
Sbjct:  989 PQCDDQGNFVPLQCHGSTGFCWCVDRNGHEVPGTQTPPGSTPPHCGPPPEPTQRPRTVCERWRESLLE-HYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGRELQGTRS 1104          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Mouse
Match: Nid2 (nidogen 2 [Source:MGI Symbol;Acc:MGI:1298229])

HSP 1 Score: 53.5286 bits (127), Expect = 1.144e-7
Identity = 34/116 (29.31%), Postives = 56/116 (48.28%), Query Frame = 2
Query:  296 PSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKCAKERD------EYLKSHLIGRYFG----------CNHLGNYEKAQCHG--SVCYCADEDGKKVEGSQT 583
            P C++ G++  LQC GS   C+C D NG E+ G  TP   +        +         E  +  L+  Y G          C+ LG++   QCHG    C+C D+DG++++G+++
Sbjct:  724 PQCDDQGNFVPLQCHGSTGFCWCVDRNGHEVPGTQTPPGSTPPHCGPPPEPTQRPRTVCERWRESLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGRELQGTRS 839          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Mouse
Match: Tg (thyroglobulin [Source:MGI Symbol;Acc:MGI:98733])

HSP 1 Score: 52.373 bits (124), Expect = 2.669e-7
Identity = 32/104 (30.77%), Postives = 45/104 (43.27%), Query Frame = 2
Query:  296 PSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNC--KCAKERDEY---LKSHLIGRYF---GCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQT 583
            PSC   G Y+ +QC    C+C D  G E+ G            C  KC K+R +      +   G  F    C   G +   QC  S CYC D +G+ + G+Q+
Sbjct:  618 PSCTAGGSYEDIQCYAGECWCVDSRGKELDGSRVR---GGRPRCPTKCEKQRAQMQSLASAQPAGSSFFVPTCTREGYFLPVQCFNSECYCVDTEGQVIPGTQS 718          
BLAST of Nidogen 2a (osteonidogen) vs. UniProt/SwissProt
Match: sp|Q14112|NID2_HUMAN (Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=3)

HSP 1 Score: 59.6918 bits (143), Expect = 7.191e-9
Identity = 41/123 (33.33%), Postives = 63/123 (51.22%), Query Frame = 2
Query:  284 GAR--APSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKCAKERD-------EYLKSHLIGRYFG----------CNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            GAR   P C+E G++  LQC GS   C+C D +G E+ G  TP   S   +C  + E         E  + +L+  Y G          C+ LG++   QCHG    C+C D+DG++V+G+++
Sbjct:  955 GARFHIPQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPG-STPPHCGPSPEPTQRPPTICERWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRS 1076          
BLAST of Nidogen 2a (osteonidogen) vs. UniProt/SwissProt
Match: sp|F1RRV3|THYG_PIG (Thyroglobulin OS=Sus scrofa OX=9823 GN=TG PE=1 SV=5)

HSP 1 Score: 57.7658 bits (138), Expect = 2.881e-8
Identity = 32/104 (30.77%), Postives = 45/104 (43.27%), Query Frame = 2
Query:  296 PSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFG--------CNHLGNYEKAQCHGSVCYCADEDGKKVEGSQT 583
            PSC   G Y+ +QC    C+C D  G E++G            C  A E+       L+GR           C   G++   QC  S CYC D DG+ + G++T
Sbjct:  619 PSCTAEGSYEDVQCFAGECWCVDARGRELAGSRAR---GGRPRCPTACEKQRERMQSLLGRQPAGSSVFVPSCTREGHFLPVQCFSSDCYCVDADGQPIPGTRT 719          
BLAST of Nidogen 2a (osteonidogen) vs. UniProt/SwissProt
Match: sp|P31226|SAX_LITCT (Saxiphilin OS=Lithobates catesbeianus OX=8400 PE=1 SV=3)

