SMED30028892

Overview
NameSMED30028892
Smed IDSMED30028892
Length (bp)327
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30028892 (SMED30028892) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30028892 (SMED30028892) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028892

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30028892h1SMcG0016241 Contig4650newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028892h1SMcG0016241 Contig4650uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028892h1SMcG0020555 Contig4650newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028892h1SMcG0020555 Contig4650uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028892h1SMcG0020555 dd_Smed_v4_8271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30028892h1SMcG0020555 dd_Smed_v4_7137_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028892h1SMcG0020555 Contig12277newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028892h1SMcG0020555 Contig12277uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
ovarySMED30028892h1SMcG0016193 Contig4649uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30028892h1SMcG0016193 Contig4649newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30028892h1SMcG0016193 Contig4649uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30028892h1SMcG0016193 Contig4649newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30028892h1SMcG0016196 Contig4649uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30028892h1SMcG0016196 Contig4649newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30028892h1SMcG0016196 Contig4649uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30028892h1SMcG0016196 Contig4649newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30028892h1SMcG0020555 Contig4649uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30028892h1SMcG0020555 Contig4649newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30028892h1SMcG0020555 Contig4649uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30028892h1SMcG0020555 Contig4649newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Category 3 cellSMED30028892h1SMcG0020555 dd_Smed_v4_8271_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30028892 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001385:36877..39752 +1566
Homology
BLAST of SMED30028892 vs. Ensembl Human
Match: ANKK1 (ankyrin repeat and kinase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:21027])

HSP 1 Score: 65.4698 bits (158), Expect = 3.426e-13
Identity = 31/106 (29.25%), Postives = 49/106 (46.23%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL H  ++DC+T  G  P+    + +  DL  LLL    D    D+ GW P+H A    D  T+ LL +    ++ + ++   P+H A       +  LL+ R  D
Sbjct:  381 LLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQAD 486          

HSP 2 Score: 47.3654 bits (111), Expect = 6.949e-7
Identity = 25/107 (23.36%), Postives = 50/107 (46.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            L      +D +  + + P+   +E   +  ++ LL      +  D+SG+ P+H A  +  +   ++L     ++E  T Q   P+H A  K + EI +LL E + ++
Sbjct:  513 LTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANM 619          

HSP 3 Score: 45.4394 bits (106), Expect = 4.032e-6
Identity = 24/108 (22.22%), Postives = 48/108 (44.44%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL H  + +    DG  P+ F  ++ +    +LLLD    ++ +++ GW P+H A        + LL +R  +      +   P+H A    +  +  LL  +  +++
Sbjct:  414 LLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELD 521          
BLAST of SMED30028892 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 62.003 bits (149), Expect = 7.149e-12
Identity = 28/107 (26.17%), Postives = 56/107 (52.34%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++  + +  T  G   +    +  ++D++ LLL RN ++   +KSG  P+H A  ++    +E+L N+  +++ +TK    P+H      N +I N LL+ +  +
Sbjct:  644 LLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKV 750          

HSP 2 Score: 56.225 bits (134), Expect = 6.831e-10
Identity = 28/107 (26.17%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +T+  L P+H      + ++  +LL+R   I
Sbjct:  215 LLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPI 321          

HSP 3 Score: 54.6842 bits (130), Expect = 2.029e-9
Identity = 29/108 (26.85%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + + G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  248 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD 355          

HSP 4 Score: 51.6026 bits (122), Expect = 3.026e-8
Identity = 22/104 (21.15%), Postives = 51/104 (49.04%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN 312
            LL  N N++     G  P+    +   +++ ++L+++   ++ + K G+ P+H   +  + +    L   +  +  +TK    P+H A  + ++ I N+LL+ N
Sbjct:  677 LLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNN 780          

HSP 5 Score: 50.8322 bits (120), Expect = 5.064e-8
Identity = 28/106 (26.42%), Postives = 49/106 (46.23%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDH  ++   T  G  P+    +   +++  LLL ++   +   KSG  P+H A + ++ + + LL ++  +     K    P+H A  K   +I   LLE   D
Sbjct:  545 LLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGAD 650          

HSP 6 Score: 49.6766 bits (117), Expect = 1.180e-7
Identity = 29/106 (27.36%), Postives = 51/106 (48.11%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLD    ID +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A    + ++  +LL++  +
Sbjct:  281 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAN 386          

HSP 7 Score: 47.7506 bits (112), Expect = 5.423e-7
Identity = 29/101 (28.71%), Postives = 47/101 (46.53%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            LL HN  +D  TND    +       +  + K+LLD+  +   +  +G+ P+H A  K   +  ELL     +I+  T+  L PIH A    +  I + L+
Sbjct:  347 LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 447          

HSP 8 Score: 47.3654 bits (111), Expect = 7.258e-7
Identity = 23/76 (30.26%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  214 LLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKID 289          

HSP 9 Score: 46.595 bits (109), Expect = 1.563e-6
Identity = 26/103 (25.24%), Postives = 45/103 (43.69%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL    + +  T  G  P+       + D+   LLD    +    K G+ P+H A      E + LL  ++ + +   K  L P+H A   +N ++  LLL++
Sbjct:  512 LLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 614          

HSP 10 Score: 45.4394 bits (106), Expect = 4.377e-6
Identity = 26/107 (24.30%), Postives = 47/107 (43.93%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL  + + D     G  P+       N  +  LLLD+        K+G+ P+H A  K   + +  L     +    T+Q +  +H A  + + ++ +LLL RN ++
Sbjct:  578 LLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANV 684          

HSP 11 Score: 44.669 bits (104), Expect = 7.992e-6
Identity = 23/108 (21.30%), Postives = 44/108 (40.74%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD   +      +G  P+    +   +D+   LL+   D     + G   +H A  +   +   LL  RN N+    K  L P+H A  ++   +  +L+ +   ++
Sbjct:  611 LLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD 718          
BLAST of SMED30028892 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 61.6178 bits (148), Expect = 7.291e-12
Identity = 28/107 (26.17%), Postives = 56/107 (52.34%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++  + +  T  G   +    +  ++D++ LLL RN ++   +KSG  P+H A  ++    +E+L N+  +++ +TK    P+H      N +I N LL+ +  +
Sbjct:  633 LLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKV 739          

HSP 2 Score: 56.225 bits (134), Expect = 7.102e-10
Identity = 28/107 (26.17%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +T+  L P+H      + ++  +LL+R   I
Sbjct:  204 LLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPI 310          

HSP 3 Score: 54.6842 bits (130), Expect = 2.130e-9
Identity = 29/108 (26.85%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + + G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  237 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD 344          

HSP 4 Score: 51.6026 bits (122), Expect = 2.997e-8
Identity = 22/104 (21.15%), Postives = 51/104 (49.04%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN 312
            LL  N N++     G  P+    +   +++ ++L+++   ++ + K G+ P+H   +  + +    L   +  +  +TK    P+H A  + ++ I N+LL+ N
Sbjct:  666 LLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNN 769          

HSP 5 Score: 50.8322 bits (120), Expect = 5.114e-8
Identity = 28/106 (26.42%), Postives = 49/106 (46.23%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDH  ++   T  G  P+    +   +++  LLL ++   +   KSG  P+H A + ++ + + LL ++  +     K    P+H A  K   +I   LLE   D
Sbjct:  534 LLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGAD 639          

HSP 6 Score: 49.6766 bits (117), Expect = 1.238e-7
Identity = 29/106 (27.36%), Postives = 51/106 (48.11%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLD    ID +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A    + ++  +LL++  +
Sbjct:  270 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAN 375          

HSP 7 Score: 47.7506 bits (112), Expect = 5.693e-7
Identity = 29/101 (28.71%), Postives = 47/101 (46.53%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            LL HN  +D  TND    +       +  + K+LLD+  +   +  +G+ P+H A  K   +  ELL     +I+  T+  L PIH A    +  I + L+
Sbjct:  336 LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 436          

HSP 8 Score: 47.7506 bits (112), Expect = 7.188e-7
Identity = 23/76 (30.26%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  203 LLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKID 278          

HSP 9 Score: 46.595 bits (109), Expect = 1.519e-6
Identity = 26/103 (25.24%), Postives = 45/103 (43.69%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL    + +  T  G  P+       + D+   LLD    +    K G+ P+H A      E + LL  ++ + +   K  L P+H A   +N ++  LLL++
Sbjct:  501 LLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 603          

HSP 10 Score: 45.4394 bits (106), Expect = 4.420e-6
Identity = 26/107 (24.30%), Postives = 47/107 (43.93%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL  + + D     G  P+       N  +  LLLD+        K+G+ P+H A  K   + +  L     +    T+Q +  +H A  + + ++ +LLL RN ++
Sbjct:  567 LLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANV 673          

HSP 11 Score: 44.669 bits (104), Expect = 8.150e-6
Identity = 23/108 (21.30%), Postives = 44/108 (40.74%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD   +      +G  P+    +   +D+   LL+   D     + G   +H A  +   +   LL  RN N+    K  L P+H A  ++   +  +L+ +   ++
Sbjct:  600 LLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD 707          
BLAST of SMED30028892 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 61.6178 bits (148), Expect = 9.641e-12
Identity = 28/107 (26.17%), Postives = 56/107 (52.34%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++  + +  T  G   +    +  ++D++ LLL RN ++   +KSG  P+H A  ++    +E+L N+  +++ +TK    P+H      N +I N LL+ +  +
Sbjct:  650 LLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKV 756          

HSP 2 Score: 55.8398 bits (133), Expect = 8.689e-10
Identity = 28/107 (26.17%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +T+  L P+H      + ++  +LL+R   I
Sbjct:  221 LLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPI 327          

HSP 3 Score: 54.6842 bits (130), Expect = 2.581e-9
Identity = 29/108 (26.85%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + + G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  254 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD 361          

HSP 4 Score: 51.2174 bits (121), Expect = 3.811e-8
Identity = 22/104 (21.15%), Postives = 51/104 (49.04%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN 312
            LL  N N++     G  P+    +   +++ ++L+++   ++ + K G+ P+H   +  + +    L   +  +  +TK    P+H A  + ++ I N+LL+ N
Sbjct:  683 LLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNN 786          

HSP 5 Score: 50.447 bits (119), Expect = 6.379e-8
Identity = 28/106 (26.42%), Postives = 49/106 (46.23%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDH  ++   T  G  P+    +   +++  LLL ++   +   KSG  P+H A + ++ + + LL ++  +     K    P+H A  K   +I   LLE   D
Sbjct:  551 LLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGAD 656          

HSP 6 Score: 49.6766 bits (117), Expect = 1.515e-7
Identity = 29/106 (27.36%), Postives = 51/106 (48.11%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLD    ID +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A    + ++  +LL++  +
Sbjct:  287 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAN 392          

HSP 7 Score: 47.7506 bits (112), Expect = 6.633e-7
Identity = 29/101 (28.71%), Postives = 47/101 (46.53%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            LL HN  +D  TND    +       +  + K+LLD+  +   +  +G+ P+H A  K   +  ELL     +I+  T+  L PIH A    +  I + L+
Sbjct:  353 LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 453          

HSP 8 Score: 47.3654 bits (111), Expect = 8.375e-7
Identity = 23/76 (30.26%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  220 LLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKID 295          

HSP 9 Score: 46.595 bits (109), Expect = 1.857e-6
Identity = 26/103 (25.24%), Postives = 45/103 (43.69%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL    + +  T  G  P+       + D+   LLD    +    K G+ P+H A      E + LL  ++ + +   K  L P+H A   +N ++  LLL++
Sbjct:  518 LLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 620          

HSP 10 Score: 45.0542 bits (105), Expect = 5.251e-6
Identity = 26/107 (24.30%), Postives = 47/107 (43.93%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL  + + D     G  P+       N  +  LLLD+        K+G+ P+H A  K   + +  L     +    T+Q +  +H A  + + ++ +LLL RN ++
Sbjct:  584 LLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANV 690          
BLAST of SMED30028892 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 60.077 bits (144), Expect = 2.602e-11
Identity = 29/103 (28.16%), Postives = 55/103 (53.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL ++ N D ++  G  P+       N+++  LLL+R   +++  ++G  P+H A  + +    +LL +R   I+ +T+  L P+H A    + ++  LLLER
Sbjct:  174 LLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLER 276          

HSP 2 Score: 55.0694 bits (131), Expect = 1.456e-9
Identity = 30/108 (27.78%), Postives = 50/108 (46.30%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +G  P+    +  N +++KLLLDR   I+ + + G  P+H A      +  ELL  R   +   TK  L P+H A   ++ E    LL+    ++
Sbjct:  207 LLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 314          

HSP 3 Score: 53.9138 bits (128), Expect = 4.326e-9
Identity = 27/96 (28.12%), Postives = 48/96 (50.00%), Query Frame = 1
Query:   34 TNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            T  G  P+    +  ++D+ KLLL R    +   K+G+ P+H A  K   + +  L N        TKQ + P+H A  + ++++  LLL++  +I
Sbjct:  482 TKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANI 577          

HSP 4 Score: 46.595 bits (109), Expect = 1.577e-6
Identity = 25/107 (23.36%), Postives = 50/107 (46.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++    +  T  G  P+    +  + D++ LLLD+  +I    KSG   +H A  ++    +++L     + +  TK    P+  A    N ++ N LL++  ++
Sbjct:  537 LLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANV 643          

HSP 5 Score: 45.4394 bits (106), Expect = 3.566e-6
Identity = 22/76 (28.95%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + + KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  173 LLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQID 248          

HSP 6 Score: 45.4394 bits (106), Expect = 3.707e-6
Identity = 26/101 (25.74%), Postives = 42/101 (41.58%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            LL H  + D  T +G  P+        +D+  +LL+         K G+ P+H A      + ++LL  R    +   K    P+H A  K   +I + LL
Sbjct:  438 LLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLL 538          
BLAST of SMED30028892 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 54.6842 bits (130), Expect = 9.573e-10
Identity = 30/106 (28.30%), Postives = 52/106 (49.06%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDHN +    T  G  P+    +  N+++++LLL+R   ++ E K+   P+H A +  + + + LL     + +   K    P+H A  K   EI + LL+   D
Sbjct:  543 LLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKAD 648          

HSP 2 Score: 53.1434 bits (126), Expect = 2.956e-9
Identity = 30/102 (29.41%), Postives = 46/102 (45.10%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL    N +  T D   P+    +    ++  +LLD N D     K G+ P+H A    + E   LL  R   ++ E K ++ P+H A    N ++  LLLE
Sbjct:  510 LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE 611          

HSP 3 Score: 50.8322 bits (120), Expect = 2.025e-8
Identity = 35/110 (31.82%), Postives = 50/110 (45.45%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER--NCDIE 324
            LL H   +D  T D   P+       ++ + KLLLDR+ D      +G+ P+H A  K   +  ELL      IE  T+  L P+H A       I   LL++  N D+E
Sbjct:  345 LLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE 454          

HSP 4 Score: 48.521 bits (114), Expect = 1.131e-7
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN--CDIE 324
            L+ +   +D +  + + P+       N D++ LLL    +     +  + P+H A  +   E + +L + N +    TK+   P+H A    N E+  LLLER    DIE
Sbjct:  477 LIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE 586          

HSP 5 Score: 47.3654 bits (111), Expect = 2.959e-7
Identity = 25/106 (23.58%), Postives = 46/106 (43.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL    N D ET  G+ P+     +   D++++L+     ++ + +    P+H A    + +   LL     N    T+    P+H A  +   E+  +LL+ N D
Sbjct:  444 LLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD 549          

HSP 6 Score: 44.669 bits (104), Expect = 3.165e-6
Identity = 26/107 (24.30%), Postives = 50/107 (46.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL +  N D  +  G  P+       + ++ +LLL++  ++ Y+ +    P+H A        + LL +R   I+  TK  L P+H A    + ++ +LL+ +   I
Sbjct:  213 LLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPI 319          
BLAST of SMED30028892 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 54.6842 bits (130), Expect = 9.573e-10
Identity = 30/106 (28.30%), Postives = 52/106 (49.06%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDHN +    T  G  P+    +  N+++++LLL+R   ++ E K+   P+H A +  + + + LL     + +   K    P+H A  K   EI + LL+   D
Sbjct:  543 LLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKAD 648          

HSP 2 Score: 53.1434 bits (126), Expect = 2.956e-9
Identity = 30/102 (29.41%), Postives = 46/102 (45.10%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL    N +  T D   P+    +    ++  +LLD N D     K G+ P+H A    + E   LL  R   ++ E K ++ P+H A    N ++  LLLE
Sbjct:  510 LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE 611          

HSP 3 Score: 50.8322 bits (120), Expect = 2.025e-8
Identity = 35/110 (31.82%), Postives = 50/110 (45.45%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER--NCDIE 324
            LL H   +D  T D   P+       ++ + KLLLDR+ D      +G+ P+H A  K   +  ELL      IE  T+  L P+H A       I   LL++  N D+E
Sbjct:  345 LLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE 454          

HSP 4 Score: 48.521 bits (114), Expect = 1.131e-7
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN--CDIE 324
            L+ +   +D +  + + P+       N D++ LLL    +     +  + P+H A  +   E + +L + N +    TK+   P+H A    N E+  LLLER    DIE
Sbjct:  477 LIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE 586          

HSP 5 Score: 47.3654 bits (111), Expect = 2.959e-7
Identity = 25/106 (23.58%), Postives = 46/106 (43.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL    N D ET  G+ P+     +   D++++L+     ++ + +    P+H A    + +   LL     N    T+    P+H A  +   E+  +LL+ N D
Sbjct:  444 LLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD 549          

HSP 6 Score: 44.669 bits (104), Expect = 3.165e-6
Identity = 26/107 (24.30%), Postives = 50/107 (46.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL +  N D  +  G  P+       + ++ +LLL++  ++ Y+ +    P+H A        + LL +R   I+  TK  L P+H A    + ++ +LL+ +   I
Sbjct:  213 LLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPI 319          
BLAST of SMED30028892 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 54.6842 bits (130), Expect = 9.577e-10
Identity = 30/106 (28.30%), Postives = 52/106 (49.06%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDHN +    T  G  P+    +  N+++++LLL+R   ++ E K+   P+H A +  + + + LL     + +   K    P+H A  K   EI + LL+   D
Sbjct:  543 LLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKAD 648          

HSP 2 Score: 53.1434 bits (126), Expect = 2.957e-9
Identity = 30/102 (29.41%), Postives = 46/102 (45.10%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL    N +  T D   P+    +    ++  +LLD N D     K G+ P+H A    + E   LL  R   ++ E K ++ P+H A    N ++  LLLE
Sbjct:  510 LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE 611          

HSP 3 Score: 50.8322 bits (120), Expect = 2.026e-8
Identity = 35/110 (31.82%), Postives = 50/110 (45.45%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER--NCDIE 324
            LL H   +D  T D   P+       ++ + KLLLDR+ D      +G+ P+H A  K   +  ELL      IE  T+  L P+H A       I   LL++  N D+E
Sbjct:  345 LLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE 454          

HSP 4 Score: 48.521 bits (114), Expect = 1.131e-7
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN--CDIE 324
            L+ +   +D +  + + P+       N D++ LLL    +     +  + P+H A  +   E + +L + N +    TK+   P+H A    N E+  LLLER    DIE
Sbjct:  477 LIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE 586          

HSP 5 Score: 47.3654 bits (111), Expect = 2.960e-7
Identity = 25/106 (23.58%), Postives = 46/106 (43.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL    N D ET  G+ P+     +   D++++L+     ++ + +    P+H A    + +   LL     N    T+    P+H A  +   E+  +LL+ N D
Sbjct:  444 LLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD 549          

HSP 6 Score: 44.669 bits (104), Expect = 3.166e-6
Identity = 26/107 (24.30%), Postives = 50/107 (46.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL +  N D  +  G  P+       + ++ +LLL++  ++ Y+ +    P+H A        + LL +R   I+  TK  L P+H A    + ++ +LL+ +   I
Sbjct:  213 LLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPI 319          
BLAST of SMED30028892 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 54.6842 bits (130), Expect = 9.577e-10
Identity = 30/106 (28.30%), Postives = 52/106 (49.06%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDHN +    T  G  P+    +  N+++++LLL+R   ++ E K+   P+H A +  + + + LL     + +   K    P+H A  K   EI + LL+   D
Sbjct:  543 LLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKAD 648          