HSP 1 Score: 57.3806 bits (137), Expect = 3.713e-8
Identity = 40/114 (35.09%), Postives = 61/114 (53.51%), Query Frame = 2
Query:  278 ILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLS-----ANKNCKCAKERDEYL--KSHLIGRYFG-CNHLGNYEKAQCHGSVCY--CADEDGKKVEGSQT 583
            ++G   P C+E G+Y+  QC GS   C+C +  G +ISG  TP   +      ++  KC KER   L     ++GR+   C+  GNYE  Q HGS  Y  C +  G+++ G++T
Sbjct:  122 MIGHYIPQCDEKGNYQPQQCHGSTGHCWCVNAMGEKISGTNTPPGQTRATCERHELPKCLKERQVALGGDEKVLGRFVPQCDEKGNYEPQQFHGSTGYSWCVNAIGEEIAGTKT 235          
BLAST of Nidogen 2a (osteonidogen) vs. UniProt/SwissProt
Match: sp|O88322|NID2_MOUSE (Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 1.546e-7
Identity = 36/117 (30.77%), Postives = 59/117 (50.43%), Query Frame = 2
Query:  296 PSCEENGDYKALQCVGSV--CYCSDINGVEISGFITP-----------IHLSANKNCKCAKERDEYLKSHLIG-----RYF-GCNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            P C++ G++  LQC GS   C+C D NG E+ G  TP              +      C + R+  L+ H  G     +Y   C+ LG++   QCHG    C+C D+DG++++G+++
Sbjct:  989 PQCDDQGNFVPLQCHGSTGFCWCVDRNGHEVPGTQTPPGSTPPHCGPPPEPTQRPRTVCERWRESLLE-HYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGRELQGTRS 1104          
BLAST of Nidogen 2a (osteonidogen) vs. UniProt/SwissProt
Match: sp|B5DFC9|NID2_RAT (Nidogen-2 OS=Rattus norvegicus OX=10116 GN=Nid2 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 4.011e-7
Identity = 36/117 (30.77%), Postives = 58/117 (49.57%), Query Frame = 2
Query:  296 PSCEENGDYKALQCVGSV--CYCSDINGVEISGFITP-----------IHLSANKNCKCAKERDEYLKSHLIG-----RYF-GCNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            P C++ G++  LQC GS   C+C D NG E+ G  TP              +      C + R+  L+ H  G     +Y   C+ LG++   QCHG    C+C D+DG+++ G+++
Sbjct:  982 PQCDDQGNFVPLQCHGSTGFCWCVDQNGHEVPGTQTPPGSTPPHCGPPPEPTQRPRTVCERWRESLLE-HYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGRELPGTRS 1097          
BLAST of Nidogen 2a (osteonidogen) vs. TrEMBL
Match: A0A194AKI3 (Uncharacterized protein OS=Pinctada fucata OX=50426 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.061e-24
Identity = 51/121 (42.15%), Postives = 74/121 (61.16%), Query Frame = 2
Query:  254 VRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKC 616
            ++ +    +LGA  PSC+  G Y+  QC GS CYC   NG EISG+   +  +    C+CA+++ EY+ S LIG++F C   G+Y+  QC G VC+CAD +G K++ S +VHI    KL C
Sbjct:  116 LKAQNGPSLLGAPTPSCDGEGYYQPKQCQGSQCYCVSKNGKEISGYTANVWEAQQMTCQCARDQAEYMASGLIGKFFYCTSDGSYQTYQCQGDVCFCADTNGVKMDHSPSVHISQVTKLNC 236          
BLAST of Nidogen 2a (osteonidogen) vs. TrEMBL
Match: A0A1S3IF36 (uncharacterized protein LOC106163748 OS=Lingula unguis OX=7574 GN=LOC106163748 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 4.733e-23
Identity = 49/119 (41.18%), Postives = 69/119 (57.98%), Query Frame = 2
Query:  260 RRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKC 616
            RR  + +LGA  P+C+ +G Y A QC+ + C+C + +G  +  +      + +  C CA++ DEY K  LIG+ + CN  GNYEK QC GSVCYC DE G K+E +  V I     L C
Sbjct:  112 RRQGQPLLGATPPTCDADGTYSAKQCIEASCFCVNKDGDRLGDYSARFWEAKDMTCNCARDEDEYQKKGLIGKMYICNENGNYEKYQCTGSVCYCVDEKGSKLESTPPVSISAVKTLNC 230          
BLAST of Nidogen 2a (osteonidogen) vs. TrEMBL
Match: A0A210PVS8 (Testican-3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04456 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 6.747e-23
Identity = 54/113 (47.79%), Postives = 71/113 (62.83%), Query Frame = 2
Query:  278 ILGARAPSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKC 616
            +LGA  P C+ENG Y+  QC GSVC C    G +I  +   I  S + NC+CA+++ EY+ + LIGR+F C   GNY+  QC GSVC+C D  G+ V G+QTV I D  KL C
Sbjct:  126 LLGAVEPLCDENGFYQPKQCEGSVCSCVSKTGRDILNYRADIWQSEDMNCQCARDQQEYMDTGLIGRFFYCTPNGNYQNHQCLGSVCHCIDNRGQMV-GTQTVSIGDLAKLSC 237          
BLAST of Nidogen 2a (osteonidogen) vs. TrEMBL
Match: A0A1S3J5E7 (equistatin-like OS=Lingula unguis OX=7574 GN=LOC106170269 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.357e-22
Identity = 48/119 (40.34%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  260 RRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKC 616
            RR  + +LGA  P+C+ +G Y A QC  + C+C + +G  +  +      + +  C CA++ DEY K  LIG+ + C   GNYEK QC GSVCYC DE G K+E +  V I     L C
Sbjct:   14 RRQGQPLLGATPPTCDADGTYSAKQCKEASCFCVNKDGDRLGDYSARFWEAKDMTCNCARDEDEYQKKGLIGKMYICKENGNYEKYQCTGSVCYCVDEKGSKLESTPPVSISAVKTLNC 132          
BLAST of Nidogen 2a (osteonidogen) vs. TrEMBL
Match: V4AXA0 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_238761 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 6.806e-20
Identity = 55/154 (35.71%), Postives = 85/154 (55.19%), Query Frame = 2
Query:  185 GLSCDKV--------CKEDTEAPDCF--KQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKC 616
            GL+CDK          K + + P C   ++    +++    +LGA  P C+ +G Y A+QC+GS C+C+   G  + G+     L+   +CKCA+++D Y K+ LIG+ F C   GNY   QC GSVC+C D +GK+V   Q+++I     L C
Sbjct:   80 GLTCDKSSFTCVKTQAKREDDFPSCADARKVFLDQKQNGGILLGAEEPKCDSDGTYSAVQCIGSQCHCTSAGGKNL-GYPVNRGLTQGMDCKCARDQDTYAKTGLIGKLFYCGPNGNYRNYQCVGSVCWCKDSNGKQV--GQSINIGLLSTLHC 230          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Cavefish
Match: nid2a (nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-030827-2])