HSP 2 Score: 53.1434 bits (126), Expect = 2.957e-9
Identity = 30/102 (29.41%), Postives = 46/102 (45.10%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL    N +  T D   P+    +    ++  +LLD N D     K G+ P+H A    + E   LL  R   ++ E K ++ P+H A    N ++  LLLE
Sbjct:  510 LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE 611          

HSP 3 Score: 50.8322 bits (120), Expect = 2.026e-8
Identity = 35/110 (31.82%), Postives = 50/110 (45.45%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER--NCDIE 324
            LL H   +D  T D   P+       ++ + KLLLDR+ D      +G+ P+H A  K   +  ELL      IE  T+  L P+H A       I   LL++  N D+E
Sbjct:  345 LLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE 454          

HSP 4 Score: 48.521 bits (114), Expect = 1.131e-7
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN--CDIE 324
            L+ +   +D +  + + P+       N D++ LLL    +     +  + P+H A  +   E + +L + N +    TK+   P+H A    N E+  LLLER    DIE
Sbjct:  477 LIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE 586          

HSP 5 Score: 47.3654 bits (111), Expect = 2.960e-7
Identity = 25/106 (23.58%), Postives = 46/106 (43.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL    N D ET  G+ P+     +   D++++L+     ++ + +    P+H A    + +   LL     N    T+    P+H A  +   E+  +LL+ N D
Sbjct:  444 LLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD 549          

HSP 6 Score: 44.669 bits (104), Expect = 3.166e-6
Identity = 26/107 (24.30%), Postives = 50/107 (46.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL +  N D  +  G  P+       + ++ +LLL++  ++ Y+ +    P+H A        + LL +R   I+  TK  L P+H A    + ++ +LL+ +   I
Sbjct:  213 LLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPI 319          
BLAST of SMED30028892 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 54.6842 bits (130), Expect = 9.581e-10
Identity = 30/106 (28.30%), Postives = 52/106 (49.06%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDHN +    T  G  P+    +  N+++++LLL+R   ++ E K+   P+H A +  + + + LL     + +   K    P+H A  K   EI + LL+   D
Sbjct:  543 LLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKAD 648          

HSP 2 Score: 53.1434 bits (126), Expect = 2.959e-9
Identity = 30/102 (29.41%), Postives = 46/102 (45.10%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL    N +  T D   P+    +    ++  +LLD N D     K G+ P+H A    + E   LL  R   ++ E K ++ P+H A    N ++  LLLE
Sbjct:  510 LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE 611          

HSP 3 Score: 50.8322 bits (120), Expect = 2.027e-8
Identity = 35/110 (31.82%), Postives = 50/110 (45.45%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER--NCDIE 324
            LL H   +D  T D   P+       ++ + KLLLDR+ D      +G+ P+H A  K   +  ELL      IE  T+  L P+H A       I   LL++  N D+E
Sbjct:  345 LLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE 454          

HSP 4 Score: 48.521 bits (114), Expect = 1.132e-7
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN--CDIE 324
            L+ +   +D +  + + P+       N D++ LLL    +     +  + P+H A  +   E + +L + N +    TK+   P+H A    N E+  LLLER    DIE
Sbjct:  477 LIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE 586          

HSP 5 Score: 47.3654 bits (111), Expect = 2.962e-7
Identity = 25/106 (23.58%), Postives = 46/106 (43.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL    N D ET  G+ P+     +   D++++L+     ++ + +    P+H A    + +   LL     N    T+    P+H A  +   E+  +LL+ N D
Sbjct:  444 LLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD 549          

HSP 6 Score: 44.669 bits (104), Expect = 3.168e-6
Identity = 26/107 (24.30%), Postives = 50/107 (46.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL +  N D  +  G  P+       + ++ +LLL++  ++ Y+ +    P+H A        + LL +R   I+  TK  L P+H A    + ++ +LL+ +   I
Sbjct:  213 LLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPI 319          
BLAST of SMED30028892 vs. Ensembl Fly
Match: Tnks (gene:FBgn0027508 transcript:FBtr0084890)

HSP 1 Score: 58.5362 bits (140), Expect = 4.216e-11
Identity = 29/102 (28.43%), Postives = 51/102 (50.00%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            N++C  +DG+R  P+        I ++++LL    D+  +DK G  P+H+A +   ++ ++LL     N+         P+H A  K   E+ +LLL R  D
Sbjct:  200 NVNCHASDGRRSTPLHLAAGYNRIGIVEILLANGADVHAKDKGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWAFTPLHEAASKSRVEVCSLLLSRGAD 301          

HSP 2 Score: 54.6842 bits (130), Expect = 1.084e-9
Identity = 29/108 (26.85%), Postives = 53/108 (49.07%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            +L++  +++C   DG+   P+ F      + +++ LL+   ++   DK G  P+H+A +   +E +ELL     N+      K  P+H A  K   +I  LLL+   D
Sbjct:  504 VLNNPISVNCRDLDGRHSTPLHFAAGFNRVPVVQFLLEHGAEVYAADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYDICKLLLKHGAD 611          

HSP 3 Score: 44.2838 bits (103), Expect = 5.287e-6
Identity = 25/102 (24.51%), Postives = 45/102 (44.12%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            +I+C    G+   P+       N +  + LL+   D+  +DK G  P+H+A +    + + LL      +    K    P+H A  K  +++ +LLL    D
Sbjct:  663 SINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGAD 764          
BLAST of SMED30028892 vs. Ensembl Fly
Match: Tnks (gene:FBgn0027508 transcript:FBtr0330383)

HSP 1 Score: 58.5362 bits (140), Expect = 4.883e-11
Identity = 29/102 (28.43%), Postives = 51/102 (50.00%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            N++C  +DG+R  P+        I ++++LL    D+  +DK G  P+H+A +   ++ ++LL     N+         P+H A  K   E+ +LLL R  D
Sbjct:  200 NVNCHASDGRRSTPLHLAAGYNRIGIVEILLANGADVHAKDKGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWAFTPLHEAASKSRVEVCSLLLSRGAD 301          

HSP 2 Score: 54.6842 bits (130), Expect = 1.255e-9
Identity = 29/108 (26.85%), Postives = 53/108 (49.07%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            +L++  +++C   DG+   P+ F      + +++ LL+   ++   DK G  P+H+A +   +E +ELL     N+      K  P+H A  K   +I  LLL+   D
Sbjct:  504 VLNNPISVNCRDLDGRHSTPLHFAAGFNRVPVVQFLLEHGAEVYAADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYDICKLLLKHGAD 611          

HSP 3 Score: 43.8986 bits (102), Expect = 6.003e-6
Identity = 25/102 (24.51%), Postives = 45/102 (44.12%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            +I+C    G+   P+       N +  + LL+   D+  +DK G  P+H+A +    + + LL      +    K    P+H A  K  +++ +LLL    D
Sbjct:  663 SINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGAD 764          
BLAST of SMED30028892 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 57.3806 bits (137), Expect = 1.032e-10
Identity = 31/107 (28.97%), Postives = 50/107 (46.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LLD++ N D  +  G  P+       N ++  LL+ +  D+ Y  K    P+H A          LL  +  NIE +T+  L P+H A    + ++ ++LLER   I
Sbjct:  191 LLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPI 297          

HSP 2 Score: 51.2174 bits (121), Expect = 1.603e-8
Identity = 30/106 (28.30%), Postives = 51/106 (48.11%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL+   NI+ +T DG  P+     S +  ++ +LL+R   I  + K+G  P+H A   E  + + +L      ++  T   L  +H A    +  +  LLL+RN D
Sbjct:  257 LLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNAD 362          

HSP 3 Score: 47.7506 bits (112), Expect = 2.685e-7
Identity = 31/104 (29.81%), Postives = 45/104 (43.27%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN 312
            LL H   +D  T D    +       ++ + KLLLDRN D      +G+ P+H A  K   +  ELL     +I   T+  L P+H A       I   LL+ +
Sbjct:  323 LLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHD 426          

HSP 4 Score: 43.8986 bits (102), Expect = 5.671e-6
Identity = 23/101 (22.77%), Postives = 46/101 (45.54%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            L+    +++        P+    +    +++ LLL++  +IE + + G  P+H A      +  ++L  R   I  +TK  L P+H A   E+ +   +LL
Sbjct:  224 LIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILL 324          
BLAST of SMED30028892 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303120)

HSP 1 Score: 57.3806 bits (137), Expect = 1.057e-10
Identity = 31/107 (28.97%), Postives = 50/107 (46.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LLD++ N D  +  G  P+       N ++  LL+ +  D+ Y  K    P+H A          LL  +  NIE +T+  L P+H A    + ++ ++LLER   I
Sbjct:  341 LLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPI 447          

HSP 2 Score: 51.2174 bits (121), Expect = 1.641e-8
Identity = 30/106 (28.30%), Postives = 51/106 (48.11%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL+   NI+ +T DG  P+     S +  ++ +LL+R   I  + K+G  P+H A   E  + + +L      ++  T   L  +H A    +  +  LLL+RN D
Sbjct:  407 LLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNAD 512          

HSP 3 Score: 47.7506 bits (112), Expect = 2.748e-7
Identity = 31/104 (29.81%), Postives = 45/104 (43.27%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN 312
            LL H   +D  T D    +       ++ + KLLLDRN D      +G+ P+H A  K   +  ELL     +I   T+  L P+H A       I   LL+ +
Sbjct:  473 LLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHD 576          

HSP 4 Score: 43.8986 bits (102), Expect = 5.802e-6
Identity = 23/101 (22.77%), Postives = 46/101 (45.54%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            L+    +++        P+    +    +++ LLL++  +IE + + G  P+H A      +  ++L  R   I  +TK  L P+H A   E+ +   +LL
Sbjct:  374 LIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILL 474          
BLAST of SMED30028892 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 57.3806 bits (137), Expect = 1.092e-10
Identity = 31/107 (28.97%), Postives = 50/107 (46.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LLD++ N D  +  G  P+       N ++  LL+ +  D+ Y  K    P+H A          LL  +  NIE +T+  L P+H A    + ++ ++LLER   I
Sbjct:  191 LLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPI 297          

HSP 2 Score: 51.2174 bits (121), Expect = 1.695e-8
Identity = 30/106 (28.30%), Postives = 51/106 (48.11%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL+   NI+ +T DG  P+     S +  ++ +LL+R   I  + K+G  P+H A   E  + + +L      ++  T   L  +H A    +  +  LLL+RN D
Sbjct:  257 LLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNAD 362          

HSP 3 Score: 50.0618 bits (118), Expect = 5.035e-8
Identity = 26/102 (25.49%), Postives = 49/102 (48.04%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            L+++   +D  T  G  P+    +  +I + +LLL +  D++ + K+G  P+H A +  + + + LL  +  +     K    P+H A  K   +I   LLE
Sbjct:  521 LIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLE 622          

HSP 4 Score: 47.7506 bits (112), Expect = 2.839e-7
Identity = 31/104 (29.81%), Postives = 45/104 (43.27%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN 312
            LL H   +D  T D    +       ++ + KLLLDRN D      +G+ P+H A  K   +  ELL     +I   T+  L P+H A       I   LL+ +
Sbjct:  323 LLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHD 426          

HSP 5 Score: 46.9802 bits (110), Expect = 5.998e-7
Identity = 26/102 (25.49%), Postives = 45/102 (44.12%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL    ++D +  +G  P+       N  +  LLL++        K+G  P+H A  K   + +  L         E+K    P+H +  + ++EI NLL+E
Sbjct:  554 LLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIE 655          

HSP 6 Score: 46.595 bits (109), Expect = 8.106e-7
Identity = 23/106 (21.70%), Postives = 47/106 (44.34%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            L++H   ++    +G  P+    +  N+++ ++L     +I+   K+G+ P+H A +         L     N++  T     P+H    + +  I NLLLE   +
Sbjct:  653 LIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKAN 758          

HSP 7 Score: 45.8246 bits (107), Expect = 1.452e-6
Identity = 22/103 (21.36%), Postives = 47/103 (45.63%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL H   +D  T D    +    +    ++  +L++    ++   K G+ P+H        + ++LL  +  +++ + K  + P+H A    N ++  LLLE+
Sbjct:  488 LLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEK 590          

HSP 8 Score: 44.669 bits (104), Expect = 3.413e-6
Identity = 22/108 (20.37%), Postives = 48/108 (44.44%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL +   +D    + + P+       N+D++ LLL     ++   K  +  +H A  +   E + +L      ++  TK+   P+H      + ++  LLL++  D++
Sbjct:  455 LLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVD 562          

HSP 9 Score: 43.8986 bits (102), Expect = 5.993e-6
Identity = 23/101 (22.77%), Postives = 46/101 (45.54%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            L+    +++        P+    +    +++ LLL++  +IE + + G  P+H A      +  ++L  R   I  +TK  L P+H A   E+ +   +LL
Sbjct:  224 LIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILL 324          
BLAST of SMED30028892 vs. Ensembl Zebrafish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 59.6918 bits (143), Expect = 2.402e-11
Identity = 31/108 (28.70%), Postives = 57/108 (52.78%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL ++ N D  +  G  P+      +N+++ +LLL+R  D+ +  K+G  P+H A  + +     LL +R   I+ +TK +L P+H A    +  I  +LL++   I+
Sbjct:  192 LLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQ 299          

HSP 2 Score: 55.4546 bits (132), Expect = 7.724e-10
Identity = 30/103 (29.13%), Postives = 45/103 (43.69%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL+H  N +  T  G  P+       +     +LLD N  +    K G+ P+H A      + + LL  R  N     K  L P+H A+   N ++ NLLL +
Sbjct:  489 LLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSK 591          

HSP 3 Score: 55.0694 bits (131), Expect = 1.232e-9
Identity = 29/108 (26.85%), Postives = 53/108 (49.07%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+   +++    +G  P+       N+ +++LLLDR   I+ + K    P+H A         E+L ++   I+ +TK  L PIH A   ++ +    LL+ N +I+
Sbjct:  225 LLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEID 332          

HSP 4 Score: 50.447 bits (119), Expect = 4.534e-8
Identity = 28/103 (27.18%), Postives = 50/103 (48.54%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LLD    ID +T D   P+     + ++ ++++LLD+   I+ + K+G  PIH A   +  +    L   N  I+  T   L P+H A    +  +  +LL++
Sbjct:  258 LLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDK 360          

HSP 5 Score: 48.9062 bits (115), Expect = 1.785e-7
Identity = 23/109 (21.10%), Postives = 50/109 (45.87%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LL H  + + E+  G  P+    +    D++ LL+ +  ++   +KSG  P+H    +     +++L     ++   T+    P+H A    N ++   LL++  ++ C
Sbjct:  621 LLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNC 729          

HSP 6 Score: 48.1358 bits (113), Expect = 2.929e-7
Identity = 21/102 (20.59%), Postives = 49/102 (48.04%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            L+    N++     G  P+  V +  ++ +  +L+     +    + G+ P+H A +  + +  + L  +  N+ C+T+    P+H A  + +++I  LLL+
Sbjct:  654 LISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHTDIVTLLLK 755          

HSP 7 Score: 46.2098 bits (108), Expect = 1.187e-6
Identity = 33/137 (24.09%), Postives = 59/137 (43.07%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLD----------------RNCDI-------------EYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD+  N    T DG  P+   ++  + +++ LL++                RN D              +   K+G+ P+H A + E+   ++LL NR  ++    K  + P+H A  + N  +  LLL+R   I+
Sbjct:  130 LLDNGANQTIPTEDGFTPLAVALQQGHENVVALLINHGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKID 266          

HSP 8 Score: 46.2098 bits (108), Expect = 1.308e-6
Identity = 26/106 (24.53%), Postives = 50/106 (47.17%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL +   +D +  D + P+       + +++KLLL+   +      +G  P+H A  +   +T+ +L + N  +   TK+   P+H A      ++  LLLER  +
Sbjct:  456 LLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGAN 561          

HSP 9 Score: 45.8246 bits (107), Expect = 1.651e-6
Identity = 23/107 (21.50%), Postives = 48/107 (44.86%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL+   N +     G  P+   +   N+D++ LLL +        ++G+ P+H A  +   E +  L     +   E+ Q + P+H A  +   ++  LL+ +  ++
Sbjct:  555 LLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANV 661          

HSP 10 Score: 45.4394 bits (106), Expect = 2.435e-6
Identity = 25/102 (24.51%), Postives = 47/102 (46.08%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LLD N  +   T  G  P+    +   +D+  LLL+R  +     K G  P+H A++  + +   LL ++  +     +    P+H A  +  +E+ + LL+
Sbjct:  522 LLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQ 623          

HSP 11 Score: 45.4394 bits (106), Expect = 2.900e-6
Identity = 25/108 (23.15%), Postives = 48/108 (44.44%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD    I  +T +G  PI    +  ++D ++ LL  N +I+        P+H A +      +++L ++             P+H A  K +  + +LLL+ +  +E
Sbjct:  291 LLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLE 398          

HSP 12 Score: 43.8986 bits (102), Expect = 9.951e-6
Identity = 26/103 (25.24%), Postives = 47/103 (45.63%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL +N  ID  T D   P+       +  + K+LLD+         +G+ P+H A  K      +LL   + ++E  T+  L P+H +    +  I  +L+++
Sbjct:  324 LLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQK 426          
BLAST of SMED30028892 vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 59.3066 bits (142), Expect = 3.931e-11
Identity = 29/102 (28.43%), Postives = 51/102 (50.00%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL++    +  T  G  P+    +  ++DL+ LLL +  ++   +K+G  P+H A   +    +E+L N    I+ +TK    P+H A    N ++ N LLE
Sbjct:  651 LLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLE 752          

HSP 2 Score: 58.151 bits (139), Expect = 8.072e-11
Identity = 30/107 (28.04%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   IE +TK  L P+H      + ++  +LL+R   I
Sbjct:  222 LLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI 328          

HSP 3 Score: 56.225 bits (134), Expect = 4.014e-10
Identity = 31/108 (28.70%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   IE + K G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  255 LLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVD 362          

HSP 4 Score: 47.7506 bits (112), Expect = 3.985e-7
Identity = 24/76 (31.58%), Postives = 40/76 (52.63%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N  +  LLL+R   IE
Sbjct:  221 LLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIE 296          

HSP 5 Score: 46.2098 bits (108), Expect = 1.368e-6
Identity = 26/88 (29.55%), Postives = 42/88 (47.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFA 264
            LLD    I+ +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A
Sbjct:  288 LLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVA 375          

HSP 6 Score: 45.0542 bits (105), Expect = 3.064e-6
Identity = 28/108 (25.93%), Postives = 52/108 (48.15%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL++N +    T DG  P+   ++  +  ++ LLL+ +     + K     +H A  K+D +++ LL   + N + E+K    P+H A    N  +  LLL R   ++
Sbjct:  160 LLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVD 263          

HSP 7 Score: 43.8986 bits (102), Expect = 9.543e-6
Identity = 26/100 (26.00%), Postives = 45/100 (45.00%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLL 300
            LL HN  +D  TND    +       +  + K+++D+  +   +  +G+ P+H A  K   +  ELL     +++  T+  L PIH A    +  I   L
Sbjct:  354 LLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 453          
BLAST of SMED30028892 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 59.3066 bits (142), Expect = 3.969e-11
Identity = 29/102 (28.43%), Postives = 51/102 (50.00%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL++    +  T  G  P+    +  ++DL+ LLL +  ++   +K+G  P+H A   +    +E+L N    I+ +TK    P+H A    N ++ N LLE
Sbjct:  651 LLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLE 752          

HSP 2 Score: 58.151 bits (139), Expect = 8.150e-11
Identity = 30/107 (28.04%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   IE +TK  L P+H      + ++  +LL+R   I
Sbjct:  222 LLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI 328          