HSP 1 Score: 65.4698 bits (158), Expect = 9.637e-12
Identity = 43/117 (36.75%), Postives = 59/117 (50.43%), Query Frame = 2
Query:  281 LGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNC--------KCAKERDEYLK---SHLIGRYF-GCNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            +GA  P C+E G Y+  QC GS   C+C DI G E  G  TP   S   NC        +C + RD   +   S  +G Y   C+  G Y + QCHGS   C+C D  G++ +G++T
Sbjct:  939 VGAFVPECDEQGQYRPQQCHGSTGHCWCVDIRGQERQGTRTPPG-SPQFNCDAPERPKTQCEQHRDSLQRGDGSPPVGAYVPQCDDQGQYRQQQCHGSTGHCWCVDSRGQERQGTRT 1054          

HSP 2 Score: 64.6994 bits (156), Expect = 1.622e-11
Identity = 48/157 (30.57%), Postives = 70/157 (44.59%), Query Frame = 2
Query:  200 KVCKEDTEAPDCFKQHLAVRRRWKEH-------------ILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNC--------KCAKERDEYLK---SHLIGRYF-GCNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            + C++  E   C  QH   + + ++H             + GA  P C+E G Y+  QC GS   C+C D  G E  G  TP   S   NC        +C + RD   +   S  +G Y   C+  G Y   QCHGS   C+C D  G++ +G++T
Sbjct:  752 RTCRDVDEYGHCHHQHERPKTQCEQHRDSLQRGSDDGLTLEGAFVPECDEQGQYRPQQCHGSTGHCWCVDSRGQERQGTRTPPG-SPQFNCDAPERPKTQCEQHRDSLQRGDGSPPVGAYVPQCDDQGQYRPQQCHGSTGHCWCVDSRGQERQGTRT 907          

HSP 3 Score: 57.3806 bits (137), Expect = 4.250e-9
Identity = 45/153 (29.41%), Postives = 70/153 (45.75%), Query Frame = 2
Query:  188 LSCDKVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKC---AKERDEYL----KSHLIGRYFG----------CNHLGNYEKAQCHG--SVCYCADEDGKKVEGSQT 583
             +CD   +  T+   C +   +++R      +GA  P C+E G Y+  QC GS   C+C D  G E  G  TP   S   NC       +R E +    ++ L+  Y G          C+  G +   QC+G  S C+C D DG++V G+++
Sbjct: 1061 FNCDAPERPKTQ---CEQHRDSLQRGDGSPPIGAYVPQCDEQGQYRPQQCHGSTGHCWCVDSRGQERQGTRTPPGTSP-YNCDAPVVPTQRPETVCERWRASLLEHYGGRPSPQQYLPQCDSAGEFNPVQCYGDSSYCWCVDRDGREVAGTRS 1209          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Cavefish
Match: nid2b (nidogen 2b (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-040724-143])

HSP 1 Score: 56.6102 bits (135), Expect = 8.602e-9
Identity = 38/116 (32.76%), Postives = 58/116 (50.00%), Query Frame = 2
Query:  296 PSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKC------AKERDEYLKSHLIGRYFG----------CNHLGNYEKAQCHG--SVCYCADEDGKKVEGSQT 583
            P C+E G YK LQC+GS   C+C D  G E  G  T +  +A+ NC        A+   E  ++ L+  Y G          C+  G++   QC+G  S C+C D  G++V G+++
Sbjct:  722 PQCDEKGQYKPLQCLGSTGHCWCVDSRGQERVGTRT-LPGTAHANCDQPPLVPRAETLCERWRTTLLSHYGGQPDPQDYMPQCDARGHFLSVQCYGNSSYCWCVDSQGREVMGTRS 836          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Cavefish
Match: tg (thyroglobulin [Source:NCBI gene;Acc:103037495])

HSP 1 Score: 53.1434 bits (126), Expect = 1.076e-7
Identity = 33/94 (35.11%), Postives = 44/94 (46.81%), Query Frame = 2
Query:  296 PSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNCKCAKERDEYL----KSHLIGRYF--GCNHLGNYEKAQCHGSVCYCADEDG 559
            P C E+G Y+A+QC GS C+C+D  G E+ G  + I        +C KER   +     S      F   C   G Y   QC G  C+C D+ G
Sbjct:  627 PQCTEDGQYQAVQCQGSECWCADSQGQEVMGSRS-IGYRPRCPSRCEKERMMAIAVKASSSAGSEVFIPKCEEDGEYVSLQCLGKSCFCLDQRG 719          

HSP 2 Score: 48.9062 bits (115), Expect = 2.626e-6
Identity = 36/115 (31.30%), Postives = 52/115 (45.22%), Query Frame = 2
Query:  272 EHILGARAPSCEENGDYKALQC-VGSVCYCSDINGVEISGF---------ITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQ 580
            EHI     P C E+G Y+ +QC  G  C+C + +G EI G          +TP          C  +R   L S   G    C   G YE  QC G++  C+C D +G ++ G++
Sbjct:   78 EHI-----PQCSEDGRYRYVQCNRGGECWCVNSDGTEIPGSRQNDTVVTCLTP----------CQLQRQRLLLSGDAGVVPRCLDSGEYEPVQCDGALGQCWCVDMEGMEIYGTR 177          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Sea Lamprey
Match: tg (thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1])