HSP 3 Score: 56.225 bits (134), Expect = 4.014e-10
Identity = 31/108 (28.70%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   IE + K G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  255 LLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVD 362          

HSP 4 Score: 49.6766 bits (117), Expect = 9.369e-8
Identity = 24/102 (23.53%), Postives = 49/102 (48.04%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL    N++    +G  P+    +     + ++LL+   +I+ + KSG+ P+H A +  + + +  L         +TK    P+H A  + ++ I N+LL+
Sbjct:  684 LLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQ 785          

HSP 5 Score: 47.7506 bits (112), Expect = 4.024e-7
Identity = 24/76 (31.58%), Postives = 40/76 (52.63%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N  +  LLL+R   IE
Sbjct:  221 LLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIE 296          

HSP 6 Score: 46.2098 bits (108), Expect = 1.382e-6
Identity = 26/88 (29.55%), Postives = 42/88 (47.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFA 264
            LLD    I+ +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A
Sbjct:  288 LLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVA 375          

HSP 7 Score: 45.0542 bits (105), Expect = 3.005e-6
Identity = 28/108 (25.93%), Postives = 52/108 (48.15%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL++N +    T DG  P+   ++  +  ++ LLL+ +     + K     +H A  K+D +++ LL   + N + E+K    P+H A    N  +  LLL R   ++
Sbjct:  160 LLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVD 263          

HSP 8 Score: 43.8986 bits (102), Expect = 9.450e-6
Identity = 26/100 (26.00%), Postives = 45/100 (45.00%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLL 300
            LL HN  +D  TND    +       +  + K+++D+  +   +  +G+ P+H A  K   +  ELL     +++  T+  L PIH A    +  I   L
Sbjct:  354 LLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 453          
BLAST of SMED30028892 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 59.3066 bits (142), Expect = 3.969e-11
Identity = 29/102 (28.43%), Postives = 51/102 (50.00%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL++    +  T  G  P+    +  ++DL+ LLL +  ++   +K+G  P+H A   +    +E+L N    I+ +TK    P+H A    N ++ N LLE
Sbjct:  651 LLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLE 752          

HSP 2 Score: 58.151 bits (139), Expect = 8.150e-11
Identity = 30/107 (28.04%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   IE +TK  L P+H      + ++  +LL+R   I
Sbjct:  222 LLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI 328          

HSP 3 Score: 56.225 bits (134), Expect = 4.014e-10
Identity = 31/108 (28.70%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   IE + K G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  255 LLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVD 362          

HSP 4 Score: 49.6766 bits (117), Expect = 9.369e-8
Identity = 24/102 (23.53%), Postives = 49/102 (48.04%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL    N++    +G  P+    +     + ++LL+   +I+ + KSG+ P+H A +  + + +  L         +TK    P+H A  + ++ I N+LL+
Sbjct:  684 LLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQ 785          

HSP 5 Score: 47.7506 bits (112), Expect = 4.024e-7
Identity = 24/76 (31.58%), Postives = 40/76 (52.63%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N  +  LLL+R   IE
Sbjct:  221 LLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIE 296          

HSP 6 Score: 46.2098 bits (108), Expect = 1.382e-6
Identity = 26/88 (29.55%), Postives = 42/88 (47.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFA 264
            LLD    I+ +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A
Sbjct:  288 LLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVA 375          

HSP 7 Score: 45.0542 bits (105), Expect = 3.005e-6
Identity = 28/108 (25.93%), Postives = 52/108 (48.15%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL++N +    T DG  P+   ++  +  ++ LLL+ +     + K     +H A  K+D +++ LL   + N + E+K    P+H A    N  +  LLL R   ++
Sbjct:  160 LLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVD 263          

HSP 8 Score: 43.8986 bits (102), Expect = 9.450e-6
Identity = 26/100 (26.00%), Postives = 45/100 (45.00%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLL 300
            LL HN  +D  TND    +       +  + K+++D+  +   +  +G+ P+H A  K   +  ELL     +++  T+  L PIH A    +  I   L
Sbjct:  354 LLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 453          
BLAST of SMED30028892 vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 59.3066 bits (142), Expect = 4.041e-11
Identity = 29/102 (28.43%), Postives = 51/102 (50.00%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL++    +  T  G  P+    +  ++DL+ LLL +  ++   +K+G  P+H A   +    +E+L N    I+ +TK    P+H A    N ++ N LLE
Sbjct:  637 LLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLE 738          

HSP 2 Score: 56.225 bits (134), Expect = 4.086e-10
Identity = 31/108 (28.70%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   IE + K G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  241 LLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVD 348          

HSP 3 Score: 54.299 bits (129), Expect = 1.917e-9
Identity = 29/111 (26.13%), Postives = 54/111 (48.65%), Query Frame = 1
Query:    7 DHNCNIDCE------TNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            DHN +++ +      T  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   IE +TK  L P+H      + ++  +LL+R   I
Sbjct:  204 DHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI 314          

HSP 4 Score: 46.2098 bits (108), Expect = 1.393e-6
Identity = 26/88 (29.55%), Postives = 42/88 (47.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFA 264
            LLD    I+ +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A
Sbjct:  274 LLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVA 361          

HSP 5 Score: 43.8986 bits (102), Expect = 9.617e-6
Identity = 26/100 (26.00%), Postives = 45/100 (45.00%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLL 300
            LL HN  +D  TND    +       +  + K+++D+  +   +  +G+ P+H A  K   +  ELL     +++  T+  L PIH A    +  I   L
Sbjct:  340 LLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 439          
BLAST of SMED30028892 vs. Ensembl Xenopus
Match: tnks2 (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [Source:NCBI gene;Acc:549762])

HSP 1 Score: 56.9954 bits (136), Expect = 3.390e-10
Identity = 28/102 (27.45%), Postives = 51/102 (50.00%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            N++C  +DG++  P+        + +++LLL    D+  +DK    P+H+A +   +E +ELL  R  ++      +  P+H A  K   E+ +LLL    D
Sbjct:  202 NVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKRGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGAD 303          

HSP 2 Score: 52.373 bits (124), Expect = 1.273e-8
Identity = 29/102 (28.43%), Postives = 49/102 (48.04%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            +++C   +G++  P+ F      + +++ LL    D+  +DK G  P+H+A +   +E +ELL      I      K  P+H A  K   EI  LLL+   D
Sbjct:  517 SVNCRDIEGRQSTPLHFAAGYNRVAVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQHGAD 618          

HSP 3 Score: 48.9062 bits (115), Expect = 2.396e-7
Identity = 26/102 (25.49%), Postives = 46/102 (45.10%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            N++C    G+   P+       N+++ + LL    D+  +DK G  P+H+A +    + + LL   N  +    K    P+H A  K  +++  LLL    D
Sbjct:  670 NVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQNGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGAD 771          
BLAST of SMED30028892 vs. Ensembl Xenopus
Match: tnks2 (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [Source:NCBI gene;Acc:549762])

HSP 1 Score: 56.9954 bits (136), Expect = 3.417e-10
Identity = 28/102 (27.45%), Postives = 51/102 (50.00%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            N++C  +DG++  P+        + +++LLL    D+  +DK    P+H+A +   +E +ELL  R  ++      +  P+H A  K   E+ +LLL    D
Sbjct:  202 NVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKRGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGAD 303          

HSP 2 Score: 52.373 bits (124), Expect = 1.259e-8
Identity = 29/102 (28.43%), Postives = 49/102 (48.04%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            +++C   +G++  P+ F      + +++ LL    D+  +DK G  P+H+A +   +E +ELL      I      K  P+H A  K   EI  LLL+   D
Sbjct:  517 SVNCRDIEGRQSTPLHFAAGYNRVAVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQHGAD 618          
BLAST of SMED30028892 vs. Ensembl Xenopus
Match: tnks2 (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [Source:NCBI gene;Acc:549762])

HSP 1 Score: 56.9954 bits (136), Expect = 3.465e-10
Identity = 28/102 (27.45%), Postives = 51/102 (50.00%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            N++C  +DG++  P+        + +++LLL    D+  +DK    P+H+A +   +E +ELL  R  ++      +  P+H A  K   E+ +LLL    D
Sbjct:  202 NVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKRGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGAD 303          

HSP 2 Score: 51.6026 bits (122), Expect = 2.115e-8
Identity = 29/100 (29.00%), Postives = 49/100 (49.00%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN 312
            +++C   +G++  P+ F      + +++ LL    D+  +DK G  P+H+A +   +E +ELL      I      K  P+H A  K   EI  LLL+ N
Sbjct:  517 SVNCRDIEGRQSTPLHFAAGYNRVAVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQVN 616          

HSP 3 Score: 48.9062 bits (115), Expect = 2.425e-7
Identity = 26/102 (25.49%), Postives = 46/102 (45.10%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            N++C    G+   P+       N+++ + LL    D+  +DK G  P+H+A +    + + LL   N  +    K    P+H A  K  +++  LLL    D
Sbjct:  698 NVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQNGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGAD 799          
BLAST of SMED30028892 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 56.6102 bits (135), Expect = 4.117e-10
Identity = 28/107 (26.17%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +T+  L P+H      + ++  +LL+R   I
Sbjct:  204 LLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPI 310          

HSP 2 Score: 55.8398 bits (133), Expect = 8.453e-10
Identity = 28/107 (26.17%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++  + +  T  G  P+    +  ++D++ LLL R+ ++   +KSG  P+H A  ++    +E+L N+   I+  TK    P+H A    N ++   LL+    +
Sbjct:  633 LLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKV 739          

HSP 3 Score: 52.7582 bits (125), Expect = 8.629e-9
Identity = 30/106 (28.30%), Postives = 50/106 (47.17%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL+H  +    T  G  P+    +   I+++KLLL +N   +   KSG  P+H A + ++ + + LL ++  +     K    P+H A  K   +I   LLE   D
Sbjct:  534 LLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGAD 639          

HSP 4 Score: 52.7582 bits (125), Expect = 1.122e-8
Identity = 28/108 (25.93%), Postives = 50/108 (46.30%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + + G  P+H        +   +L +R   I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  237 LLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD 344          

HSP 5 Score: 50.0618 bits (118), Expect = 9.799e-8
Identity = 28/107 (26.17%), Postives = 48/107 (44.86%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL  N + D     G  P+       N  +  LLLD+        K+G+ P+H A  K   + +  L     +    TKQ + P+H A  + + ++ +LLL R+ ++
Sbjct:  567 LLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANV 673          

HSP 6 Score: 48.9062 bits (115), Expect = 1.897e-7
Identity = 29/106 (27.36%), Postives = 50/106 (47.17%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLD    ID +T DG  P+     S +  ++ +LLDR   I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A    + ++  +LL++  +
Sbjct:  270 LLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAN 375          

HSP 7 Score: 47.7506 bits (112), Expect = 5.633e-7
Identity = 27/88 (30.68%), Postives = 42/88 (47.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFA 264
            LL HN  +D  TND    +       +  + K+LLD+  +   +  +G+ P+H A  K   +  ELL     +I+  T+  L PIH A
Sbjct:  336 LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVA 423          

HSP 8 Score: 47.7506 bits (112), Expect = 5.971e-7
Identity = 23/76 (30.26%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  203 LLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKID 278          

HSP 9 Score: 44.669 bits (104), Expect = 6.640e-6
Identity = 27/103 (26.21%), Postives = 44/103 (42.72%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL      D  T  G  P+       + D+  +LL+         K G+ P+H A      E  +LL  +N + +   K  L P+H A   +N ++  LLL++
Sbjct:  501 LLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDK 603          

HSP 10 Score: 44.2838 bits (103), Expect = 8.301e-6
Identity = 25/108 (23.15%), Postives = 44/108 (40.74%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD   +      +G  P+    +   +D+   LL+   D     K G  P+H A  +   +   LL  R+ N+    K  L P+H A  ++   +  +L  +   I+
Sbjct:  600 LLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVID 707          

HSP 11 Score: 44.2838 bits (103), Expect = 8.464e-6
Identity = 28/108 (25.93%), Postives = 50/108 (46.30%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD+  +    T DG  P+   ++  +  ++ LLL+ +     + K     +H A  K+D + + LL   + N + E+K    P+H A    N  +  LLL R   ++
Sbjct:  142 LLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVD 245          
BLAST of SMED30028892 vs. Ensembl Xenopus
Match: foxj3 (forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185])

HSP 1 Score: 56.6102 bits (135), Expect = 4.173e-10
Identity = 28/102 (27.45%), Postives = 50/102 (49.02%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            N++C  +DG++  P+        + +++LLL    D+  +DK G  P+H+A +   +E +ELL      +      +  P+H A  K   E+ +LLL    D
Sbjct:  262 NVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHFEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGAD 363          

HSP 2 Score: 54.6842 bits (130), Expect = 1.829e-9
Identity = 29/102 (28.43%), Postives = 49/102 (48.04%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            N++C   +G+   P+ F      + +++ LL    D+  +DK G  P+H+A +   +E +ELL     ++      K  P+H A  K   EI  LLL+   D
Sbjct:  577 NVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGAD 678          

HSP 3 Score: 50.0618 bits (118), Expect = 8.502e-8
Identity = 27/102 (26.47%), Postives = 47/102 (46.08%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            NI+C    G+   P+       N+++ + LL+   D+  +DK G  P+H+A +    + + LL   N  +    K    P+H A  K  +++  LLL    D
Sbjct:  730 NINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGAD 831          
BLAST of SMED30028892 vs. Ensembl Mouse
Match: Ankk1 (ankyrin repeat and kinase domain containing 1 [Source:MGI Symbol;Acc:MGI:3045301])

HSP 1 Score: 66.6254 bits (161), Expect = 9.597e-14
Identity = 31/107 (28.97%), Postives = 48/107 (44.86%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL H+ ++DC+T  G  P+    + +  DL  LLL    D    D+ GW P+H A    D  T+ LL +    +     +   P+H A       +  LL+ R  D+
Sbjct:  389 LLSHDVDVDCQTASGYTPLLIATQDQQPDLCALLLAHGADTNLADEDGWAPLHFAAQNGDDHTARLLLDHGALVNAREHEGWTPLHLAAQNNFENVARLLVSRQADL 495          

HSP 2 Score: 44.2838 bits (103), Expect = 5.779e-6
Identity = 22/88 (25.00%), Postives = 38/88 (43.18%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFA 264
            LL H  + +    DG  P+ F  ++ +    +LLLD    +   +  GW P+H A        + LL +R  ++     +   P+H A
Sbjct:  422 LLAHGADTNLADEDGWAPLHFAAQNGDDHTARLLLDHGALVNAREHEGWTPLHLAAQNNFENVARLLVSRQADLSPHEAEGKTPLHVA 509          
BLAST of SMED30028892 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 62.3882 bits (150), Expect = 3.417e-12
Identity = 28/107 (26.17%), Postives = 56/107 (52.34%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++  + +  T  G   +    +  ++D++ LLL RN ++   +KSG  P+H A  ++    +E+L N+  +++ +TK    P+H      N +I N LL+ +  +
Sbjct:  633 LLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKV 739          

HSP 2 Score: 57.7658 bits (138), Expect = 1.235e-10
Identity = 28/107 (26.17%), Postives = 55/107 (51.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +T+  L P+H      + ++  +LL+R+  I
Sbjct:  204 LLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPI 310          

HSP 3 Score: 55.8398 bits (133), Expect = 6.769e-10
Identity = 29/108 (26.85%), Postives = 52/108 (48.15%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + + G  P+H        +  E+L +R+  I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  237 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD 344          

HSP 4 Score: 50.447 bits (119), Expect = 4.970e-8
Identity = 29/103 (28.16%), Postives = 51/103 (49.51%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LLD    ID +T DG  P+     S +  ++++LLDR+  I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A    + ++  +LL++
Sbjct:  270 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDK 372          

HSP 5 Score: 50.447 bits (119), Expect = 5.320e-8
Identity = 28/106 (26.42%), Postives = 49/106 (46.23%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDH  ++   T  G  P+    +   +++  LLL ++   +   KSG  P+H A + ++ + + LL ++  +     K    P+H A  K   +I   LLE   D
Sbjct:  534 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGAD 639          

HSP 6 Score: 48.1358 bits (113), Expect = 2.695e-7
Identity = 23/76 (30.26%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  203 LLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKID 278          

HSP 7 Score: 47.3654 bits (111), Expect = 6.338e-7
Identity = 26/103 (25.24%), Postives = 45/103 (43.69%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL    + +  T  G  P+       + D+   LLD    +    K G+ P+H A      E + LL  ++ + +   K  L P+H A   +N ++  LLL++
Sbjct:  501 LLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 603          

HSP 8 Score: 46.9802 bits (110), Expect = 8.400e-7
Identity = 29/101 (28.71%), Postives = 45/101 (44.55%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            LL HN  +D  TND    +       +  + K+LLD+      +  +G+ P+H A  K      ELL     +I+  T+  L PIH A    +  I + L+
Sbjct:  336 LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 436          

HSP 9 Score: 45.8246 bits (107), Expect = 2.329e-6
Identity = 26/107 (24.30%), Postives = 47/107 (43.93%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL  + + D     G  P+       N  +  LLLD+        K+G+ P+H A  K   + +  L     +    T+Q +  +H A  + + ++ +LLL RN ++
Sbjct:  567 LLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANV 673          

HSP 10 Score: 44.669 bits (104), Expect = 4.508e-6
Identity = 28/108 (25.93%), Postives = 50/108 (46.30%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD+  +    T DG  P+   ++  +  ++ LLL+ +     + K     +H A  K+D + + LL   + N + E+K    P+H A    N  +  LLL R   ++
Sbjct:  142 LLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD 245          

HSP 11 Score: 44.669 bits (104), Expect = 5.859e-6
Identity = 23/108 (21.30%), Postives = 45/108 (41.67%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD   +      +G  P+    +   +D+   LL+   D     + G   +H A  +   +   LL +RN N+    K  L P+H A  ++   +  +L+ +   ++
Sbjct:  600 LLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD 707          
BLAST of SMED30028892 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 62.3882 bits (150), Expect = 3.419e-12
Identity = 28/107 (26.17%), Postives = 56/107 (52.34%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++  + +  T  G   +    +  ++D++ LLL RN ++   +KSG  P+H A  ++    +E+L N+  +++ +TK    P+H      N +I N LL+ +  +
Sbjct:  644 LLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKV 750          

HSP 2 Score: 57.7658 bits (138), Expect = 1.236e-10
Identity = 28/107 (26.17%), Postives = 55/107 (51.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +T+  L P+H      + ++  +LL+R+  I
Sbjct:  215 LLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPI 321          

HSP 3 Score: 55.8398 bits (133), Expect = 6.773e-10
Identity = 29/108 (26.85%), Postives = 52/108 (48.15%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + + G  P+H        +  E+L +R+  I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  248 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD 355          

HSP 4 Score: 50.447 bits (119), Expect = 4.973e-8
Identity = 29/103 (28.16%), Postives = 51/103 (49.51%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LLD    ID +T DG  P+     S +  ++++LLDR+  I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A    + ++  +LL++
Sbjct:  281 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDK 383          

HSP 5 Score: 50.447 bits (119), Expect = 5.323e-8
Identity = 28/106 (26.42%), Postives = 49/106 (46.23%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDH  ++   T  G  P+    +   +++  LLL ++   +   KSG  P+H A + ++ + + LL ++  +     K    P+H A  K   +I   LLE   D
Sbjct:  545 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGAD 650          

HSP 6 Score: 48.1358 bits (113), Expect = 2.697e-7
Identity = 23/76 (30.26%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  214 LLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKID 289          

HSP 7 Score: 47.3654 bits (111), Expect = 6.341e-7
Identity = 26/103 (25.24%), Postives = 45/103 (43.69%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL    + +  T  G  P+       + D+   LLD    +    K G+ P+H A      E + LL  ++ + +   K  L P+H A   +N ++  LLL++
Sbjct:  512 LLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 614          