HSP 1 Score: 50.0618 bits (118), Expect = 2.730e-7
Identity = 34/100 (34.00%), Postives = 47/100 (47.00%), Query Frame = 2
Query:  305 EENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNC--KCAKERDEYLKSHLIGRYFG-------CNHLGNYEKAQCHGSVCYCADEDGKKVEGS 577
            E+ G Y+ +QC G+ C+C D +G EI+G  T     A   C   C  ER   L +   GR  G       C+  G+Y   QC G  C+C    G +V G+
Sbjct:  612 EDGGAYEPVQCHGAACWCVDAHGREIAG--TRAVGGAPPRCPSACEGERARALLARR-GRPVGTPLFVPECDGAGDYRPVQCSGDRCFCVGAGGAEVPGT 708          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Nematostella
Match: EDO47797 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL43])

HSP 1 Score: 58.5362 bits (140), Expect = 1.427e-10
Identity = 37/110 (33.64%), Postives = 57/110 (51.82%), Query Frame = 2
Query:  296 PSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLS----ANKNCKCAKERDEYLKSHLIG-----RYFG-CNHLGNYEKAQCH--GSVCYCADEDGKKVEGSQT 583
            P+C ++G +  +QC G    C+C D+NG+EI G +T  H      A +   C ++R   L   L G     RY   C   G YE+ QCH    +C+C DE G+++  ++T
Sbjct:    3 PTCRDDGSFAEVQCHGLTGQCWCVDMNGIEIPGSVTRGHRPDCKKAAQTTSCQRQRTAALG--LTGRPNSARYLPQCKPTGRYEEVQCHTGTGLCWCVDERGQEITRTRT 110          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Nematostella
Match: EDO39095 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB04])

HSP 1 Score: 53.9138 bits (128), Expect = 3.740e-9
Identity = 36/117 (30.77%), Postives = 55/117 (47.01%), Query Frame = 2
Query:  278 ILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNC-----KCAKERDEYLKS-----HLIGRYF-GCNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            ++G   P C   G+YK +QC GS   C+C D  G  + G I       N +       C  +R   L+        +GR+   C+  G YEK QC GS+  C+C D  G +++G++ 
Sbjct:    3 VVGKYIPQCTPEGEYKQVQCYGSTGYCWCVDQMGSPVLGTIVRGVPQCNSSAVGGMTNCQTKRAAALQGSQGGLQPVGRFLPSCDVKGAYEKIQCWGSIGFCWCVDSSGNEIKGTRV 119          

HSP 2 Score: 48.1358 bits (113), Expect = 5.305e-7
Identity = 33/93 (35.48%), Postives = 44/93 (47.31%), Query Frame = 2
Query:  281 LGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSH--LIGRYFG-CNHLGNYEKAQCHGSVCYC 544
            +G   PSC+  G Y+ +QC GS+  C+C D +G EI G       S +           + +S   LIG Y   C+  G Y   QCHGS  YC
Sbjct:   79 VGRFLPSCDVKGAYEKIQCWGSIGFCWCVDSSGNEIKGTRVRGTPSCDTTPAPTASGKHWAQSRGPLIGAYIPQCDKDGRYSALQCHGSTGYC 171          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Nematostella
Match: EDO38469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCV6])

HSP 1 Score: 52.7582 bits (125), Expect = 1.601e-8
Identity = 39/111 (35.14%), Postives = 51/111 (45.95%), Query Frame = 2
Query:  284 GARAPSCEENGDYKALQCVGSVCYC---SDINGVEISGFITPIHLSANKNC------KCAKERDEYLKSHLIGRYFG-CNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQ 580
            G   P C   G +  +QC GS  YC      NG E++G           +C      KC +   + L    IGR+   C   GNYEK QCHGS   C+C D DG ++ GS+
Sbjct:   74 GRFVPLCTSEGKFADVQCHGSTGYCWCAHPDNGQEVTG----TRQRGQPDCSDVALSKCQRHYRDNLIYPPIGRFLPTCKPDGNYEKMQCHGSTGFCWCVDADGAELVGSR 180          

HSP 2 Score: 51.6026 bits (122), Expect = 4.165e-8
Identity = 41/114 (35.96%), Postives = 57/114 (50.00%), Query Frame = 2
Query:  281 LGARAPSCEENGDYKALQCVGSV--CYCSDINGVE-----ISGFITPIHLSANKNCKCAKERDEYLKSHLI---GRYFG-CNHLGNYEKAQCHGSV--CYCADED-GKKVEGSQ 580
            +G   P C+ NG+Y  +QC GS   C+C D++GVE     I G      L ANK   C  + +  L    I   GR+   C   G +   QCHGS   C+CA  D G++V G++
Sbjct:    1 IGRFLPKCKPNGNYDEVQCHGSTGFCWCVDMDGVELLGSKIRGPPNCTALGANKTV-CQSQLEAALGPDGIASPGRFVPLCTSEGKFADVQCHGSTGYCWCAHPDNGQEVTGTR 113          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Nematostella
Match: EDO40373 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7C4])