HSP 8 Score: 46.9802 bits (110), Expect = 8.405e-7
Identity = 29/101 (28.71%), Postives = 45/101 (44.55%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            LL HN  +D  TND    +       +  + K+LLD+      +  +G+ P+H A  K      ELL     +I+  T+  L PIH A    +  I + L+
Sbjct:  347 LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 447          

HSP 9 Score: 45.8246 bits (107), Expect = 2.330e-6
Identity = 26/107 (24.30%), Postives = 47/107 (43.93%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL  + + D     G  P+       N  +  LLLD+        K+G+ P+H A  K   + +  L     +    T+Q +  +H A  + + ++ +LLL RN ++
Sbjct:  578 LLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANV 684          

HSP 10 Score: 44.669 bits (104), Expect = 4.511e-6
Identity = 28/108 (25.93%), Postives = 50/108 (46.30%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD+  +    T DG  P+   ++  +  ++ LLL+ +     + K     +H A  K+D + + LL   + N + E+K    P+H A    N  +  LLL R   ++
Sbjct:  153 LLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD 256          

HSP 11 Score: 44.669 bits (104), Expect = 5.863e-6
Identity = 23/108 (21.30%), Postives = 45/108 (41.67%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD   +      +G  P+    +   +D+   LL+   D     + G   +H A  +   +   LL +RN N+    K  L P+H A  ++   +  +L+ +   ++
Sbjct:  611 LLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD 718          
BLAST of SMED30028892 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 62.3882 bits (150), Expect = 3.422e-12
Identity = 28/107 (26.17%), Postives = 56/107 (52.34%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++  + +  T  G   +    +  ++D++ LLL RN ++   +KSG  P+H A  ++    +E+L N+  +++ +TK    P+H      N +I N LL+ +  +
Sbjct:  633 LLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKV 739          

HSP 2 Score: 57.7658 bits (138), Expect = 1.237e-10
Identity = 28/107 (26.17%), Postives = 55/107 (51.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +T+  L P+H      + ++  +LL+R+  I
Sbjct:  204 LLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPI 310          

HSP 3 Score: 55.8398 bits (133), Expect = 6.779e-10
Identity = 29/108 (26.85%), Postives = 52/108 (48.15%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + + G  P+H        +  E+L +R+  I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  237 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD 344          

HSP 4 Score: 50.447 bits (119), Expect = 4.977e-8
Identity = 29/103 (28.16%), Postives = 51/103 (49.51%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LLD    ID +T DG  P+     S +  ++++LLDR+  I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A    + ++  +LL++
Sbjct:  270 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDK 372          

HSP 5 Score: 50.447 bits (119), Expect = 5.327e-8
Identity = 28/106 (26.42%), Postives = 49/106 (46.23%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDH  ++   T  G  P+    +   +++  LLL ++   +   KSG  P+H A + ++ + + LL ++  +     K    P+H A  K   +I   LLE   D
Sbjct:  534 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGAD 639          

HSP 6 Score: 48.1358 bits (113), Expect = 2.699e-7
Identity = 23/76 (30.26%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  203 LLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKID 278          

HSP 7 Score: 47.3654 bits (111), Expect = 6.347e-7
Identity = 26/103 (25.24%), Postives = 45/103 (43.69%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL    + +  T  G  P+       + D+   LLD    +    K G+ P+H A      E + LL  ++ + +   K  L P+H A   +N ++  LLL++
Sbjct:  501 LLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 603          

HSP 8 Score: 46.9802 bits (110), Expect = 8.412e-7
Identity = 29/101 (28.71%), Postives = 45/101 (44.55%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            LL HN  +D  TND    +       +  + K+LLD+      +  +G+ P+H A  K      ELL     +I+  T+  L PIH A    +  I + L+
Sbjct:  336 LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 436          

HSP 9 Score: 45.8246 bits (107), Expect = 2.332e-6
Identity = 26/107 (24.30%), Postives = 47/107 (43.93%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL  + + D     G  P+       N  +  LLLD+        K+G+ P+H A  K   + +  L     +    T+Q +  +H A  + + ++ +LLL RN ++
Sbjct:  567 LLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANV 673          

HSP 10 Score: 44.669 bits (104), Expect = 4.514e-6
Identity = 28/108 (25.93%), Postives = 50/108 (46.30%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD+  +    T DG  P+   ++  +  ++ LLL+ +     + K     +H A  K+D + + LL   + N + E+K    P+H A    N  +  LLL R   ++
Sbjct:  142 LLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD 245          

HSP 11 Score: 44.669 bits (104), Expect = 5.868e-6
Identity = 23/108 (21.30%), Postives = 45/108 (41.67%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD   +      +G  P+    +   +D+   LL+   D     + G   +H A  +   +   LL +RN N+    K  L P+H A  ++   +  +L+ +   ++
Sbjct:  600 LLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD 707          
BLAST of SMED30028892 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 62.3882 bits (150), Expect = 3.429e-12
Identity = 28/107 (26.17%), Postives = 56/107 (52.34%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++  + +  T  G   +    +  ++D++ LLL RN ++   +KSG  P+H A  ++    +E+L N+  +++ +TK    P+H      N +I N LL+ +  +
Sbjct:  633 LLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKV 739          

HSP 2 Score: 57.7658 bits (138), Expect = 1.239e-10
Identity = 28/107 (26.17%), Postives = 55/107 (51.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +T+  L P+H      + ++  +LL+R+  I
Sbjct:  204 LLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPI 310          

HSP 3 Score: 55.8398 bits (133), Expect = 6.792e-10
Identity = 29/108 (26.85%), Postives = 52/108 (48.15%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + + G  P+H        +  E+L +R+  I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  237 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD 344          

HSP 4 Score: 50.447 bits (119), Expect = 4.986e-8
Identity = 29/103 (28.16%), Postives = 51/103 (49.51%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LLD    ID +T DG  P+     S +  ++++LLDR+  I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A    + ++  +LL++
Sbjct:  270 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDK 372          

HSP 5 Score: 50.447 bits (119), Expect = 5.337e-8
Identity = 28/106 (26.42%), Postives = 49/106 (46.23%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDH  ++   T  G  P+    +   +++  LLL ++   +   KSG  P+H A + ++ + + LL ++  +     K    P+H A  K   +I   LLE   D
Sbjct:  534 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGAD 639          

HSP 6 Score: 48.1358 bits (113), Expect = 2.704e-7
Identity = 23/76 (30.26%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  203 LLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKID 278          

HSP 7 Score: 47.3654 bits (111), Expect = 6.358e-7
Identity = 26/103 (25.24%), Postives = 45/103 (43.69%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL    + +  T  G  P+       + D+   LLD    +    K G+ P+H A      E + LL  ++ + +   K  L P+H A   +N ++  LLL++
Sbjct:  501 LLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 603          

HSP 8 Score: 46.9802 bits (110), Expect = 8.427e-7
Identity = 29/101 (28.71%), Postives = 45/101 (44.55%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            LL HN  +D  TND    +       +  + K+LLD+      +  +G+ P+H A  K      ELL     +I+  T+  L PIH A    +  I + L+
Sbjct:  336 LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 436          

HSP 9 Score: 45.8246 bits (107), Expect = 2.337e-6
Identity = 26/107 (24.30%), Postives = 47/107 (43.93%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL  + + D     G  P+       N  +  LLLD+        K+G+ P+H A  K   + +  L     +    T+Q +  +H A  + + ++ +LLL RN ++
Sbjct:  567 LLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANV 673          

HSP 10 Score: 44.669 bits (104), Expect = 4.523e-6
Identity = 28/108 (25.93%), Postives = 50/108 (46.30%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD+  +    T DG  P+   ++  +  ++ LLL+ +     + K     +H A  K+D + + LL   + N + E+K    P+H A    N  +  LLL R   ++
Sbjct:  142 LLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD 245          

HSP 11 Score: 44.669 bits (104), Expect = 5.878e-6
Identity = 23/108 (21.30%), Postives = 45/108 (41.67%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD   +      +G  P+    +   +D+   LL+   D     + G   +H A  +   +   LL +RN N+    K  L P+H A  ++   +  +L+ +   ++
Sbjct:  600 LLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD 707          
BLAST of SMED30028892 vs. UniProt/SwissProt
Match: sp|Q8BZ25|ANKK1_MOUSE (Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankk1 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 6.713e-13
Identity = 31/107 (28.97%), Postives = 48/107 (44.86%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL H+ ++DC+T  G  P+    + +  DL  LLL    D    D+ GW P+H A    D  T+ LL +    +     +   P+H A       +  LL+ R  D+
Sbjct:  389 LLSHDVDVDCQTASGYTPLLIATQDQQPDLCALLLAHGADTNLADEDGWAPLHFAAQNGDDHTARLLLDHGALVNAREHEGWTPLHLAAQNNFENVARLLVSRQADL 495          
BLAST of SMED30028892 vs. UniProt/SwissProt
Match: sp|Q02989|LITA_LATTR (Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus OX=6925 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.591e-12
Identity = 35/109 (32.11%), Postives = 51/109 (46.79%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            L D N NI  ETN G  P+     + N  L+  LL +N D+      G+  +H  I  ++ E    L  +  N+  +T   + P+HFA     + IF LLL R  DI+ 
Sbjct:  723 LSDENLNIRLETNGGINPLHLASATGNKQLVIELLAKNADVTRLTSKGFSALHLGIIGKNEEIPFFLVEKGANVNDKTNSGVTPLHFAAGLGKANIFRLLLSRGADIKA 831          

HSP 2 Score: 54.299 bits (129), Expect = 1.680e-8
Identity = 26/108 (24.07%), Postives = 55/108 (50.93%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNI-ECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            L++   N++ +TN G  P+ F       ++ +LLL R  DI+ ED +   PIH A++    E   +L  ++ ++   +  +   P + A+ K   +IF+  + ++ ++
Sbjct:  789 LVEKGANVNDKTNSGVTPLHFAAGLGKANIFRLLLSRGADIKAEDINSQMPIHEAVSNGHLEIVRILIEKDPSLMNVKNIRNEYPFYLAVEKRYKDIFDYFVSKDANV 896          

HSP 3 Score: 49.6766 bits (117), Expect = 6.064e-7
Identity = 28/107 (26.17%), Postives = 53/107 (49.53%), Query Frame = 1
Query:    1 LLDHNCNIDCET-NDGKRPIQFVIESKNIDLLKLLLD-RNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNC 315
            L+ +N +++  T +D   P+         D+ + L+D    D+  +DKSG+ P+H +I+      + L+ N N  I  ++K  L P+H A ++ N  +  LL  +  
Sbjct:  553 LIGNNADVNVRTKSDLFTPLHLAARRDLTDVTQTLIDITEIDLNAQDKSGFTPLHLSISSTSETAAILIRNTNAVINIKSKVGLTPLHLATLQNNLSVSKLLAGKGA 659          

HSP 4 Score: 46.9802 bits (110), Expect = 6.124e-6
Identity = 28/98 (28.57%), Postives = 52/98 (53.06%), Query Frame = 1
Query:   40 DGKRPIQFVIESKNIDLLKLLLDR---NCDIEYEDKSGWRPIHHAINKEDWETSE-LLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            +G  P+ +   + N++++  LL++   N +   ++K  W P+H AI  +  + +E LL + N NI  ET   + P+H A    N ++   LL +N D+
Sbjct:  667 NGMTPLHYAAMTGNLEMVDFLLNQQYININAATKEKK-WTPLHLAILFKKNDVAERLLSDENLNIRLETNGGINPLHLASATGNKQLVIELLAKNADV 763          
BLAST of SMED30028892 vs. UniProt/SwissProt
Match: sp|Q8NFD2|ANKK1_HUMAN (Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.645e-12
Identity = 31/106 (29.25%), Postives = 49/106 (46.23%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL H  ++DC+T  G  P+    + +  DL  LLL    D    D+ GW P+H A    D  T+ LL +    ++ + ++   P+H A       +  LL+ R  D
Sbjct:  381 LLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQAD 486          

HSP 2 Score: 47.3654 bits (111), Expect = 3.337e-6
Identity = 25/107 (23.36%), Postives = 50/107 (46.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            L      +D +  + + P+   +E   +  ++ LL      +  D+SG+ P+H A  +  +   ++L     ++E  T Q   P+H A  K + EI +LL E + ++
Sbjct:  513 LTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANM 619          
BLAST of SMED30028892 vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.400e-11
Identity = 28/107 (26.17%), Postives = 56/107 (52.34%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++  + +  T  G   +    +  ++D++ LLL RN ++   +KSG  P+H A  ++    +E+L N+  +++ +TK    P+H      N +I N LL+ +  +
Sbjct:  633 LLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKV 739          

HSP 2 Score: 57.7658 bits (138), Expect = 8.673e-10
Identity = 28/107 (26.17%), Postives = 55/107 (51.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +T+  L P+H      + ++  +LL+R+  I
Sbjct:  204 LLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPI 310          

HSP 3 Score: 55.8398 bits (133), Expect = 4.753e-9
Identity = 29/108 (26.85%), Postives = 52/108 (48.15%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + + G  P+H        +  E+L +R+  I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  237 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD 344          

HSP 4 Score: 50.447 bits (119), Expect = 3.490e-7
Identity = 29/103 (28.16%), Postives = 51/103 (49.51%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LLD    ID +T DG  P+     S +  ++++LLDR+  I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A    + ++  +LL++
Sbjct:  270 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDK 372          

HSP 5 Score: 50.447 bits (119), Expect = 3.735e-7
Identity = 28/106 (26.42%), Postives = 49/106 (46.23%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDH  ++   T  G  P+    +   +++  LLL ++   +   KSG  P+H A + ++ + + LL ++  +     K    P+H A  K   +I   LLE   D
Sbjct:  534 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGAD 639          

HSP 6 Score: 48.1358 bits (113), Expect = 1.893e-6
Identity = 23/76 (30.26%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  203 LLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKID 278          

HSP 7 Score: 47.3654 bits (111), Expect = 4.450e-6
Identity = 26/103 (25.24%), Postives = 45/103 (43.69%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL    + +  T  G  P+       + D+   LLD    +    K G+ P+H A      E + LL  ++ + +   K  L P+H A   +N ++  LLL++
Sbjct:  501 LLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 603          

HSP 8 Score: 46.9802 bits (110), Expect = 5.898e-6
Identity = 29/101 (28.71%), Postives = 45/101 (44.55%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            LL HN  +D  TND    +       +  + K+LLD+      +  +G+ P+H A  K      ELL     +I+  T+  L PIH A    +  I + L+
Sbjct:  336 LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 436          
BLAST of SMED30028892 vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 62.3882 bits (150), Expect = 2.417e-11
Identity = 28/107 (26.17%), Postives = 56/107 (52.34%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++  + +  T  G   +    +  ++D++ LLL RN ++   +KSG  P+H A  ++    +E+L N+  +++ +TK    P+H      N +I N LL+ +  +
Sbjct:  658 LLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKV 764          

HSP 2 Score: 54.6842 bits (130), Expect = 9.829e-9
Identity = 29/108 (26.85%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + + G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL+ N  ++
Sbjct:  262 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD 369          

HSP 3 Score: 51.9878 bits (123), Expect = 1.023e-7
Identity = 22/104 (21.15%), Postives = 51/104 (49.04%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERN 312
            LL  N N++     G  P+    +   +++ ++L+++   ++ + K G+ P+H   +  + +    L   +  +  +TK    P+H A  + ++ I N+LL+ N
Sbjct:  691 LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNN 794          

HSP 4 Score: 50.8322 bits (120), Expect = 2.677e-7
Identity = 29/115 (25.22%), Postives = 54/115 (46.96%), Query Frame = 1
Query:    1 LLDHNCNIDCE--------TNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E        T  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +T+  L P+H      + ++  +LL+R   I
Sbjct:  221 LLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPI 335          

HSP 5 Score: 50.447 bits (119), Expect = 3.762e-7
Identity = 28/106 (26.42%), Postives = 49/106 (46.23%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDH  ++   T  G  P+    +   +++  LLL ++   +   KSG  P+H A + ++ + + LL ++  +     K    P+H A  K   +I   LLE   D
Sbjct:  559 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGAD 664          

HSP 6 Score: 49.6766 bits (117), Expect = 5.713e-7
Identity = 29/106 (27.36%), Postives = 51/106 (48.11%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLD    ID +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL   N  ++  T   L  +H A    + ++  +LL++  +
Sbjct:  295 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAN 400          

HSP 7 Score: 47.3654 bits (111), Expect = 3.550e-6
Identity = 29/101 (28.71%), Postives = 46/101 (45.54%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            LL HN  +D  TND    +       +  + K+LLD+  +   +  +G+ P+H A  K      ELL     +I+  T+  L PIH A    +  I + L+
Sbjct:  361 LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 461          

HSP 8 Score: 46.595 bits (109), Expect = 7.284e-6
Identity = 26/103 (25.24%), Postives = 45/103 (43.69%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL    + +  T  G  P+       + D+   LLD    +    K G+ P+H A      E + LL  ++ + +   K  L P+H A   +N ++  LLL++
Sbjct:  526 LLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 628          
BLAST of SMED30028892 vs. TrEMBL
Match: A0A5E4MFZ9 (Latrotoxin, C-terminal domain,Ankyrin repeat-containing domain,Ankyrin repeat (Fragment) OS=Cinara cedri OX=506608 GN=CINCED_3A025069 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.197e-17
Identity = 37/109 (33.94%), Postives = 61/109 (55.96%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD+  NI+ E  +G+ P+ F     N+D+++ LLDR   IE +DK G+ PI +A +   W   +LL +    +  E   +  P+HFA+ + NS +   LL++  +IE 
Sbjct:  618 LLDYGANINAEDIEGRTPLSFATSGNNLDMIQFLLDRGASIEAQDKPGYTPILYAASLGRWSEVKLLIDNGAKLNNEITYQGTPLHFAVQEGNSNMVQFLLDKGANIEA 726          

HSP 2 Score: 61.2326 bits (147), Expect = 1.674e-8
Identity = 31/103 (30.10%), Postives = 51/103 (49.51%), Query Frame = 1
Query:   19 NIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            +I+ +    + P+     + + D +++LLDR  +IE +DK G+ PI  AI    W   +LL +   NI  E  +   P+ FA    N ++   LL+R   IE 
Sbjct:  558 DIEVQGKFKRTPLHCASGAGDWDKVRILLDRGANIEVQDKFGYTPIFLAIESGKWSIVKLLLDYGANINAEDIEGRTPLSFATSGNNLDMIQFLLDRGASIEA 660          

HSP 3 Score: 59.3066 bits (142), Expect = 8.999e-8
Identity = 35/135 (25.93%), Postives = 59/135 (43.70%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLL------LDR--------------------NCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD   N+     DGK P+    +  N  ++ LL      LD+                      ++  +D+ GW P+  AI+         L +++ NIE ++K    P+H+A  ++N +++ LLLER   IE 
Sbjct:  750 LLDKGANLKATDMDGKTPLDLANQKSNTGIVGLLEQAQINLDKELLIAVAKGDLEKVRDSIRQGANVNAQDRQGWTPVFLAIH---------LLDKDANIEVKSKDGWTPLHYAAYEDNLDVYELLLERGASIEA 875          

HSP 4 Score: 53.9138 bits (128), Expect = 5.496e-6
Identity = 25/100 (25.00%), Postives = 48/100 (48.00%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLL 300
            L+D+   ++ E      P+ F ++  N ++++ LLD+  +IE +D    +P+H A+         LL ++  N++        P+  A  K N+ I  LL
Sbjct:  684 LIDNGAKLNNEITYQGTPLHFAVQEGNSNMVQFLLDKGANIEAQDAYNRKPLHLAVGANKLNVVNLLLDKGANLKATDMDGKTPLDLANQKSNTGIVGLL 783          
BLAST of SMED30028892 vs. TrEMBL
Match: A0A2K9L6I2 (Ankyrin repeat protein OS=Tupanvirus deep ocean OX=2126984 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.774e-16
Identity = 37/109 (33.94%), Postives = 64/109 (58.72%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            L+D   N++C+TN+ K P+ F I     D++K ++ +  D+E +D  GWRPIH A+     E S+ + ++  ++E ET +K +PIH AI   +  I   L+ +  ++EC
Sbjct:   87 LIDKGVNLNCKTNNKKTPLHFAIIYSTPDIVKYIIGKGVDLECQDIEGWRPIHLALRYGTPELSKYIIDQGVDLESETNEKWKPIHLAIRYSSEGIARYLILKGVNLEC 195          