HSP 1 Score: 52.373 bits (124), Expect = 1.873e-8
Identity = 35/110 (31.82%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  284 GARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFIT---PIHLSANKNCKCAKERDEYLKSHLI---GRYF-GCNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQ 580
            G+  P C+ +GDY  +QC GS   C+C D +G EI        P+        +C +ER  ++    I   GR+   C   G YE+ QCH S   C+C D+ G+++  ++
Sbjct:   75 GSFVPKCKSSGDYDTVQCHGSTGFCWCVDDDGNEIPATRVRGRPMCGLLAGLSQCQQERQRHMGVLGIAPPGRFVPACTSTGQYERVQCHSSTGYCWCVDKFGRELPNTR 184          

HSP 2 Score: 47.7506 bits (112), Expect = 8.507e-7
Identity = 32/118 (27.12%), Postives = 53/118 (44.92%), Query Frame = 2
Query:  278 ILGARAPSCEENGDYKALQC--VGSVCYCSDINGVEISGFITPIHLSANKNC--------KCAKERD---EYLKSHLIGRYFG-CNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            + G   P C  +G Y+++QC  +   C+C D +G E+ G      +   + C         C KER     +      G +   C   G+Y+  QCHGS   C+C D+DG ++  ++ 
Sbjct:    1 VTGLWVPDCRPDGSYESVQCHALSGYCWCVDRSGHELFG----TRVRGKRTCDKIKAGLTMCQKERQIAIGWTGVAAPGSFVPKCKSSGDYDTVQCHGSTGFCWCVDDDGNEIPATRV 114          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Nematostella
Match: EDO40370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7C1])

HSP 1 Score: 51.9878 bits (123), Expect = 2.362e-8
Identity = 37/106 (34.91%), Postives = 49/106 (46.23%), Query Frame = 2
Query:  290 RAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFIT--PIHLSANKNCKCAKERDE---YLKSHLIGRYFG-CNHLGNYEKAQCHGSV--CYCADEDGKKVEGS 577
            R P+C  +G Y  +QC  S   C+CS  +G E  G  T   +   AN+   C K R           +G Y   C   G+YE  QCH     C+C DEDGK+  G+
Sbjct:   90 RVPNCRPDGSYSRVQCDKSTGECWCSSEDGSETPGTRTSGTLRCPANEFSACQKHRHRVQGMTGQAPVGAYVPRCADDGSYETVQCHDGTRYCWCVDEDGKERPGT 195          

HSP 2 Score: 51.2174 bits (121), Expect = 4.337e-8
Identity = 33/104 (31.73%), Postives = 51/104 (49.04%), Query Frame = 2
Query:  296 PSCEENGDYKALQC-VGS-VCYCSDINGVEISGFITPIHLS----ANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            P C+ +G Y+ +QC  G+  C+C D  GVE+ G  T   +       +   C + + E L S    R   C   G+Y + QC  S   C+C+ EDG +  G++T
Sbjct:   24 PHCKSDGRYEEVQCHTGTKYCWCVDEKGVEVWGTRTRTFIRCAAFVKEPTPCQRAKGEALLSPETKRVPNCRPDGSYSRVQCDKSTGECWCSSEDGSETPGTRT 127          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Medaka
Match: nid2a (nidogen 2 [Source:NCBI gene;Acc:101173773])

HSP 1 Score: 54.6842 bits (130), Expect = 3.133e-8
Identity = 41/136 (30.15%), Postives = 61/136 (44.85%), Query Frame = 2
Query:  239 KQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCK-----------CAKERDEYLKSHLIGRYFG------CNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            ++H+    R     +GA  P C++NG+Y   QC  S   C+C D  G E SG  +    S + +C            C + R+  L S   GR         C+  G+Y   QCHGS   C+C D  G++  G++T
Sbjct:  926 REHVLASEREDRPSVGAYVPQCDQNGEYVPQQCHTSTGYCWCVDGMGQERSGTRSAPG-SPSMDCSKPDEALQPKTPCERLRESVLASSAGGRPLAGAYAPQCDEDGHYVPRQCHGSSGYCWCVDSSGQERPGTRT 1060          

HSP 2 Score: 50.8322 bits (120), Expect = 6.503e-7
Identity = 43/140 (30.71%), Postives = 63/140 (45.00%), Query Frame = 2
Query:  233 CFKQHLAVRRRWKEH--ILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNC-----------KCAKERDEYLKSHL-----IGRYF-GCNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            C     +V+R  +E   +LG   P C+E+G Y   QC  S   C+C D  G E +G  TP   SA  +C           +C + R+  L S       +G Y   C+  G Y   QCH S   C+C D  G++  G+++
Sbjct:  842 CEHHRESVQRTTEEGAPLLGVYVPQCDESGKYLPQQCHDSTGYCWCVDSTGQERTGTRTPPG-SALVDCSRTDEQPHYKTRCERHREHVLASEREDRPSVGAYVPQCDQNGEYVPQQCHTSTGYCWCVDGMGQERSGTRS 980          