HSP 2 Score: 60.8474 bits (146), Expect = 1.477e-8
Identity = 26/78 (33.33%), Postives = 41/78 (52.56%), Query Frame = 1
Query:   94 KLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            K   D   D+E  D  GW+PIH+AI        + L ++  N+ C+T  K  P+HFAI+    +I   ++ +  D+EC
Sbjct:   52 KYFFDNTNDLECSDSDGWKPIHYAIRYSKPIIIKYLIDKGVNLNCKTNNKKTPLHFAIIYSTPDIVKYIIGKGVDLEC 129          
BLAST of SMED30028892 vs. TrEMBL
Match: A0A5A8E8G3 (ANK_REP_REGION domain-containing protein OS=Cafeteria roenbergensis OX=33653 GN=FNF27_04422 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 3.112e-16
Identity = 30/106 (28.30%), Postives = 59/106 (55.66%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLDH  + + +++ G R + + ++S ++++++LLLDR   ++ ++++ W  +H A  +   E   LL +R  ++   T   + P+H A      E+  LLLER  D
Sbjct:   64 LLDHGADTEAKSDGGARTLLWAVDSGDVEIIRLLLDRGAKVDAKNRTDWTALHQAAERGQLEIVRLLLDRGADLAARTTGGVSPLHSAAAHGRQEVARLLLERGAD 169          
BLAST of SMED30028892 vs. TrEMBL
Match: A0A3G5A969 (ANK_REP_REGION domain-containing protein (Fragment) OS=Homavirus sp. OX=2487769 GN=Homavirus39_1 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 7.229e-16
Identity = 39/105 (37.14%), Postives = 62/105 (59.05%), Query Frame = 1
Query:   13 NCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            N +++CET D  RPI    ++ N D++K L+D+N  +E E     RPIH A    + E  + L ++N NIECE   +++PIH      N E+F  L+++N ++EC
Sbjct:    1 NVSLECETKDKDRPIHLACKNNNTDIVKYLIDKNVSLECETLCKHRPIHIACRNSNIEIFKYLMDKNVNIECEIFPRMKPIHIVCRNGNIEMFKYLMDKNVNLEC 105          

HSP 2 Score: 68.5514 bits (166), Expect = 1.377e-11
Identity = 38/109 (34.86%), Postives = 60/109 (55.05%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            L+D N +++CET    RPI     + NI++ K L+D+N +IE E     +PIH      + E  + L ++N N+EC T     PIH A     ++I   L+++N D+EC
Sbjct:   30 LIDKNVSLECETLCKHRPIHIACRNSNIEIFKYLMDKNVNIECEIFPRMKPIHIVCRNGNIEMFKYLMDKNVNLECGTIDHETPIHIACENNYTDIVKDLIDKNVDLEC 138          
BLAST of SMED30028892 vs. TrEMBL
Match: A0A0P8ZHN4 (ANK_REP_REGION domain-containing protein OS=Drosophila ananassae OX=7217 GN=Dana\GF26433 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.774e-15
Identity = 32/92 (34.78%), Postives = 56/92 (60.87%), Query Frame = 1
Query:   52 PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            P+ F   + +I+++K+LLDR  +I+ +++ G  P+H+AI  +  E +ELL NR  NI   +     P+HFA+ K + E+  LLL R  +++ 
Sbjct:   19 PLHFAAINGDIEIVKMLLDRGANIDAKNQYGRTPLHNAIENKKMEITELLLNRGANINVRSNDGYAPLHFAVEKGSKEVITLLLSRGANVDG 110          

HSP 2 Score: 74.7146 bits (182), Expect = 3.207e-14
Identity = 37/122 (30.33%), Postives = 61/122 (50.00%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKE---------------DWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LLD   NID +   G+ P+   IE+K +++ +LLL+R  +I      G+ P+H A+ K                D E ++LL ++  NI  +TK  +  +H A  K  +++   LLE N D+
Sbjct:   35 LLDRGANIDAKNQYGRTPLHNAIENKKMEITELLLNRGANINVRSNDGYAPLHFAVEKGSKEVITLLLSRGANVDGEIAKLLLSKGANINAQTKNGITTLHAAAQKGYTKVVEALLEYNADV 156          

HSP 3 Score: 56.225 bits (134), Expect = 3.060e-7
Identity = 32/118 (27.12%), Postives = 54/118 (45.76%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIE-------------SKNID--LLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAI-----MKENSEIFN 294
            LL+   NI+  +NDG  P+ F +E               N+D  + KLLL +  +I  + K+G   +H A  K   +  E L   N ++    K  + P+H +      +KE +++FN
Sbjct:   68 LLNRGANINVRSNDGYAPLHFAVEKGSKEVITLLLSRGANVDGEIAKLLLSKGANINAQTKNGITTLHAAAQKGYTKVVEALLEYNADVNSTVKSDITPLHLSAQQGNEVKEENKVFN 185          
BLAST of SMED30028892 vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 59.6918 bits (143), Expect = 2.392e-11
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++  + +  T  G  P+    +  N+D++ LL+ R+  I   +KSG  P+H A  ++    +E+L N    ++ ETK    P+H A    N ++ + LL+    +
Sbjct:  597 LLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKV 703          

HSP 2 Score: 57.7658 bits (138), Expect = 1.133e-10
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   ++++ ++   P+H A  + +    +LL  R   I+ +TK  L P+H      + ++  +LL+R   I
Sbjct:  168 LLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI 274          

HSP 3 Score: 51.2174 bits (121), Expect = 1.759e-8
Identity = 28/108 (25.93%), Postives = 50/108 (46.30%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D +  +   P+    +  N +++KLLL+R   I+ + K G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL     ++
Sbjct:  201 LLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVD 308          

HSP 4 Score: 50.8322 bits (120), Expect = 3.062e-8
Identity = 25/76 (32.89%), Postives = 42/76 (55.26%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++ + +  + P+H A  + NS +  LLLER   I+
Sbjct:  167 LLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARID 242          

HSP 5 Score: 49.2914 bits (116), Expect = 8.577e-8
Identity = 28/103 (27.18%), Postives = 45/103 (43.69%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL H    D  T  G  P+       + D+  +LLD+   +    K G+ P+H A      E + LL  +    +   K  L P+H A   +N ++  LLL++
Sbjct:  465 LLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQ 567          

HSP 6 Score: 49.2914 bits (116), Expect = 1.062e-7
Identity = 29/106 (27.36%), Postives = 47/106 (44.34%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLD   ++   T  G  P+    +   I++  LLL +    +   KSG  P+H A + ++ + + LL ++  +     K    P+H A  K   EI   LLE   D
Sbjct:  498 LLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGAD 603          

HSP 7 Score: 47.7506 bits (112), Expect = 3.756e-7
Identity = 28/107 (26.17%), Postives = 44/107 (41.12%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL      D     G  P+       N  +  LLLD+        K+G+ P+H A  K   E +  L     +    T+Q + P+H A  + N ++  LL+ R+  I
Sbjct:  531 LLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATI 637          

HSP 8 Score: 44.2838 bits (103), Expect = 6.040e-6
Identity = 28/108 (25.93%), Postives = 50/108 (46.30%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD+  +    T DG  P+   ++  +  ++ LLL+ +     + K     +H A  K+D + + LL   + N + E+K    P+H A    N  +  LLL R   ++
Sbjct:  106 LLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVD 209          

HSP 9 Score: 44.2838 bits (103), Expect = 6.099e-6
Identity = 25/88 (28.41%), Postives = 42/88 (47.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFA 264
            LL+    ID +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL +    ++  T   L  +H A
Sbjct:  234 LLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVA 321          
BLAST of SMED30028892 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 58.9214 bits (141), Expect = 4.163e-11
Identity = 29/107 (27.10%), Postives = 52/107 (48.60%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL+     +  T  G  P+    +  ++DL+ LLL +N ++   +K+G  P+H A  ++    +E+L N    ++  TK    P+H A    N ++ + LLE    I
Sbjct:  652 LLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKI 758          

HSP 2 Score: 57.7658 bits (138), Expect = 8.974e-11
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +TK  L P+H      + ++  +LL+R   I
Sbjct:  223 LLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI 329          

HSP 3 Score: 53.9138 bits (128), Expect = 2.422e-9
Identity = 29/108 (26.85%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + K G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL+ +  ++
Sbjct:  256 LLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVD 363          

HSP 4 Score: 52.7582 bits (125), Expect = 6.218e-9
Identity = 24/102 (23.53%), Postives = 50/102 (49.02%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL  N N++    +G  P+    +   + + ++LL+   +++   K+G+ P+H A +  + +    L      I  +TK    P+H A  + ++ I N+LL+
Sbjct:  685 LLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQ 786          

HSP 5 Score: 47.7506 bits (112), Expect = 3.033e-7
Identity = 28/102 (27.45%), Postives = 45/102 (44.12%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL+H  ++   T  G  P+    +   I+  KLLL +    +   K+G  P+H A + ++   + LL +   +     K    P+H A  K   EI   LLE
Sbjct:  553 LLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLE 654          

HSP 6 Score: 47.7506 bits (112), Expect = 3.612e-7
Identity = 33/139 (23.74%), Postives = 56/139 (40.29%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLL-------------------------------DRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+H  +    T DG  P+   ++  +  ++ LLL                               D N D+E   KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N  +  LLL+R   I+
Sbjct:  161 LLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVE--SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKID 297          

HSP 7 Score: 46.595 bits (109), Expect = 8.492e-7
Identity = 26/88 (29.55%), Postives = 42/88 (47.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFA 264
            LLD    ID +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL   +  ++  T   L  +H A
Sbjct:  289 LLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVA 376          

HSP 8 Score: 45.8246 bits (107), Expect = 1.354e-6
Identity = 25/103 (24.27%), Postives = 46/103 (44.66%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL +   +D +  D +  +         ++++LLL +         SG+ P+H A+ +   ET+ LL     ++   TK+   P+H A      E   LLL++
Sbjct:  487 LLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQK 589          

HSP 9 Score: 45.4394 bits (106), Expect = 2.243e-6
Identity = 23/108 (21.30%), Postives = 46/108 (42.59%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLDH  +      +G  P+    +   +++   LL+   +     + G  P+H A  +   +   LL  +N N+    K  L P+H A  ++   +  +LL    +++
Sbjct:  619 LLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVD 726          

HSP 10 Score: 45.0542 bits (105), Expect = 2.944e-6
Identity = 27/107 (25.23%), Postives = 43/107 (40.19%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL      D     G  P+       N  +  LLLD         K+G+ P+H A  K   E    L          T+Q + P+H A  + + ++ +LLL +N ++
Sbjct:  586 LLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANV 692          
BLAST of SMED30028892 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 58.9214 bits (141), Expect = 4.241e-11
Identity = 29/107 (27.10%), Postives = 52/107 (48.60%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL+     +  T  G  P+    +  ++DL+ LLL +N ++   +K+G  P+H A  ++    +E+L N    ++  TK    P+H A    N ++ + LLE    I
Sbjct:  604 LLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKI 710          

HSP 2 Score: 54.299 bits (129), Expect = 1.547e-9
Identity = 28/111 (25.23%), Postives = 55/111 (49.55%), Query Frame = 1
Query:    7 DHNCNIDCE------TNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            DHN +++ +      T+ G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +TK  L P+H      + ++  +LL+R   I
Sbjct:  171 DHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI 281          

HSP 3 Score: 53.9138 bits (128), Expect = 2.467e-9
Identity = 29/108 (26.85%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + K G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL+ +  ++
Sbjct:  208 LLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVD 315          

HSP 4 Score: 52.7582 bits (125), Expect = 6.333e-9
Identity = 24/102 (23.53%), Postives = 50/102 (49.02%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL  N N++    +G  P+    +   + + ++LL+   +++   K+G+ P+H A +  + +    L      I  +TK    P+H A  + ++ I N+LL+
Sbjct:  637 LLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQ 738          

HSP 5 Score: 47.7506 bits (112), Expect = 3.088e-7
Identity = 28/102 (27.45%), Postives = 45/102 (44.12%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL+H  ++   T  G  P+    +   I+  KLLL +    +   K+G  P+H A + ++   + LL +   +     K    P+H A  K   EI   LLE
Sbjct:  505 LLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLE 606          

HSP 6 Score: 46.595 bits (109), Expect = 8.648e-7
Identity = 26/88 (29.55%), Postives = 42/88 (47.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFA 264
            LLD    ID +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL   +  ++  T   L  +H A
Sbjct:  241 LLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVA 328          

HSP 7 Score: 45.8246 bits (107), Expect = 1.378e-6
Identity = 25/103 (24.27%), Postives = 46/103 (44.66%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL +   +D +  D +  +         ++++LLL +         SG+ P+H A+ +   ET+ LL     ++   TK+   P+H A      E   LLL++
Sbjct:  439 LLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQK 541          

HSP 8 Score: 45.4394 bits (106), Expect = 2.284e-6
Identity = 23/108 (21.30%), Postives = 46/108 (42.59%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLDH  +      +G  P+    +   +++   LL+   +     + G  P+H A  +   +   LL  +N N+    K  L P+H A  ++   +  +LL    +++
Sbjct:  571 LLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVD 678          

HSP 9 Score: 45.0542 bits (105), Expect = 2.998e-6
Identity = 27/107 (25.23%), Postives = 43/107 (40.19%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL      D     G  P+       N  +  LLLD         K+G+ P+H A  K   E    L          T+Q + P+H A  + + ++ +LLL +N ++
Sbjct:  538 LLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANV 644          
BLAST of SMED30028892 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 58.9214 bits (141), Expect = 4.380e-11
Identity = 29/107 (27.10%), Postives = 52/107 (48.60%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL+     +  T  G  P+    +  ++DL+ LLL +N ++   +K+G  P+H A  ++    +E+L N    ++  TK    P+H A    N ++ + LLE    I
Sbjct:  624 LLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKI 730          

HSP 2 Score: 54.299 bits (129), Expect = 1.678e-9
Identity = 28/111 (25.23%), Postives = 55/111 (49.55%), Query Frame = 1
Query:    7 DHNCNIDCE------TNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            DHN +++ +      T+ G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   I+ +TK  L P+H      + ++  +LL+R   I
Sbjct:  191 DHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI 301          

HSP 3 Score: 53.9138 bits (128), Expect = 2.598e-9
Identity = 29/108 (26.85%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   I+ + K G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL+ +  ++
Sbjct:  228 LLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVD 335          

HSP 4 Score: 52.7582 bits (125), Expect = 6.293e-9
Identity = 24/102 (23.53%), Postives = 50/102 (49.02%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL  N N++    +G  P+    +   + + ++LL+   +++   K+G+ P+H A +  + +    L      I  +TK    P+H A  + ++ I N+LL+
Sbjct:  657 LLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQ 758          

HSP 5 Score: 47.7506 bits (112), Expect = 3.129e-7
Identity = 28/102 (27.45%), Postives = 45/102 (44.12%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL+H  ++   T  G  P+    +   I+  KLLL +    +   K+G  P+H A + ++   + LL +   +     K    P+H A  K   EI   LLE
Sbjct:  525 LLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLE 626          

HSP 6 Score: 46.595 bits (109), Expect = 9.379e-7
Identity = 26/88 (29.55%), Postives = 42/88 (47.73%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFA 264
            LLD    ID +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL   +  ++  T   L  +H A
Sbjct:  261 LLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVA 348          

HSP 7 Score: 45.8246 bits (107), Expect = 1.438e-6
Identity = 25/103 (24.27%), Postives = 46/103 (44.66%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL +   +D +  D +  +         ++++LLL +         SG+ P+H A+ +   ET+ LL     ++   TK+   P+H A      E   LLL++
Sbjct:  459 LLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQK 561          

HSP 8 Score: 45.4394 bits (106), Expect = 2.248e-6
Identity = 23/108 (21.30%), Postives = 46/108 (42.59%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLDH  +      +G  P+    +   +++   LL+   +     + G  P+H A  +   +   LL  +N N+    K  L P+H A  ++   +  +LL    +++
Sbjct:  591 LLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVD 698          

HSP 9 Score: 45.0542 bits (105), Expect = 3.127e-6
Identity = 27/107 (25.23%), Postives = 43/107 (40.19%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL      D     G  P+       N  +  LLLD         K+G+ P+H A  K   E    L          T+Q + P+H A  + + ++ +LLL +N ++
Sbjct:  558 LLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANV 664          
BLAST of SMED30028892 vs. Ensembl Cavefish
Match: ENSAMXT00000037173.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21074007:21119253:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000037173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 5.354e-11
Identity = 30/107 (28.04%), Postives = 53/107 (49.53%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D ++  G  P+       N+++  LLL+R   +++  ++G  P+H A  + +     LL +R   I+ +T+  L P+H A    +     LLLER   I
Sbjct:  195 LLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPI 301          

HSP 2 Score: 54.6842 bits (130), Expect = 1.019e-9
Identity = 30/108 (27.78%), Postives = 49/108 (45.37%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +G  P+    +  N ++++LLLDR   I+ + + G  P+H A         ELL  R   I   TK  L P+H A   ++ E    LL+    ++
Sbjct:  228 LLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 335          

HSP 3 Score: 46.2098 bits (108), Expect = 1.126e-6
Identity = 22/76 (28.95%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + + KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  194 LLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQID 269          

HSP 4 Score: 44.669 bits (104), Expect = 4.221e-6
Identity = 29/106 (27.36%), Postives = 47/106 (44.34%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLD    ID +T DG  P+     S +   ++LLL+R   I    K+G  P+H A   +  E  + L      ++  T   L  +H A    +  +  LLL++  +
Sbjct:  261 LLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRAN 366          
BLAST of SMED30028892 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 1.039e-11
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL H  N D  +  G  P+       N+++  LLL+    +++  ++G  P+H A  + +    +LL +R   I+ +T+  L P+H A    + ++  +LLER+  I
Sbjct:  191 LLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPI 297          

HSP 2 Score: 58.151 bits (139), Expect = 1.548e-11
Identity = 32/108 (29.63%), Postives = 52/108 (48.15%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +G  P+    +  N +++KLLLDR   I+ + + G  P+H A      +  E+L  R+  I  +TK  L P+H A   E+     LLL R   ++
Sbjct:  224 LLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVD 331          

HSP 3 Score: 55.8398 bits (133), Expect = 8.239e-11
Identity = 32/103 (31.07%), Postives = 51/103 (49.51%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LLD    ID +T DG  P+     S +  ++++LL+R+  I  + K+G  P+H A   E     +LL  R   ++  T   L P+H A    +  +  LLL+R
Sbjct:  257 LLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDR 359          

HSP 4 Score: 44.669 bits (104), Expect = 7.068e-7
Identity = 30/102 (29.41%), Postives = 44/102 (43.14%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL     +D  T D   P+       +  + KLLLDR  +      +G+ P+H A  K   +  ELL     +I   T+  L PIH A    +  +  LLL+
Sbjct:  323 LLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ 424          

HSP 5 Score: 44.2838 bits (103), Expect = 9.187e-7
Identity = 27/106 (25.47%), Postives = 44/106 (41.51%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL H  +I   T  G  PI       ++++++LLL         +  G  P+H A      E  + L      +  + ++   P+H A     +EI  LLL+R  D
Sbjct:  389 LLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSD 494          

HSP 6 Score: 43.1282 bits (100), Expect = 2.402e-6
Identity = 24/94 (25.53%), Postives = 43/94 (45.74%), Query Frame = 1
Query:   40 DGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            +G  P+       +  +  LLLD+        K+G+ P+H A  K   E  ++L          T+Q + P+H A  + ++++  LLL R+  I
Sbjct:  569 NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASI 662          

HSP 7 Score: 41.9726 bits (97), Expect = 6.466e-6
Identity = 21/76 (27.63%), Postives = 38/76 (50.00%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL    + +   KSG+ P+H A +  +   + LL N    ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  190 LLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKID 265          
BLAST of SMED30028892 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.554e-11
Identity = 32/108 (29.63%), Postives = 52/108 (48.15%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +G  P+    +  N +++KLLLDR   I+ + + G  P+H A      +  E+L  R+  I  +TK  L P+H A   E+     LLL R   ++
Sbjct:  231 LLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVD 338          

HSP 2 Score: 55.8398 bits (133), Expect = 8.275e-11
Identity = 32/103 (31.07%), Postives = 51/103 (49.51%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LLD    ID +T DG  P+     S +  ++++LL+R+  I  + K+G  P+H A   E     +LL  R   ++  T   L P+H A    +  +  LLL+R
Sbjct:  264 LLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDR 366          

HSP 3 Score: 52.373 bits (124), Expect = 1.347e-9
Identity = 30/115 (26.09%), Postives = 54/115 (46.96%), Query Frame = 1
Query:    1 LLDHNCNIDCE--------TNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL H  N D          T  G  P+       N+++  LLL+    +++  ++G  P+H A  + +    +LL +R   I+ +T+  L P+H A    + ++  +LLER+  I
Sbjct:  190 LLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPI 304          

HSP 4 Score: 46.595 bits (109), Expect = 1.787e-7
Identity = 28/103 (27.18%), Postives = 48/103 (46.60%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL    + +  T  G  P+ F     + D+  LLL+   DI    K G+ P+H A      E + LL  +  + + + K  L P+H A   ++ ++  LLL++
Sbjct:  495 LLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDK 597          

HSP 5 Score: 46.2098 bits (108), Expect = 2.048e-7
Identity = 27/107 (25.23%), Postives = 49/107 (45.79%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL+   + D +  +G  P+       +  +  LLLD+        K+G+ P+H A  K   E  ++L          T+Q + P+H A  + ++++  LLL R+  I
Sbjct:  561 LLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASI 667          

HSP 6 Score: 44.669 bits (104), Expect = 7.099e-7
Identity = 30/102 (29.41%), Postives = 44/102 (43.14%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL     +D  T D   P+       +  + KLLLDR  +      +G+ P+H A  K   +  ELL     +I   T+  L PIH A    +  +  LLL+
Sbjct:  330 LLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ 431          

HSP 7 Score: 44.2838 bits (103), Expect = 9.227e-7
Identity = 27/106 (25.47%), Postives = 44/106 (41.51%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL H  +I   T  G  PI       ++++++LLL         +  G  P+H A      E  + L      +  + ++   P+H A     +EI  LLL+R  D
Sbjct:  396 LLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSD 501          

HSP 8 Score: 43.8986 bits (102), Expect = 1.685e-6
Identity = 25/102 (24.51%), Postives = 49/102 (48.04%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL++  +I   T  G  P+    +   +++  LLL++    + + K+G  P+H A + +  + + LL ++  +     K    P+H A  K   E+  +LLE
Sbjct:  528 LLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLE 629          
BLAST of SMED30028892 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 2.736e-11
Identity = 28/102 (27.45%), Postives = 51/102 (50.00%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            N++C  +DG++  P+        + +++LLL    D+  +DK G  P+H+A +   +E +ELL     ++      +  P+H A  K   E+ +LLL    D
Sbjct:  324 NVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGAD 425          

HSP 2 Score: 54.299 bits (129), Expect = 3.201e-10
Identity = 29/101 (28.71%), Postives = 48/101 (47.52%), Query Frame = 1
Query:   22 IDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            ++C   +G+   P+ F      + +++ LL    D+  +DK G  P+H+A +   +E +ELL  R   +      K  P+H A  K   EI  LLL+   D
Sbjct:  641 VNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGAD 741          

HSP 3 Score: 47.7506 bits (112), Expect = 6.391e-8
Identity = 25/102 (24.51%), Postives = 48/102 (47.06%), Query Frame = 1
Query:   19 NIDCETNDGKR--PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            N++C  + G+   P+       N+++ + LL+   D+  +DK G  P+H+A +    + + LL   +  +    K    P+H A  K  +++  LLL    D
Sbjct:  793 NVNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGAD 894          
BLAST of SMED30028892 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 2.711e-9
Identity = 28/107 (26.17%), Postives = 49/107 (45.79%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++    +  T  G  P+    +  + D+  LLL R  D+ +  KSG  P+H A  ++    +E+L     ++   TK    P+  A    N ++ N LL+   D+
Sbjct:  265 LLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADV 371          

HSP 2 Score: 49.2914 bits (116), Expect = 1.653e-8
Identity = 28/103 (27.18%), Postives = 48/103 (46.60%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL H  + D  T++G  P+       + D+  +LL+    +    K G+ P+H A      E + LL  R  + +   K  L P+H A   +N ++  LLL++
Sbjct:  133 LLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQ 235          

HSP 3 Score: 46.9802 bits (110), Expect = 1.143e-7
Identity = 27/107 (25.23%), Postives = 47/107 (43.93%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL    + D    +G  P+       N  +  LLLD+        K+G+ P+H A  K+  E +  L          T+Q + P+H    + ++++ +LLL R  D+
Sbjct:  199 LLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADV 305          

HSP 4 Score: 46.595 bits (109), Expect = 1.857e-7
Identity = 27/102 (26.47%), Postives = 48/102 (47.06%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL+H  ++   T  G  P+    +   +++  LLL R    +   K+G  P+H A + ++ + + LL ++  +     K    P+H A  K+  EI   LLE
Sbjct:  166 LLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLE 267          

HSP 5 Score: 43.5134 bits (101), Expect = 1.838e-6
Identity = 22/103 (21.36%), Postives = 48/103 (46.60%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL +   +D +  + + P+        +++++LLL      +    +G+ P+H A  +   + + +L     ++   TK+   P+H A      E+ +LLL+R
Sbjct:  100 LLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQR 202          
BLAST of SMED30028892 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 2.744e-9
Identity = 28/107 (26.17%), Postives = 49/107 (45.79%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL++    +  T  G  P+    +  + D+  LLL R  D+ +  KSG  P+H A  ++    +E+L     ++   TK    P+  A    N ++ N LL+   D+
Sbjct:  355 LLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADV 461          

HSP 2 Score: 49.2914 bits (116), Expect = 1.673e-8
Identity = 28/103 (27.18%), Postives = 48/103 (46.60%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL H  + D  T++G  P+       + D+  +LL+    +    K G+ P+H A      E + LL  R  + +   K  L P+H A   +N ++  LLL++
Sbjct:  223 LLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQ 325          

HSP 3 Score: 46.9802 bits (110), Expect = 1.156e-7
Identity = 27/107 (25.23%), Postives = 47/107 (43.93%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL    + D    +G  P+       N  +  LLLD+        K+G+ P+H A  K+  E +  L          T+Q + P+H    + ++++ +LLL R  D+
Sbjct:  289 LLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADV 395          

HSP 4 Score: 46.595 bits (109), Expect = 1.879e-7
Identity = 27/102 (26.47%), Postives = 48/102 (47.06%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLE 306
            LL+H  ++   T  G  P+    +   +++  LLL R    +   K+G  P+H A + ++ + + LL ++  +     K    P+H A  K+  EI   LLE
Sbjct:  256 LLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLE 357          

HSP 5 Score: 43.5134 bits (101), Expect = 1.859e-6
Identity = 22/103 (21.36%), Postives = 48/103 (46.60%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL +   +D +  + + P+        +++++LLL      +    +G+ P+H A  +   + + +L     ++   TK+   P+H A      E+ +LLL+R
Sbjct:  190 LLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQR 292          
BLAST of SMED30028892 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 41.2022 bits (95), Expect = 6.053e-6
Identity = 24/99 (24.24%), Postives = 48/99 (48.48%), Query Frame = 1
Query:   40 DGKRPIQFVIESKNIDLLKLLLDRNCDI---EYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECE--TKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            DG+ P+ + +  +  ++   LL +  ++   +Y D SGW P H A +  + E  + L++R    +    T Q +  +H A+ K+  E+   L+E    +
Sbjct:   35 DGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASV 133          
BLAST of SMED30028892 vs. Ensembl Nematostella
Match: EDO34862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN63])

HSP 1 Score: 48.521 bits (114), Expect = 1.172e-8
Identity = 25/97 (25.77%), Postives = 42/97 (43.30%), Query Frame = 1
Query:   34 TNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDK-SGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            ++ G  P+       N +L+  LL    D+  ED  SG  P+HHA+    +   E L +R   +   T      +H A  ++  E+ +LL     D+
Sbjct:    2 SSPGMTPLHLATLKGNRELITELLRMGADLNVEDGNSGRSPLHHAVESGRYHVIEFLLSRGALVNQRTFSGNTAMHTAAGRQMDEVVSLLASYGADV 98          
BLAST of SMED30028892 vs. Ensembl Nematostella
Match: EDO45485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSW0])

HSP 1 Score: 46.595 bits (109), Expect = 2.669e-8
Identity = 18/58 (31.03%), Postives = 31/58 (53.45%), Query Frame = 1
Query:  142 GWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNC 315
            G+ P+H A+    WE  +LL +   ++E +TK   +P+H A    +  I  +LL+R  
Sbjct:    1 GFTPLHIAVVYGHWEIVKLLLDEGADVEAQTKNGYQPLHLAAQYGHKIIIEILLQRGA 58          
BLAST of SMED30028892 vs. Ensembl Nematostella
Match: EDO30818 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZP1])

HSP 1 Score: 46.2098 bits (108), Expect = 6.142e-8
Identity = 25/94 (26.60%), Postives = 36/94 (38.30%), Query Frame = 1
Query:   19 NIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLL 300
             +D     G  PI        +  LK+ L    D    DK GW P+H AI   D ++   L     N+       ++PI  AI   +  +  LL
Sbjct:    2 TLDGLNASGGSPIHEAAFQGKLSCLKVFLKFGADPNMRDKEGWTPLHAAICGGDPDSVAELLRFGANVNLAANDGVKPIEMAIQCGDERVIKLL 95          
BLAST of SMED30028892 vs. Ensembl Nematostella
Match: EDO34161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ63])

HSP 1 Score: 44.2838 bits (103), Expect = 3.568e-7
Identity = 19/78 (24.36%), Postives = 37/78 (47.44%), Query Frame = 1
Query:   85 DLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            +++K  + +  D   +D +GW P+H A  +   E  ++L     ++   +   +RP+H A    + E+  LLL    D
Sbjct:    1 EVVKQCILQGADPTAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGAD 78          
BLAST of SMED30028892 vs. Ensembl Nematostella
Match: EDO34162 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ64])

HSP 1 Score: 43.8986 bits (102), Expect = 5.004e-7
Identity = 19/78 (24.36%), Postives = 37/78 (47.44%), Query Frame = 1
Query:   85 DLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            +++K  + +  D   +D +GW P+H A  +   E  ++L     ++   +   +RP+H A    + E+  LLL    D
Sbjct:    1 EVVKQCILQGADPTAKDNAGWTPLHEACARGKLEVVKVLAQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGAD 78          
BLAST of SMED30028892 vs. Ensembl Medaka
Match: ENSORLT00000044090.1 (pep primary_assembly:ASM223467v1:19:16434440:16449680:1 gene:ENSORLG00000026670.1 transcript:ENSORLT00000044090.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 2.286e-13
Identity = 30/109 (27.52%), Postives = 51/109 (46.79%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LL +  + D  TN G  P+       + D+   LLD+  ++    KSG  P+H A + ++ + + LL N+  +     K  + P+H A  + + +I  LLL R   I  
Sbjct:   32 LLTNGADPDATTNSGYTPLHLAAREGHKDIAAALLDQGANLSVTTKSGLTPLHVAAHYDNQKVALLLLNQGASPHSSAK-GITPLHLAAQEGSVDIVTLLLARGSPINA 139          

HSP 2 Score: 51.9878 bits (123), Expect = 2.566e-9
Identity = 24/97 (24.74%), Postives = 45/97 (46.39%), Query Frame = 1
Query:   28 CETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
             ++ D + P+         D+++LLL    D +    SG+ P+H A  +   + +  L ++  N+   TK  L P+H A   +N ++  LLL +   
Sbjct:    8 SKSTDDQTPLHISSRLGKQDIVQLLLTNGADPDATTNSGYTPLHLAAREGHKDIAAALLDQGANLSVTTKSGLTPLHVAAHYDNQKVALLLLNQGAS 104          
BLAST of SMED30028892 vs. Ensembl Medaka
Match: ENSORLT00000038526.1 (pep primary_assembly:ASM223467v1:19:16434440:16453404:1 gene:ENSORLG00000026670.1 transcript:ENSORLT00000038526.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 2.621e-11
Identity = 31/109 (28.44%), Postives = 50/109 (45.87%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LL +  + D  TN G  P+       + D+   LLD+  ++     +G+ P+H A  K   E S  L          T+Q + P+H A  + + +I  LLL R  ++EC
Sbjct:   32 LLTNGADPDATTNSGYTPLHLAAREGHKDIAAALLDQGANLS----NGYTPLHIAAKKNQMEISTTLLEYGALTNTVTRQGITPLHLAAQEGSVDIVTLLLARE-NVEC 135          
BLAST of SMED30028892 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 58.9214 bits (141), Expect = 3.756e-11
Identity = 31/108 (28.70%), Postives = 55/108 (50.93%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL ++ N D  +  G  P+      +N+ + +LLL+R  ++ +  K+G  P+H A  + +     LL +R   I+ +TK +L P+H A    +  I  +LLE    I+
Sbjct:  190 LLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQ 297          

HSP 2 Score: 57.7658 bits (138), Expect = 1.073e-10
Identity = 31/103 (30.10%), Postives = 46/103 (44.66%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LLDH  N D  T  G  P+       +I  +++LLD         K G+ P+H A      + +ELL  R  N     K  L P+H A+   N ++  LL+ +
Sbjct:  487 LLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSK 589          

HSP 3 Score: 56.225 bits (134), Expect = 3.220e-10
Identity = 30/108 (27.78%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+   N++    +G  P+       N+ +++LLLDR   I+ + K    P+H A         E+L      I+ +TK  L PIH A   ++ +    LL+ N +I+
Sbjct:  223 LLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEID 330          

HSP 4 Score: 54.299 bits (129), Expect = 1.926e-9
Identity = 23/107 (21.50%), Postives = 52/107 (48.60%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL+   N +    +G  P+   +   N+D++KLL+ +        ++G+ P+H A  +   E + +L     +  CE+ Q + P+H A  +   ++  +L+ +  ++
Sbjct:  553 LLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANV 659          

HSP 5 Score: 48.521 bits (114), Expect = 1.910e-7
Identity = 27/103 (26.21%), Postives = 49/103 (47.57%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LLD    ID +T D   P+     + ++ ++++LL+    I+ + K+G  PIH A   +  +    L   N  I+  T   L P+H A    +  +  +LL++
Sbjct:  256 LLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDK 358          

HSP 6 Score: 47.3654 bits (111), Expect = 3.882e-7
Identity = 33/137 (24.09%), Postives = 59/137 (43.07%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLD----------------RNCDI-------------EYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL++  N    T DG  P+   ++  + +++ LL++                RN D              +   K+G+ P+H A + E+   ++LL NR  N+    K  + P+H A  + N  +  LLL+R   I+
Sbjct:  128 LLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQID 264          

HSP 7 Score: 46.9802 bits (110), Expect = 5.508e-7
Identity = 29/103 (28.16%), Postives = 47/103 (45.63%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLER 309
            LL +N  ID  T D   P+       +  + K+LLD+         +G+ P+H A  K    + +LL   + ++E  T+  L P+H A    +  I   LL+R
Sbjct:  322 LLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQR 424          

HSP 8 Score: 44.669 bits (104), Expect = 4.359e-6
Identity = 25/109 (22.94%), Postives = 49/109 (44.95%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD        T  G  P+    +   +D+ +LLL+R  +     K+G  P+H A++  + +  +LL ++  +     +    P+H A  +   E+ ++LL+      C
Sbjct:  520 LLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNC 628          

HSP 9 Score: 44.2838 bits (103), Expect = 4.711e-6
Identity = 25/108 (23.15%), Postives = 48/108 (44.44%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+H   I  +T +G  PI    +  ++D ++ LL  N +I+        P+H A +      +++L ++             P+H A  K +    +LLL+ +  +E
Sbjct:  289 LLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLE 396          

HSP 10 Score: 43.8986 bits (102), Expect = 7.805e-6
Identity = 27/106 (25.47%), Postives = 46/106 (43.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LL +   +D    D + P+       + +L+KLLLD   + +    +G  P+H A  +    T  +L +        TK+   P+H A      ++  LLLER  +
Sbjct:  454 LLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGAN 559          
BLAST of SMED30028892 vs. Ensembl Medaka
Match: ENSORLT00000039903.1 (pep primary_assembly:ASM223467v1:15:18469388:18484014:-1 gene:ENSORLG00000030042.1 transcript:ENSORLT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 5.236e-11
Identity = 30/107 (28.04%), Postives = 54/107 (50.47%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D E+  G  P+       NI++  LLL+R   +++  ++   P+H A  + +    +LL +R   IE +TK  L P+H      + ++  +LL+R   I
Sbjct:  197 LLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPI 303          

HSP 2 Score: 54.6842 bits (130), Expect = 1.006e-9
Identity = 30/108 (27.78%), Postives = 51/108 (47.22%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +   P+    +  N +++KLLLDR   IE + K G  P+H        +  E+L +R   I  +TK  L P+H A   ++     LLL+ +  ++
Sbjct:  230 LLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVD 337          

HSP 3 Score: 49.6766 bits (117), Expect = 6.837e-8
Identity = 25/76 (32.89%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + E KSG+ P+H A +  +   + LL NR   ++   +  + P+H A  + NS +  LLL+R   IE
Sbjct:  196 LLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIE 271          

HSP 4 Score: 45.4394 bits (106), Expect = 1.934e-6
Identity = 26/106 (24.53%), Postives = 51/106 (48.11%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLD    I+ +T DG  P+     S +  ++++LLDR   I  + K+G  P+H A   +     +LL   +  ++  T   L  +H A    + ++  L++++  +
Sbjct:  263 LLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKAN 368          

HSP 5 Score: 45.4394 bits (106), Expect = 2.132e-6
Identity = 27/101 (26.73%), Postives = 46/101 (45.54%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            LL H+  +D  TND    +       +  + KL++D+  +   +  +G+ P+H A  K      ELL     +I+  T+  L PIH A    +  I + L+
Sbjct:  329 LLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALI 429          
BLAST of SMED30028892 vs. Ensembl Medaka
Match: ENSORLT00000006308.2 (pep primary_assembly:ASM223467v1:1:12516834:12530692:1 gene:ENSORLG00000005003.2 transcript:ENSORLT00000006308.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 8.723e-11
Identity = 30/107 (28.04%), Postives = 53/107 (49.53%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDI 321
            LL ++ N D ++  G  P+       N+++  LLL+R   +++  ++G  P+H A  + +     LL +R   I+ +T+  L P+H A    +     LLLER   I
Sbjct:  167 LLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPI 273          

HSP 2 Score: 55.0694 bits (131), Expect = 8.094e-10
Identity = 30/108 (27.78%), Postives = 49/108 (45.37%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL+    +D    +G  P+    +  N +++ LLLDR   I+ + + G  P+H A         ELL  R   I   TK  L P+H +   ++ E   LLL+    ++
Sbjct:  200 LLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVD 307          

HSP 3 Score: 46.9802 bits (110), Expect = 5.298e-7
Identity = 23/76 (30.26%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   97 LLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLL  + + + + KSG+ P+H A +  +   S LL NR   ++   +  + P+H A  + N+ +  LLL+R   I+
Sbjct:  166 LLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQID 241          

HSP 4 Score: 45.0542 bits (105), Expect = 2.483e-6
Identity = 28/106 (26.42%), Postives = 48/106 (45.28%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCD 318
            LLD    ID +T DG  P+     S +   ++LLL+R   I    K+G  P+H +   +  E  +LL      ++  T   L  +H A    +  +  +LL++  +
Sbjct:  233 LLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKAN 338          
BLAST of SMED30028892 vs. Planmine SMEST
Match: SMESG000010564.1 (SMESG000010564.1)