HSP 3 Score: 47.7506 bits (112), Expect = 6.293e-6
Identity = 35/124 (28.23%), Postives = 56/124 (45.16%), Query Frame = 2
Query:  284 GARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNCKCAKERD----------EYLKSHLIGRYFG----------CNHLGNYEKAQCHG--SVCYCADEDGKKVEGSQT 583
            G   P C+  G Y + QC GS   C+C D  G E  G  TP  + A  +C    E +          E  ++ L+  Y G          C   G +   QC+G  + C+C D+DG++++G+++
Sbjct: 1101 GRFVPQCDAEGRYLSQQCHGSTGHCWCVDSRGQERPGTRTPPGV-AQVDCYQRPEPEPPYTRPESVCERWRASLMEHYGGKPQPQQYLPQCRSDGEFSPVQCYGETTYCWCVDQDGREIDGTRS 1223          
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Medaka
Match: nid2a (nidogen 2 [Source:NCBI gene;Acc:101173773])

HSP 1 Score: 53.9138 bits (128), Expect = 6.984e-8
Identity = 41/132 (31.06%), Postives = 60/132 (45.45%), Query Frame = 2
Query:  239 KQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFIT-PIHLSAN------KNCKCAKERDEYLKSHLIGRYFG------CNHLGNYEKAQCHGS--VCYCADEDGKKVEGSQT 583
            ++H+    R     +GA  P C++NG+Y   QC  S   C+C D  G E SG  + P   S +          C + R+  L S   GR         C+  G+Y   QCHGS   C+C D  G++  G++T
Sbjct:  847 REHVLASEREDRPSVGAYVPQCDQNGEYVPQQCHTSTGYCWCVDGMGQERSGTRSAPGSPSMDCSKPGAPKTPCERLRESVLASSAGGRPLAGAYAPQCDEDGHYVPRQCHGSSGYCWCVDSSGQERPGTRT 978          

HSP 2 Score: 49.6766 bits (117), Expect = 1.579e-6
Identity = 40/119 (33.61%), Postives = 56/119 (47.06%), Query Frame = 2
Query:  278 ILGARAPSCEENGDYKALQCVGS--VCYCSDINGVEISGFIT-PIHLSAN--------KNCKCAKERDEYLKSHLI---GRYFG-CNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            + GA AP C+E+G Y   QC GS   C+C D +G E  G  T P   S +          C+  +ER        +   GR+   C+  G Y   QCHGS   C+C D  G++  G++T
Sbjct:  937 LAGAYAPQCDEDGHYVPRQCHGSSGYCWCVDSSGQERPGTRTSPGAPSVDCKEPEAPKTECELLRERAMASSPEAVPAAGRFVPQCDAEGRYLSQQCHGSTGHCWCVDSRGQERPGTRT 1055          

HSP 3 Score: 48.9062 bits (115), Expect = 2.981e-6
Identity = 42/131 (32.06%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  251 AVRRRWKE--HILGARAPSCEENGDYKALQCVGSV--CYCSDINGVEISGFITPIHLSANKNC--------KCAKERDEYLKSHL-----IGRYFG-CNHLGNYEKAQCHGSV--CYCADEDGKKVEGSQT 583
            +V+R  +E   +LG   P C+E+G Y   QC  S   C+C D  G E +G  TP   SA  +C        +C + R+  L S       +G Y   C+  G Y   QCH S   C+C D  G++  G+++
Sbjct:  772 SVQRTTEEGAPLLGVYVPQCDESGKYLPQQCHDSTGYCWCVDSTGQERTGTRTPPG-SALVDCNEQPHYKTRCERHREHVLASEREDRPSVGAYVPQCDQNGEYVPQQCHTSTGYCWCVDGMGQERSGTRS 901          
BLAST of Nidogen 2a (osteonidogen) vs. Planmine SMEST
Match: SMESG000016993.1 (SMESG000016993.1)

HSP 1 Score: 330.102 bits (845), Expect = 4.080e-116
Identity = 177/179 (98.88%), Postives = 178/179 (99.44%), Query Frame = 2
Query:   83 MLKIFVAFSLFCGIFSALLXXXXXXXXXXXXXXYGLSCDKVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKCD 619
            MLKIFVAFSLFCGIFSALLEEFEVCENNENVCNYGLSCDKVCKEDTEAPDCFKQHL+VRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSD NGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKCD
Sbjct:    1 MLKIFVAFSLFCGIFSALLEEFEVCENNENVCNYGLSCDKVCKEDTEAPDCFKQHLSVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDKNGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKCD 179          
BLAST of Nidogen 2a (osteonidogen) vs. Planmine SMEST
Match: SMESG000016992.1 (SMESG000016992.1)

HSP 1 Score: 318.161 bits (814), Expect = 2.164e-111
Identity = 172/179 (96.09%), Postives = 174/179 (97.21%), Query Frame = 2
Query:   83 MLKIFVAFSLFCGIFSALLXXXXXXXXXXXXXXYGLSCDKVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKCD 619
            MLKIFVAFSLFCGIFSALLEEFEVCENNENVCNYGLSCDKVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSD NGVEISGFITPIHLSANKNCKCAKERDEY K HLIGR+F C+ LGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKCD
Sbjct:    1 MLKIFVAFSLFCGIFSALLEEFEVCENNENVCNYGLSCDKVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDKNGVEISGFITPIHLSANKNCKCAKERDEYHKKHLIGRFFRCSELGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKCD 179          
BLAST of Nidogen 2a (osteonidogen) vs. Planmine SMEST
Match: SMESG000016994.1 (SMESG000016994.1)