HSP 1 Score: 219.935 bits (559), Expect = 6.760e-68
Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC
Sbjct:  237 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 345          

HSP 2 Score: 124.02 bits (310), Expect = 4.599e-34
Identity = 62/109 (56.88%), Postives = 77/109 (70.64%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            L + NCNI+CET    RPI F I  +N ++  LLL+RNCDIE ED   WRPIH AINK++ E   LL +RNCNIEC   +  RPIH+AI+ ENSEI  +L +RNC+IEC
Sbjct:  303 LFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIECEDNQRWRPIHWAINKKNSEMVNLLLDRNCNIECGDNRGWRPIHWAIINENSEILEMLFDRNCNIEC 411          

HSP 3 Score: 123.25 bits (308), Expect = 7.257e-34
Identity = 62/109 (56.88%), Postives = 79/109 (72.48%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LL+ NC+I+CE N   RPI + I  KN +++ LLLDRNC+IE  D  GWRPIH AI  E+ E  E+LF+RNCNIEC+ +  +RPIHFAI  +N EI  LLL+R C+IEC
Sbjct:  336 LLERNCDIECEDNQRWRPIHWAINKKNSEMVNLLLDRNCNIECGDNRGWRPIHWAIINENSEILEMLFDRNCNIECQNESGIRPIHFAISYKNFEILKLLLDRKCNIEC 444          

HSP 4 Score: 123.25 bits (308), Expect = 9.432e-34
Identity = 61/109 (55.96%), Postives = 79/109 (72.48%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            L D NCNI+C+   G RPI F I  KN ++LKLLLDR C+IE ED    RPIH+AI+ +++E  ELL +RNC IECE  +++RPIH+AI  EN E+   LL+RNC+IEC
Sbjct:  402 LFDRNCNIECQNESGIRPIHFAISYKNFEILKLLLDRKCNIECEDIKKMRPIHYAISYQNFEILELLLDRNCIIECEDIKRMRPIHYAISCENLEVLKSLLDRNCNIEC 510          

HSP 5 Score: 121.709 bits (304), Expect = 2.965e-33
Identity = 57/107 (53.27%), Postives = 79/107 (73.83%), Query Frame = 1
Query:    7 DHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            D NCNIDCE N+G RPI + I  + +++ KLLLDRNC+I+ ED  G RPIH++I+ E++E  +LL  RNCNIEC+  + +RPIH+AI   N EI  LL +R+C+I+C
Sbjct:  800 DRNCNIDCEDNEGMRPIHYAINCQKLEIFKLLLDRNCNIDCEDNRGMRPIHYSISGENFEILKLLLERNCNIECKDNKGMRPIHYAISCVNLEILKLLFDRSCNIDC 906          

HSP 6 Score: 121.709 bits (304), Expect = 3.143e-33
Identity = 60/108 (55.56%), Postives = 80/108 (74.07%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD NCNIDCE N G RPI + I  +N ++LKLLL+RNC+IE +D  G RPIH+AI+  + E  +LLF+R+CNI+CE  + +RPIH+AI  EN EI  LLL++ C I+
Sbjct:  831 LLDRNCNIDCEDNRGMRPIHYSISGENFEILKLLLERNCNIECKDNKGMRPIHYAISCVNLEILKLLFDRSCNIDCEDNEGMRPIHYAISCENLEILKLLLQQKCGID 938          

HSP 7 Score: 120.168 bits (300), Expect = 1.099e-32
Identity = 60/109 (55.05%), Postives = 83/109 (76.15%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCNI+C  N G RPI + I ++N ++L++L DRNC+IE +++SG RPIH AI+ +++E  +LL +R CNIECE  +K+RPIH+AI  +N EI  LLL+RNC IEC
Sbjct:  369 LLDRNCNIECGDNRGWRPIHWAIINENSEILEMLFDRNCNIECQNESGIRPIHFAISYKNFEILKLLLDRKCNIECEDIKKMRPIHYAISYQNFEILELLLDRNCIIEC 477          

HSP 8 Score: 119.013 bits (297), Expect = 2.711e-32
Identity = 59/108 (54.63%), Postives = 74/108 (68.52%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLDHNCNI+C  N+G RPI +     + ++LKLLLD NC+IE ED  GWRPIH+A N    E  +LL + NCNI+CET    RPI F I  +N ++  LLL+RNCDIE
Sbjct:  171 LLDHNCNIECVDNEGWRPIHYATNEGHSEILKLLLDHNCNIECEDNEGWRPIHYATNGGHSEILKLLLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIE 278          

HSP 9 Score: 118.242 bits (295), Expect = 4.037e-32
Identity = 59/109 (54.13%), Postives = 76/109 (69.72%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLDHNCNI+CE N+G RP    I+  + ++LKLLLD NC+IE  D  GWRPIH+A N+   E  +LL + NCNIECE  +  RPIH+A    +SEI  LLL+ NC+I+C
Sbjct:  138 LLDHNCNIECEDNEGWRPSHCAIDGGHSEILKLLLDHNCNIECVDNEGWRPIHYATNEGHSEILKLLLDHNCNIECEDNEGWRPIHYATNGGHSEILKLLLDHNCNIDC 246          

HSP 10 Score: 117.857 bits (294), Expect = 6.433e-32
Identity = 59/105 (56.19%), Postives = 77/105 (73.33%), Query Frame = 1
Query:   13 NCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            NCNI+C+ N G RPI + I   N++ LKLLLDR C+IE +D  G RPIH+AI+  + E  +LLF+R+CNIEC+  + +RPIH+AI  EN EI  LLLE NC+IEC
Sbjct:  670 NCNIECKDNKGMRPIHYAISCVNLEKLKLLLDRLCNIECKDNKGMRPIHYAISCGNLEILKLLFDRDCNIECKDNKGMRPIHYAISYENFEILKLLLELNCNIEC 774          

HSP 11 Score: 114.39 bits (285), Expect = 1.033e-30
Identity = 60/109 (55.05%), Postives = 76/109 (69.72%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD  CNI+CE     RPI + I  +N ++L+LLLDRNC IE ED    RPIH+AI+ E+ E  + L +RNCNIECE  + +RPIH+AI   N EIF LLL+ NC+IEC
Sbjct:  435 LLDRKCNIECEDIKKMRPIHYAISYQNFEILELLLDRNCIIECEDIKRMRPIHYAISCENLEVLKSLLDRNCNIECEENKGMRPIHYAISCGNLEIFKLLLDLNCNIEC 543          

HSP 12 Score: 111.694 bits (278), Expect = 8.496e-30
Identity = 60/109 (55.05%), Postives = 80/109 (73.39%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCNI+CE N G RPI +VI   N+++LKLLLD +C+IE ED  G +PIH++I+ E+ E  +LL + NC+IECE  + +RPIH+AI   N EI  LLL RNC+I+C
Sbjct:  534 LLDLNCNIECEDNKGMRPIHYVITCGNLEILKLLLDHHCNIECEDNEGMKPIHYSISCENLEILKLLLDLNCSIECEENKGMRPIHYAINCRNLEILKLLLVRNCNIDC 642          

HSP 13 Score: 111.694 bits (278), Expect = 8.579e-30
Identity = 61/109 (55.96%), Postives = 81/109 (74.31%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LL+ NCNI+C+ N G RPI +    + +++LKLLLDRNC+I+ ED  G RPIH+AIN +  E  +LL +RNCNI+CE  + +RPIH++I  EN EI  LLLERNC+IEC
Sbjct:  765 LLELNCNIECKDNKGMRPIHYASSCEKLEILKLLLDRNCNIDCEDNEGMRPIHYAINCQKLEIFKLLLDRNCNIDCEDNRGMRPIHYSISGENFEILKLLLERNCNIEC 873          

HSP 14 Score: 111.694 bits (278), Expect = 1.012e-29
Identity = 56/109 (51.38%), Postives = 73/109 (66.97%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCNI+C  N+G RPI +     + +++KLLLD NC+IE ED  GWRP H AI+    E  +LL + NCNIEC   +  RPIH+A  + +SEI  LLL+ NC+IEC
Sbjct:  105 LLDRNCNIECVDNEGLRPIHYATNGGHSEIVKLLLDHNCNIECEDNEGWRPSHCAIDGGHSEILKLLLDHNCNIECVDNEGWRPIHYATNEGHSEILKLLLDHNCNIEC 213          

HSP 15 Score: 108.612 bits (270), Expect = 9.814e-29
Identity = 56/109 (51.38%), Postives = 75/109 (68.81%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NC I+CE     RPI + I  +N+++LK LLDRNC+IE E+  G RPIH+AI+  + E  +LL + NCNIECE  + +RPIH+ I   N EI  LLL+ +C+IEC
Sbjct:  468 LLDRNCIIECEDIKRMRPIHYAISCENLEVLKSLLDRNCNIECEENKGMRPIHYAISCGNLEIFKLLLDLNCNIECEDNKGMRPIHYVITCGNLEILKLLLDHHCNIEC 576          

HSP 16 Score: 108.227 bits (269), Expect = 1.579e-28
Identity = 57/109 (52.29%), Postives = 79/109 (72.48%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            L D +CNI+C+ N G RPI + I  +N ++LKLLL+ NC+IE +D  G RPIH+A + E  E  +LL +RNCNI+CE  + +RPIH+AI  +  EIF LLL+RNC+I+C
Sbjct:  732 LFDRDCNIECKDNKGMRPIHYAISYENFEILKLLLELNCNIECKDNKGMRPIHYASSCEKLEILKLLLDRNCNIDCEDNEGMRPIHYAINCQKLEIFKLLLDRNCNIDC 840          

HSP 17 Score: 106.301 bits (264), Expect = 6.150e-28
Identity = 58/109 (53.21%), Postives = 75/109 (68.81%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCNI+CE N G RPI + I   N+++ KLLLD NC+IE ED  G RPIH+ I   + E  +LL + +CNIECE  + ++PIH++I  EN EI  LLL+ NC IEC
Sbjct:  501 LLDRNCNIECEENKGMRPIHYAISCGNLEIFKLLLDLNCNIECEDNKGMRPIHYVITCGNLEILKLLLDHHCNIECEDNEGMKPIHYSISCENLEILKLLLDLNCSIEC 609          

HSP 18 Score: 104.375 bits (259), Expect = 3.024e-27
Identity = 57/109 (52.29%), Postives = 78/109 (71.56%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD  CNI+C+ N G RPI + I   N+++LKLL DR+C+IE +D  G RPIH+AI+ E++E  +LL   NCNIEC+  + +RPIH+A   E  EI  LLL+RNC+I+C
Sbjct:  699 LLDRLCNIECKDNKGMRPIHYAISCGNLEILKLLFDRDCNIECKDNKGMRPIHYAISYENFEILKLLLELNCNIECKDNKGMRPIHYASSCEKLEILKLLLDRNCNIDC 807          

HSP 19 Score: 103.219 bits (256), Expect = 8.142e-27
Identity = 55/105 (52.38%), Postives = 76/105 (72.38%), Query Frame = 1
Query:   13 NCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            NC+I+CE N G RPI + I  +N+++LKLLL RNC+I+ ED  G +PIH+AI+ E+ E  +LL + NCNIEC+  + +RPIH+AI   N E   LLL+R C+IEC
Sbjct:  604 NCSIECEENKGMRPIHYAINCRNLEILKLLLVRNCNIDCEDNEGMKPIHYAISCENLEILKLLLDLNCNIECKDNKGMRPIHYAISCVNLEKLKLLLDRLCNIEC 708          

HSP 20 Score: 97.8265 bits (242), Expect = 5.843e-25
Identity = 61/109 (55.96%), Postives = 81/109 (74.31%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLDH+CNI+CE N+G +PI + I  +N+++LKLLLD NC IE E+  G RPIH+AIN  + E  +LL  RNCNI+CE  + ++PIH+AI  EN EI  LLL+ NC+IEC
Sbjct:  567 LLDHHCNIECEDNEGMKPIHYSISCENLEILKLLLDLNCSIECEENKGMRPIHYAINCRNLEILKLLLVRNCNIDCEDNEGMKPIHYAISCENLEILKLLLDLNCNIEC 675          

HSP 21 Score: 97.4413 bits (241), Expect = 9.590e-25
Identity = 51/103 (49.51%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   19 NIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            N +CE N  +RPI +       + +KLLLDRNC+IE  D  G RPIH+A N    E  +LL + NCNIECE  +  RP H AI   +SEI  LLL+ NC+IEC
Sbjct:   78 NTECEDNQERRPIHYASSFGVTEAMKLLLDRNCNIECVDNEGLRPIHYATNGGHSEIVKLLLDHNCNIECEDNEGWRPSHCAIDGGHSEILKLLLDHNCNIEC 180          

HSP 22 Score: 83.1889 bits (204), Expect = 8.369e-20
Identity = 43/101 (42.57%), Postives = 61/101 (60.40%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLL 303
            LL+ NCNI+C+ N G RPI + I   N+++LKLL DR+C+I+ ED  G RPIH+AI+ E+ E  +LL  + C I+   K    P+  A      E   LL+
Sbjct:  864 LLERNCNIECKDNKGMRPIHYAISCVNLEILKLLFDRSCNIDCEDNEGMRPIHYAISCENLEILKLLLQQKCGIDHRRKDGKSPLDLAKENNRVECVQLLI 964          

HSP 23 Score: 82.0333 bits (201), Expect = 2.148e-19
Identity = 48/109 (44.04%), Postives = 61/109 (55.96%), Query Frame = 1
Query:   52 PIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKE-----------------DWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            PI       +ID ++LLL  NC+IE E+K G+RPIH  IN E                   E  +LL +RNCNIEC   + LRPIH+A    +SEI  LLL+ NC+IEC
Sbjct:   39 PIHIACFEGDIDAVRLLLQLNCNIECENKYGFRPIHCVINTECEDNQERRPIHYASSFGVTEAMKLLLDRNCNIECVDNEGLRPIHYATNGGHSEIVKLLLDHNCNIEC 147          

HSP 24 Score: 58.9214 bits (141), Expect = 3.138e-11
Identity = 29/69 (42.03%), Postives = 42/69 (60.87%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFN 207
            L D +CNIDCE N+G RPI + I  +N+++LKLLL + C I++  K G  P+  A      E  +LL +
Sbjct:  897 LFDRSCNIDCEDNEGMRPIHYAISCENLEILKLLLQQKCGIDHRRKDGKSPLDLAKENNRVECVQLLIH 965          
BLAST of SMED30028892 vs. Planmine SMEST
Match: SMESG000010221.1 (SMESG000010221.1)

HSP 1 Score: 120.939 bits (302), Expect = 8.538e-34
Identity = 59/109 (54.13%), Postives = 77/109 (70.64%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLDHNCNI+CET    RPI +     +++++KLLLD NC+ E E +SGWRPIH A ++ + E  +LL   NCN ECETK K RPIH+A  + +SEI  L L+RNC+IEC
Sbjct:   56 LLDHNCNIECETESKWRPIHWASSEGHLEIVKLLLDLNCNTECETESGWRPIHFASSEGESEIVKLLLELNCNTECETKSKWRPIHYASSEGHSEIVKLFLDRNCNIEC 164          

HSP 2 Score: 111.694 bits (278), Expect = 2.308e-30
Identity = 58/109 (53.21%), Postives = 71/109 (65.14%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
             LD NCNI+CE  DG RPI +     +  ++KLLL  NC+IE E KS WRPIH+A  K   +  +LL +RNCN ECE K   RPIH A  + +SEI  LLL+RNC IEC
Sbjct:  155 FLDRNCNIECEVGDGNRPIHYASLEGHSKIVKLLLGCNCNIECETKSKWRPIHYASWKGHSKIVKLLLDRNCNTECEDKDGNRPIHIASSEGHSEIVKLLLDRNCYIEC 263          

HSP 3 Score: 109.383 bits (272), Expect = 1.684e-29
Identity = 55/109 (50.46%), Postives = 72/109 (66.06%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCN +CET  G RPI F       +++KLLL+ NC+ E E KS WRPIH+A ++   E  +L  +RNCNIECE     RPIH+A ++ +S+I  LLL  NC+IEC
Sbjct:   89 LLDLNCNTECETESGWRPIHFASSEGESEIVKLLLELNCNTECETKSKWRPIHYASSEGHSEIVKLFLDRNCNIECEVGDGNRPIHYASLEGHSKIVKLLLGCNCNIEC 197          

HSP 4 Score: 106.686 bits (265), Expect = 1.698e-28
Identity = 55/109 (50.46%), Postives = 72/109 (66.06%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LL+ NCN +CET    RPI +     + +++KL LDRNC+IE E   G RPIH+A  +   +  +LL   NCNIECETK K RPIH+A  K +S+I  LLL+RNC+ EC
Sbjct:  122 LLELNCNTECETKSKWRPIHYASSEGHSEIVKLFLDRNCNIECEVGDGNRPIHYASLEGHSKIVKLLLGCNCNIECETKSKWRPIHYASWKGHSKIVKLLLDRNCNTEC 230          

HSP 5 Score: 102.064 bits (253), Expect = 1.079e-26
Identity = 52/108 (48.15%), Postives = 68/108 (62.96%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL H  N +CE  DG RPI       + +++KLLL+ NC+ E EDKSG RPIH+A  +   E  +LL +RNCN ECE +   RPIH+A    ++EI  LLLER C I+
Sbjct:  288 LLGHKFNTECEDKDGNRPIHIASSEGHSEIVKLLLNCNCNTECEDKSGMRPIHYASRQGHSEIVKLLLDRNCNTECEDRWGWRPIHYASRNGHTEIVKLLLERKCRID 395          

HSP 6 Score: 98.2117 bits (243), Expect = 2.105e-25
Identity = 57/143 (39.86%), Postives = 73/143 (51.05%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHH----------------------------------AINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCN +CE  DG RPI       + +++KLLLDRNC IE + KS WRP H+                                  A ++   E  +LL N NCN ECE K  +RPIH+A  + +SEI  LLL+RNC+ EC
Sbjct:  221 LLDRNCNTECEDKDGNRPIHIASSEGHSEIVKLLLDRNCYIECKTKSKWRPTHYGSWKGHSEIGLGLLLGHKFNTECEDKDGNRPIHIASSEGHSEIVKLLLNCNCNTECEDKSGMRPIHYASRQGHSEIVKLLLDRNCNTEC 363          

HSP 7 Score: 97.0561 bits (240), Expect = 5.983e-25
Identity = 54/110 (49.09%), Postives = 68/110 (61.82%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEI-FNLLLERNCDIEC 327
            LL  NCNI+CET    RPI +     +  ++KLLLDRNC+ E EDK G RPIH A ++   E  +LL +RNC IEC+TK K RP H+   K +SEI   LLL    + EC
Sbjct:  188 LLGCNCNIECETKSKWRPIHYASWKGHSKIVKLLLDRNCNTECEDKDGNRPIHIASSEGHSEIVKLLLDRNCYIECKTKSKWRPTHYGSWKGHSEIGLGLLLGHKFNTEC 297          

HSP 8 Score: 90.8929 bits (224), Expect = 1.127e-22
Identity = 47/96 (48.96%), Postives = 60/96 (62.50%), Query Frame = 1
Query:   40 DGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            +G  PI        +++ KLLLD NC+IE E +S WRPIH A ++   E  +LL + NCN ECET+   RPIHFA  +  SEI  LLLE NC+ EC
Sbjct:   36 NGYFPIHIACRDGFVEVAKLLLDHNCNIECETESKWRPIHWASSEGHLEIVKLLLDLNCNTECETESGWRPIHFASSEGESEIVKLLLELNCNTEC 131          

HSP 9 Score: 78.1814 bits (191), Expect = 4.887e-18
Identity = 38/81 (46.91%), Postives = 51/81 (62.96%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQK 243
            LL+ NCN +CE   G RPI +     + +++KLLLDRNC+ E ED+ GWRPIH+A      E  +LL  R C I+ +TK K
Sbjct:  321 LLNCNCNTECEDKSGMRPIHYASRQGHSEIVKLLLDRNCNTECEDRWGWRPIHYASRNGHTEIVKLLLERKCRIDSKTKVK 401          
BLAST of SMED30028892 vs. Planmine SMEST
Match: SMESG000010221.1 (SMESG000010221.1)

HSP 1 Score: 120.939 bits (302), Expect = 8.924e-34
Identity = 59/109 (54.13%), Postives = 77/109 (70.64%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLDHNCNI+CET    RPI +     +++++KLLLD NC+ E E +SGWRPIH A ++ + E  +LL   NCN ECETK K RPIH+A  + +SEI  L L+RNC+IEC
Sbjct:   56 LLDHNCNIECETESKWRPIHWASSEGHLEIVKLLLDLNCNTECETESGWRPIHFASSEGESEIVKLLLELNCNTECETKSKWRPIHYASSEGHSEIVKLFLDRNCNIEC 164          

HSP 2 Score: 111.694 bits (278), Expect = 2.723e-30
Identity = 58/109 (53.21%), Postives = 71/109 (65.14%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
             LD NCNI+CE  DG RPI +     +  ++KLLL  NC+IE E KS WRPIH+A  K   +  +LL +RNCN ECE K   RPIH A  + +SEI  LLL+RNC IEC
Sbjct:  155 FLDRNCNIECEVGDGNRPIHYASLEGHSKIVKLLLGCNCNIECETKSKWRPIHYASWKGHSKIVKLLLDRNCNTECEDKDGNRPIHIASSEGHSEIVKLLLDRNCYIEC 263          

HSP 3 Score: 109.383 bits (272), Expect = 1.925e-29
Identity = 55/109 (50.46%), Postives = 72/109 (66.06%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCN +CET  G RPI F       +++KLLL+ NC+ E E KS WRPIH+A ++   E  +L  +RNCNIECE     RPIH+A ++ +S+I  LLL  NC+IEC
Sbjct:   89 LLDLNCNTECETESGWRPIHFASSEGESEIVKLLLELNCNTECETKSKWRPIHYASSEGHSEIVKLFLDRNCNIECEVGDGNRPIHYASLEGHSKIVKLLLGCNCNIEC 197          

HSP 4 Score: 106.686 bits (265), Expect = 2.020e-28
Identity = 55/109 (50.46%), Postives = 72/109 (66.06%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LL+ NCN +CET    RPI +     + +++KL LDRNC+IE E   G RPIH+A  +   +  +LL   NCNIECETK K RPIH+A  K +S+I  LLL+RNC+ EC
Sbjct:  122 LLELNCNTECETKSKWRPIHYASSEGHSEIVKLFLDRNCNIECEVGDGNRPIHYASLEGHSKIVKLLLGCNCNIECETKSKWRPIHYASWKGHSKIVKLLLDRNCNTEC 230          

HSP 5 Score: 101.679 bits (252), Expect = 1.294e-26
Identity = 52/108 (48.15%), Postives = 68/108 (62.96%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LL H  N +CE  DG RPI       + +++KLLL+ NC+ E EDKSG RPIH+A  +   E  +LL +RNCN ECE +   RPIH+A    ++EI  LLLER C I+
Sbjct:  288 LLGHKFNTECEDKDGNRPIHIASSEGHSEIVKLLLNCNCNTECEDKSGMRPIHYASRQGHSEIVKLLLDRNCNTECEDRWGWRPIHYASRNGHTEIVKLLLERKCRID 395          

HSP 6 Score: 98.2117 bits (243), Expect = 2.495e-25
Identity = 57/143 (39.86%), Postives = 73/143 (51.05%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHH----------------------------------AINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCN +CE  DG RPI       + +++KLLLDRNC IE + KS WRP H+                                  A ++   E  +LL N NCN ECE K  +RPIH+A  + +SEI  LLL+RNC+ EC
Sbjct:  221 LLDRNCNTECEDKDGNRPIHIASSEGHSEIVKLLLDRNCYIECKTKSKWRPTHYGSWKGHSEIGLGLLLGHKFNTECEDKDGNRPIHIASSEGHSEIVKLLLNCNCNTECEDKSGMRPIHYASRQGHSEIVKLLLDRNCNTEC 363          

HSP 7 Score: 97.0561 bits (240), Expect = 6.669e-25
Identity = 54/110 (49.09%), Postives = 68/110 (61.82%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEI-FNLLLERNCDIEC 327
            LL  NCNI+CET    RPI +     +  ++KLLLDRNC+ E EDK G RPIH A ++   E  +LL +RNC IEC+TK K RP H+   K +SEI   LLL    + EC
Sbjct:  188 LLGCNCNIECETKSKWRPIHYASWKGHSKIVKLLLDRNCNTECEDKDGNRPIHIASSEGHSEIVKLLLDRNCYIECKTKSKWRPTHYGSWKGHSEIGLGLLLGHKFNTEC 297          

HSP 8 Score: 90.5077 bits (223), Expect = 1.371e-22
Identity = 47/96 (48.96%), Postives = 60/96 (62.50%), Query Frame = 1
Query:   40 DGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            +G  PI        +++ KLLLD NC+IE E +S WRPIH A ++   E  +LL + NCN ECET+   RPIHFA  +  SEI  LLLE NC+ EC
Sbjct:   36 NGYFPIHIACRDGFVEVAKLLLDHNCNIECETESKWRPIHWASSEGHLEIVKLLLDLNCNTECETESGWRPIHFASSEGESEIVKLLLELNCNTEC 131          

HSP 9 Score: 77.411 bits (189), Expect = 7.947e-18
Identity = 37/80 (46.25%), Postives = 51/80 (63.75%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQ 240
            LL+ NCN +CE   G RPI +     + +++KLLLDRNC+ E ED+ GWRPIH+A      E  +LL  R C I+ +TK+
Sbjct:  321 LLNCNCNTECEDKSGMRPIHYASRQGHSEIVKLLLDRNCNTECEDRWGWRPIHYASRNGHTEIVKLLLERKCRIDSKTKE 400          
BLAST of SMED30028892 vs. Planmine SMEST
Match: SMESG000010546.1 (SMESG000010546.1)

HSP 1 Score: 116.316 bits (290), Expect = 7.064e-33
Identity = 58/109 (53.21%), Postives = 75/109 (68.81%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCN +CET  G RPI +     + +++KLLLDRNC+ E E +SG RPIH A +  + E  +LL +RNCN ECETK  +RPIH A  + +SEI  LLL+RNC+ EC
Sbjct:   45 LLDRNCNTECETKSGWRPIHYASWQGHSEIVKLLLDRNCNTECETESGMRPIHWASSNGNSEIVKLLLDRNCNTECETKWGMRPIHCASRQGHSEIVKLLLDRNCNTEC 153          

HSP 2 Score: 114.39 bits (285), Expect = 2.921e-32
Identity = 60/108 (55.56%), Postives = 71/108 (65.74%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIE 324
            LLD NCN +CET  G+RPI         +++KLLLDRNC+ E EDKSG RPIH A  K D E  +LL +RNCN ECETK   RPIH A    ++EI  LLLER C I+
Sbjct:  177 LLDRNCNTECETKSGERPIHCASGRGRSEIVKLLLDRNCNTECEDKSGERPIHVASWKGDSEIVKLLLDRNCNTECETKSGRRPIHVASRNGHTEIVKLLLERKCRID 284          

HSP 3 Score: 114.005 bits (284), Expect = 5.481e-32
Identity = 59/109 (54.13%), Postives = 73/109 (66.97%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCN +CET  G+RPI     + + +++KLLLDRNC+ E E KSG RPIH A  +   E  +LL +RNCN ECE K   RPIH A  K +SEI  LLL+RNC+ EC
Sbjct:  144 LLDRNCNTECETIWGERPIHVASRNGHTEIVKLLLDRNCNTECETKSGERPIHCASGRGRSEIVKLLLDRNCNTECEDKSGERPIHVASWKGDSEIVKLLLDRNCNTEC 252          

HSP 4 Score: 110.923 bits (276), Expect = 7.952e-31
Identity = 57/109 (52.29%), Postives = 71/109 (65.14%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCN +CET  G RPI +   + N +++KLLLDRNC+ E E K G RPIH A  +   E  +LL +RNCN ECET    RPIH A    ++EI  LLL+RNC+ EC
Sbjct:   78 LLDRNCNTECETESGMRPIHWASSNGNSEIVKLLLDRNCNTECETKWGMRPIHCASRQGHSEIVKLLLDRNCNTECETIWGERPIHVASRNGHTEIVKLLLDRNCNTEC 186          

HSP 5 Score: 106.301 bits (264), Expect = 3.694e-29
Identity = 57/109 (52.29%), Postives = 68/109 (62.39%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCN +CET  G RPI       + +++KLLLDRNC+ E E   G RPIH A      E  +LL +RNCN ECETK   RPIH A  +  SEI  LLL+RNC+ EC
Sbjct:  111 LLDRNCNTECETKWGMRPIHCASRQGHSEIVKLLLDRNCNTECETIWGERPIHVASRNGHTEIVKLLLDRNCNTECETKSGERPIHCASGRGRSEIVKLLLDRNCNTEC 219          

HSP 6 Score: 101.679 bits (252), Expect = 2.647e-27
Identity = 50/95 (52.63%), Postives = 62/95 (65.26%), Query Frame = 1
Query:   43 GKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            G  PI        + + KLLLDRNC+ E E KSGWRPIH+A  +   E  +LL +RNCN ECET+  +RPIH+A    NSEI  LLL+RNC+ EC
Sbjct:   26 GDFPIHIACRDGFVAVAKLLLDRNCNTECETKSGWRPIHYASWQGHSEIVKLLLDRNCNTECETESGMRPIHWASSNGNSEIVKLLLDRNCNTEC 120          

HSP 7 Score: 72.7886 bits (177), Expect = 2.139e-16
Identity = 38/79 (48.10%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETK 237
            LLD NCN +CE   G+RPI       + +++KLLLDRNC+ E E KSG RPIH A      E  +LL  R C I+ +TK
Sbjct:  210 LLDRNCNTECEDKSGERPIHVASWKGDSEIVKLLLDRNCNTECETKSGRRPIHVASRNGHTEIVKLLLERKCRIDSKTK 288          

HSP 8 Score: 67.0106 bits (162), Expect = 2.460e-14
Identity = 34/67 (50.75%), Postives = 43/67 (64.18%), Query Frame = 1
Query:  127 YEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
             +DK G  PIH A        ++LL +RNCN ECETK   RPIH+A  + +SEI  LLL+RNC+ EC
Sbjct:   21 VDDKYGDFPIHIACRDGFVAVAKLLLDRNCNTECETKSGWRPIHYASWQGHSEIVKLLLDRNCNTEC 87          
BLAST of SMED30028892 vs. Planmine SMEST
Match: SMESG000019776.1 (SMESG000019776.1)

HSP 1 Score: 119.013 bits (297), Expect = 2.548e-32
Identity = 58/109 (53.21%), Postives = 74/109 (67.89%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCN +C+   G+RPI +     N +++KLLLDRNC+ E +DKS WRPIHHA +  + E  +LL +RNCN ECETK   RPIH A  + +SEI  LLL R C I+C
Sbjct:   52 LLDRNCNTECKDKSGERPIHYASRDGNSEIVKLLLDRNCNTECKDKSKWRPIHHASSNGNSEIVKLLLDRNCNTECETKLGERPIHHATWRGHSEIVKLLLRRKCRIDC 160          

HSP 2 Score: 116.316 bits (290), Expect = 2.494e-31
Identity = 58/109 (53.21%), Postives = 75/109 (68.81%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            LLD NCN +CE   G+RPI +   + + +++KLLLDRNC+ E +DKSG RPIH+A    + E  +LL +RNCN EC+ K K RPIH A    NSEI  LLL+RNC+ EC
Sbjct:   19 LLDRNCNTECEDESGRRPIHWASSNGHSEIVKLLLDRNCNTECKDKSGERPIHYASRDGNSEIVKLLLDRNCNTECKDKSKWRPIHHASSNGNSEIVKLLLDRNCNTEC 127          

HSP 3 Score: 93.9745 bits (232), Expect = 1.677e-23
Identity = 49/93 (52.69%), Postives = 61/93 (65.59%), Query Frame = 1
Query:   49 RPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLLLERNCDIEC 327
            RPI       N +++KLLLDRNC+ E ED+SG RPIH A +    E  +LL +RNCN EC+ K   RPIH+A    NSEI  LLL+RNC+ EC
Sbjct:    2 RPIHCASLQSNSEIVKLLLDRNCNTECEDESGRRPIHWASSNGHSEIVKLLLDRNCNTECKDKSGERPIHYASRDGNSEIVKLLLDRNCNTEC 94          

HSP 4 Score: 75.0998 bits (183), Expect = 6.680e-17
Identity = 39/88 (44.32%), Postives = 51/88 (57.95%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFA 264
            LLD NCN +C+     RPI     + N +++KLLLDRNC+ E E K G RPIHHA  +   E  +LL  R C I+C+ K    P+  A
Sbjct:   85 LLDRNCNTECKDKSKWRPIHHASSNGNSEIVKLLLDRNCNTECETKLGERPIHHATWRGHSEIVKLLLRRKCRIDCKNKDGKSPLDIA 172          

HSP 5 Score: 50.0618 bits (118), Expect = 3.960e-8
Identity = 28/69 (40.58%), Postives = 40/69 (57.97%), Query Frame = 1
Query:    1 LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWRPIHHAINKEDWETSELLFN 207
            LLD NCN +CET  G+RPI       + +++KLLL R C I+ ++K G  P+  A     ++  ELL N
Sbjct:  118 LLDRNCNTECETKLGERPIHHATWRGHSEIVKLLLRRKCRIDCKNKDGKSPLDIAKEYNHFDCVELLTN 186          
The following BLAST results are available for this feature:
BLAST of SMED30028892 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKK13.426e-1329.25ankyrin repeat and kinase domain containing 1 [Sou... [more]
ANK37.149e-1226.17ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK37.291e-1226.17ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK39.641e-1226.17ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK22.602e-1128.16ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of SMED30028892 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-449.573e-1028.30AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.573e-1028.30AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.577e-1028.30AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.577e-1028.30AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.581e-1028.30AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30028892 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tnks4.216e-1128.43gene:FBgn0027508 transcript:FBtr0084890[more]
Tnks4.883e-1128.43gene:FBgn0027508 transcript:FBtr0330383[more]
Ank21.032e-1028.97gene:FBgn0261788 transcript:FBtr0334062[more]
Ank21.057e-1028.97gene:FBgn0261788 transcript:FBtr0303120[more]
Ank21.092e-1028.97gene:FBgn0261788 transcript:FBtr0303119[more]
back to top
BLAST of SMED30028892 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a2.402e-1128.70ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
BX469921.13.931e-1128.43ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
ank3a3.969e-1128.43ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a3.969e-1128.43ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
BX469921.14.041e-1128.43ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
back to top
BLAST of SMED30028892 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnks23.390e-1027.45tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnks23.417e-1027.45tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnks23.465e-1027.45tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tpm44.117e-1026.17tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
foxj34.173e-1027.45forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185... [more]
back to top
BLAST of SMED30028892 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankk19.597e-1428.97ankyrin repeat and kinase domain containing 1 [Sou... [more]
Ank33.417e-1226.17ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.419e-1226.17ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.422e-1226.17ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.429e-1226.17ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of SMED30028892 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BZ25|ANKK1_MOUSE6.713e-1328.97Ankyrin repeat and protein kinase domain-containin... [more]
sp|Q02989|LITA_LATTR1.591e-1232.11Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrode... [more]
sp|Q8NFD2|ANKK1_HUMAN1.645e-1229.25Ankyrin repeat and protein kinase domain-containin... [more]
sp|G5E8K5|ANK3_MOUSE2.400e-1126.17Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|O70511|ANK3_RAT2.417e-1126.17Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
back to top
BLAST of SMED30028892 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4MFZ92.197e-1733.94Latrotoxin, C-terminal domain,Ankyrin repeat-conta... [more]
A0A2K9L6I21.774e-1633.94Ankyrin repeat protein OS=Tupanvirus deep ocean OX... [more]
A0A5A8E8G33.112e-1628.30ANK_REP_REGION domain-containing protein OS=Cafete... [more]
A0A3G5A9697.229e-1637.14ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A0P8ZHN41.774e-1534.78ANK_REP_REGION domain-containing protein OS=Drosop... [more]
back to top
BLAST of SMED30028892 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3b2.392e-1127.10ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a4.163e-1127.10ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a4.241e-1127.10ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a4.380e-1127.10ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ENSAMXT00000037173.15.354e-1128.04pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
back to top
BLAST of SMED30028892 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000095.11.039e-1127.10pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.11.554e-1129.63pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000009608.12.736e-1127.45pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
ENSPMAT00000007449.12.711e-926.17pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000007446.12.744e-926.17pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
back to top
BLAST of SMED30028892 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NAS66.053e-624.24Evolutionarily conserved 19S regulatory particle a... [more]
back to top
BLAST of SMED30028892 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348621.172e-825.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454852.669e-831.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308186.142e-826.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341613.568e-724.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341625.004e-724.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30028892 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000044090.12.286e-1327.52pep primary_assembly:ASM223467v1:19:16434440:16449... [more]
ENSORLT00000038526.12.621e-1128.44pep primary_assembly:ASM223467v1:19:16434440:16453... [more]
ank1b3.756e-1128.70ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000039903.15.236e-1128.04pep primary_assembly:ASM223467v1:15:18469388:18484... [more]
ENSORLT00000006308.28.723e-1128.04pep primary_assembly:ASM223467v1:1:12516834:125306... [more]
back to top
BLAST of SMED30028892 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010564.16.760e-68100.00SMESG000010564.1[more]
SMESG000010221.18.538e-3454.13SMESG000010221.1[more]
SMESG000010221.18.924e-3454.13SMESG000010221.1[more]
SMESG000010546.17.064e-3353.21SMESG000010546.1[more]
SMESG000019776.12.548e-3253.21SMESG000019776.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028892 ID=SMED30028892|Name=SMED30028892|organism=Schmidtea mediterranea sexual|type=transcript|length=327bp
TTGCTTGACCATAACTGCAATATCGATTGCGAAACTAATGATGGAAAAAG
ACCGATTCAATTTGTAATAGAATCAAAAAATATCGACTTGTTAAAGTTGT
TACTCGATCGCAACTGTGATATTGAATATGAGGATAAATCGGGGTGGAGA
CCAATTCATCATGCAATCAACAAAGAGGATTGGGAAACATCAGAATTGTT
ATTCAATCGCAATTGCAATATAGAATGTGAGACCAAACAAAAACTTCGAC
CTATTCATTTTGCAATCATGAAAGAAAATTCAGAAATATTTAATTTATTG
CTTGAGCGCAACTGCGATATCGAATGT
back to top

protein sequence of SMED30028892-orf-1

>SMED30028892-orf-1 ID=SMED30028892-orf-1|Name=SMED30028892-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
LLDHNCNIDCETNDGKRPIQFVIESKNIDLLKLLLDRNCDIEYEDKSGWR
PIHHAINKEDWETSELLFNRNCNIECETKQKLRPIHFAIMKENSEIFNLL
LERNCDIEC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003824catalytic activity
Vocabulary: biological process
TermDefinition
GO:0009116nucleoside metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 47..76
e-value: 170.0
score: 10.8
coord: 80..109
e-value: 3.1
score: 16.8
coord: 14..43
e-value: 0.57
score: 19.2
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 80..109
score: 8.71
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 14..46
score: 9.725
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 23..108
e-value: 3.3E-10
score: 40.4
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 1..109
score: 25.806
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 1..109
e-value: 2.3E-24
score: 87.9
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 1..107
NoneNo IPR availablePANTHERPTHR24134:SF1ANKYRIN REPEAT AND SOCS BOX PROTEIN 8coord: 14..109
NoneNo IPR availablePANTHERPTHR24134FAMILY NOT NAMEDcoord: 14..109