HSP 1 Score: 206.838 bits (525), Expect = 1.637e-67
Identity = 110/180 (61.11%), Postives = 140/180 (77.78%), Query Frame = 2
Query:   83 MLKIFVAFSLFCG-IFSALLXXXXXXXXXXXXXXYGLSCDKVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKCD 619
            MLKIFV  SLF   +F  +LEEF++C N E+ CNYGL C+++C+ED EAPDCFK+HL VRR+    ++G R P+CEENGDYK +QC+GSVC+C D +G  I GF +PI+ S NK CKCAK+RDEY K  LIGRYFGC++ GNY++ QCHGSVC+CADE+GKK  GS TV+I   D+LKC+
Sbjct:    1 MLKIFV-ISLFASCVFCEVLEEFQLCLNEEDKCNYGLFCNEICEEDEEAPDCFKKHLDVRRKLANKVIGIRLPNCEENGDYKPVQCLGSVCHCVDKHGERIEGFSSPIYKSTNKTCKCAKDRDEYQKLRLIGRYFGCDNQGNYKRTQCHGSVCFCADENGKKTSGSPTVNIGQLDQLKCE 179          
BLAST of Nidogen 2a (osteonidogen) vs. Planmine SMEST
Match: SMESG000016991.1 (SMESG000016991.1)

HSP 1 Score: 201.06 bits (510), Expect = 7.633e-66
Identity = 114/115 (99.13%), Postives = 114/115 (99.13%), Query Frame = 2
Query:   83 MLKIFVAFSLFCGIFSALLXXXXXXXXXXXXXXYGLSCDKVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNC 427
            MLKIFVAFSLFCGIFSALLEEFEVCENNENVCNYGLSCDKVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSD NGVEISGFITPIHLSANKNC
Sbjct:    1 MLKIFVAFSLFCGIFSALLEEFEVCENNENVCNYGLSCDKVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDKNGVEISGFITPIHLSANKNC 115          
BLAST of Nidogen 2a (osteonidogen) vs. Planmine SMEST
Match: SMESG000016977.1 (SMESG000016977.1)

HSP 1 Score: 112.849 bits (281), Expect = 7.455e-31
Identity = 55/138 (39.86%), Postives = 80/138 (57.97%), Query Frame = 2
Query:  206 CKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDINGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKCD 619
            C ++     CF +   + +  K  +LGA  P C+ NGD+  +QC GS CYC D  G  I  +   I+  AN +CKCA+E+++Y  + LIG+ F C   G+Y   QC+GSVC+CAD +GK V G   V+I     L+C+
Sbjct:   41 CSDNPLNTQCFNK---LSKARKGGLLGAPIPKCDSNGDFLPVQCTGSKCYCVDREGNNIRNYAAHINEFANMDCKCAREQNDYFLTGLIGKMFSCTTNGSYSSVQCNGSVCFCADYNGKAVAGKPIVNIGQIQSLRCN 175          
The following BLAST results are available for this feature:
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NID21.497e-933.33nidogen 2 [Source:HGNC Symbol;Acc:HGNC:13389][more]
NID22.271e-933.33nidogen 2 [Source:HGNC Symbol;Acc:HGNC:13389][more]
NID22.607e-933.33nidogen 2 [Source:HGNC Symbol;Acc:HGNC:13389][more]
back to top
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nid2a1.766e-1034.75nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
nid2a3.377e-1033.08nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
nid2a6.738e-1032.06nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
nid2a1.267e-831.20nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
nid2a1.345e-831.20nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nid26.750e-1231.97nidogen 2 [Source:NCBI gene;Acc:100036716][more]
nid22.252e-1129.03nidogen 2 [Source:NCBI gene;Acc:100036716][more]
nid26.620e-1131.08nidogen 2 [Source:NCBI gene;Acc:100036716][more]
nid23.319e-1029.03nidogen 2 [Source:NCBI gene;Acc:100036716][more]
nid24.750e-1032.39nidogen 2 [Source:NCBI gene;Acc:100036716][more]
back to top
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Nid22.211e-830.77nidogen 2 [Source:MGI Symbol;Acc:MGI:1298229][more]
Nid21.144e-729.31nidogen 2 [Source:MGI Symbol;Acc:MGI:1298229][more]
Tg2.669e-730.77thyroglobulin [Source:MGI Symbol;Acc:MGI:98733][more]
back to top
BLAST of Nidogen 2a (osteonidogen) vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14112|NID2_HUMAN7.191e-933.33Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=... [more]
sp|F1RRV3|THYG_PIG2.881e-830.77Thyroglobulin OS=Sus scrofa OX=9823 GN=TG PE=1 SV=... [more]
sp|P31226|SAX_LITCT3.713e-835.09Saxiphilin OS=Lithobates catesbeianus OX=8400 PE=1... [more]
sp|O88322|NID2_MOUSE1.546e-730.77Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV... [more]
sp|B5DFC9|NID2_RAT4.011e-730.77Nidogen-2 OS=Rattus norvegicus OX=10116 GN=Nid2 PE... [more]
back to top
BLAST of Nidogen 2a (osteonidogen) vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A194AKI31.061e-2442.15Uncharacterized protein OS=Pinctada fucata OX=5042... [more]
A0A1S3IF364.733e-2341.18uncharacterized protein LOC106163748 OS=Lingula un... [more]
A0A210PVS86.747e-2347.79Testican-3 OS=Mizuhopecten yessoensis OX=6573 GN=K... [more]
A0A1S3J5E71.357e-2240.34equistatin-like OS=Lingula unguis OX=7574 GN=LOC10... [more]
V4AXA06.806e-2035.71Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nid2a9.637e-1236.75nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
nid2b8.602e-932.76nidogen 2b (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
tg1.076e-735.11thyroglobulin [Source:NCBI gene;Acc:103037495][more]
back to top
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tg2.730e-734.00thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1][more]
back to top
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO477971.427e-1033.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390953.740e-930.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384691.601e-835.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403731.873e-831.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403702.362e-834.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nidogen 2a (osteonidogen) vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nid2a3.133e-830.15nidogen 2 [Source:NCBI gene;Acc:101173773][more]
nid2a6.984e-831.06nidogen 2 [Source:NCBI gene;Acc:101173773][more]
back to top
BLAST of Nidogen 2a (osteonidogen) vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016993.14.080e-11698.88SMESG000016993.1[more]
SMESG000016992.12.164e-11196.09SMESG000016992.1[more]
SMESG000016994.11.637e-6761.11SMESG000016994.1[more]
SMESG000016991.17.633e-6699.13SMESG000016991.1[more]
SMESG000016977.17.455e-3139.86SMESG000016977.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028912 ID=SMED30028912|Name=Nidogen 2a (osteonidogen)|organism=Schmidtea mediterranea sexual|type=transcript|length=756bp
GCGACTGCTGTTCAGTCGCACCTAATTAGGCGATTATCTCGCATATATAA
GCCACATCTGAATGCATTTTCATCAGTAAAACATGCTGAAAATATTCGTT
GCCTTTTCTCTGTTTTGCGGAATATTCTCTGCGTTACTCGAAGAATTTGA
AGTTTGTGAAAATAATGAAAATGTCTGCAATTACGGATTGAGTTGCGATA
AAGTTTGCAAGGAAGATACCGAAGCTCCCGACTGTTTCAAGCAACATCTC
GCTGTCAGACGAAGATGGAAGGAACACATTCTAGGAGCAAGAGCTCCGAG
TTGTGAAGAAAACGGCGATTACAAAGCGCTCCAATGCGTTGGATCAGTAT
GTTACTGCTCAGACATAAACGGAGTAGAGATCAGCGGATTCATAACGCCT
ATTCATTTGTCTGCCAATAAAAACTGCAAATGTGCCAAAGAACGAGATGA
GTACCTTAAATCACATCTGATTGGCCGATATTTCGGTTGCAACCATCTAG
GAAATTACGAAAAGGCTCAATGTCACGGATCAGTGTGCTACTGTGCCGAT
GAGGATGGAAAGAAAGTTGAAGGATCCCAAACTGTTCATATCGTAGATTT
TGATAAATTAAAATGTGATTAATAAAATATAAAATATAGTTAATTTTCAG
TTTTGATTGTTCTATTTTAATTTTCTCACTTTCAATATTGTTTATCAACT
CGAACCTTGACCTTTGATCTCAGGAAGTTTGCACAAGAAATCCCTGCTTT
TCAAAC
back to top

protein sequence of SMED30028912-orf-1

>SMED30028912-orf-1 ID=SMED30028912-orf-1|Name=SMED30028912-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=180bp
MLKIFVAFSLFCGIFSALLEEFEVCENNENVCNYGLSCDKVCKEDTEAPD
CFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDINGVEI
SGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGS
VCYCADEDGKKVEGSQTVHIVDFDKLKCD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007160cell-matrix adhesion
GO:0007411axon guidance
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000067goblet cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000419prepharyngeal region
PLANA:0000421tail
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036857Thyroglobulin_1_sf
IPR000716Thyroglobulin_1
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000716Thyroglobulin type-1SMARTSM00211TY_2coord: 133..168
e-value: 0.0021
score: 27.3
coord: 71..121
e-value: 1.1E-4
score: 31.6
IPR000716Thyroglobulin type-1PFAMPF00086Thyroglobulin_1coord: 136..168
e-value: 4.5E-8
score: 32.6
coord: 67..103
e-value: 1.0E-8
score: 34.7
IPR000716Thyroglobulin type-1PROSITEPS51162THYROGLOBULIN_1_2coord: 48..115
score: 9.031
IPR000716Thyroglobulin type-1PROSITEPS51162THYROGLOBULIN_1_2coord: 116..178
score: 7.612
IPR000716Thyroglobulin type-1CDDcd00191TYcoord: 59..102
e-value: 1.52358E-7
score: 44.7621
IPR000716Thyroglobulin type-1CDDcd00191TYcoord: 116..167
e-value: 8.71791E-8
score: 45.1473
IPR036857Thyroglobulin type-1 superfamilyGENE3DG3DSA:4.10.800.10coord: 117..175
e-value: 7.5E-9
score: 36.8
coord: 50..116
e-value: 3.4E-10
score: 41.1
IPR036857Thyroglobulin type-1 superfamilySUPERFAMILYSSF57610Thyroglobulin type-1 domaincoord: 117..170
IPR036857Thyroglobulin type-1 superfamilySUPERFAMILYSSF57610Thyroglobulin type-1 domaincoord: 51..117
NoneNo IPR availablePANTHERPTHR12352SECRETED MODULAR CALCIUM-BINDING PROTEINcoord: 25..106
coord: 112..168
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.732