Bravo_FIGEY domain-containing protein

Overview
NameBravo_FIGEY domain-containing protein
Smed IDSMED30028890
Length (bp)2826
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bravo_FIGEY domain-containing protein (SMED30028890) t-SNE clustered cells

Violin plots show distribution of expression levels for Bravo_FIGEY domain-containing protein (SMED30028890) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bravo_FIGEY domain-containing protein (SMED30028890) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bravo_FIGEY domain-containing protein (SMED30028890) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028890

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028890SMESG000028920.1 Contig4582GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028890SMESG000065363.1 Contig4582GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30028890SMESG000065363.1 SMESG000043141.1 dd_Smed_v4_1294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028890SMESG000065363.1 SMESG000043141.1 dd_Smed_v4_1294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30028890SMESG000065363.1 SMESG000043141.1 dd_Smed_v4_1294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028890SMESG000065363.1 SMESG000043141.1 dd_Smed_v6_1294_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30028890SMESG000065363.1 SMESG000043141.1 dd_Smed_v4_1294_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028890SMESG000065363.1 SMESG000043141.1 dd_Smed_v4_1294_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bravo_FIGEY domain-containing protein vs. TrEMBL
Match: A0A3Q0KT09 (Putative immunoglobulin domain superfamily (Sensory guidance protein) OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 4.058e-49
Identity = 226/824 (27.43%), Postives = 373/824 (45.27%), Query Frame = 2
Query:   95 GSSRDTGLLQSPILLSLTSNNAAIDVYSGRQIIIYKDLARHSN---IFIIYCLVSGYGPNRDLVYRF-CKEDSCPNEWKEAEQFSGITMFNYKISREENPAGKLGLKLKLQFPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIYYWSQSIVLNNENTKTIYQTNITRDKMPATFKCAQNGLTYNPSKPTWYQQLSMNPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYIKSKDAANPINTYIQSYN----LNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYLRKLIKGSTKNRIVSLIALYQASSSAKPY-WKNNGQQLNMGNNIEYDKFSVKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQYVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDTKELILNPVKSNDST-RDKSVKDALKDNFLECHV-------DLKSL-PDVVPEFVYYSTSDPSLKSKMKARITL--DFQPI-NTAYIYWXXXXXXXXXXXXXXXXXXXRYCMRNKGETYQLDKIEREHGYDPEKEVQE-EMFKPYEREEHDPDMMSDNTGER-KLSITAQSVGSANDGELDMYDLDPTNFNEDGSIIGKYGA 2497
            G   DT   + P L +L   +A I     +Q+ I   +  H N   +  I+C+V+      +LV  + C+  S  +  +  +  +   +F  ++    N     G     + P       G + C+  ++ G  +  SN I+I+D YY+ + +V      +T Y   ++ + +P + +C Q  ++   + P+W      +P  WS C V    ++   I+      C++   Q           S+   + +  YV  +G L LY      +       L+C+    D++   +TY    N    L    S + F G+  T       +SPL Q+IT+ +     G      + L+  Y+++       W  +G+++   N   ++ + +KF   I  + +GTY L V +G D++ F F+V+V+GPP ++     P +  VME E+ +F+C   +   + +L+IN   +    +       L+  Y YL D       +  L  +   +TYSAYNL  T G      HTV    +NE+GL   ++ + V+PR+N L  ++P+ Y+CT DC + VSH F C +  D Y +   +    W ++G  +     +     F     TK LI+ PV     T   + V    +      HV       D + L PD+    VY S  D  +   M A + L  D  P   +A I W+ AVI+ +++I+ + +L     MR +GETY LD+ ER  G DPEKE++E E F+ YER E  P       G R  L+  +  +GS  DGELD Y+LDP  FNE+GS IG+Y  
Sbjct:   32 GVRHDTYFYEHPGLRNLIEIDATIK----QQVRI--RIVEHLNELPVLRIHCIVAPLDSTHELVSAYLCRRKSTHDSDECIDPKTRNVIFG-RVEFSANGNRSAGYTFSSRLPVKDELLDGFYFCKYHNRNGELI--SNFIEIQDAYYYHKRMV-RRPVKQTEYLPPLSINDLPLSLECGQTKVS--EALPSWADAAFPSPFMWSFCDV----DSPDGIQSA---GCMRRVRQ----------TSIHVTNYFESYVSPNGTLVLYK---RTASAWKDMGLVCW-SHLDSSAVYSTYFGGSNERPKLLTYDSNIPFIGSGIT------VLSPLTQRITVRI-----GPQTG--LKLMTKYRSNPEHTIVKWTKDGKRIP-SNFPGHNDYLLKFPDFIRREHSGTYNLLVENGYDQVNFQFLVSVVGPPEVIRAP--PPLLLVMEGENVTFSCQLDSF-ITESLEING--LPYQPNPTNFRTELRDQYPYLKD-----ALIQPLQRNGHILTYSAYNLLFTPGSKIGPTHTVSLVGKNEYGLARVSTLVRVLPRINIL--NAPKDYSCTTDCLNSVSHTFDCVIDTDPYQSTYFV--QTWELNGISVSKMTKDYQQSKFIKTEGTK-LIITPVDDPSLTVLFRKVNVTCRWRIFYPHVTSRIADLDTRLLEPDMK---VYDSHDDVKIHPLMTAALDLQVDHDPTPASANISWITAVIIGILVIIAIGVLTACLVMRFRGETYMLDREERALGNDPEKELREKEAFQTYERAEEPP-----LRGSRCSLNDDSAEIGSDGDGELDDYNLDPGKFNEEGSFIGEYAT 785          
BLAST of Bravo_FIGEY domain-containing protein vs. TrEMBL
Match: G4V9E1 (Putative immunoglobulin domain superfamily (Sensory guidance protein) OS=Schistosoma mansoni OX=6183 GN=Smp_172070 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 4.884e-49
Identity = 226/824 (27.43%), Postives = 373/824 (45.27%), Query Frame = 2
Query:   95 GSSRDTGLLQSPILLSLTSNNAAIDVYSGRQIIIYKDLARHSN---IFIIYCLVSGYGPNRDLVYRF-CKEDSCPNEWKEAEQFSGITMFNYKISREENPAGKLGLKLKLQFPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIYYWSQSIVLNNENTKTIYQTNITRDKMPATFKCAQNGLTYNPSKPTWYQQLSMNPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYIKSKDAANPINTYIQSYN----LNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYLRKLIKGSTKNRIVSLIALYQASSSAKPY-WKNNGQQLNMGNNIEYDKFSVKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQYVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDTKELILNPVKSNDST-RDKSVKDALKDNFLECHV-------DLKSL-PDVVPEFVYYSTSDPSLKSKMKARITL--DFQPI-NTAYIYWXXXXXXXXXXXXXXXXXXXRYCMRNKGETYQLDKIEREHGYDPEKEVQE-EMFKPYEREEHDPDMMSDNTGER-KLSITAQSVGSANDGELDMYDLDPTNFNEDGSIIGKYGA 2497
            G   DT   + P L +L   +A I     +Q+ I   +  H N   +  I+C+V+      +LV  + C+  S  +  +  +  +   +F  ++    N     G     + P       G + C+  ++ G  +  SN I+I+D YY+ + +V      +T Y   ++ + +P + +C Q  ++   + P+W      +P  WS C V    ++   I+      C++   Q           S+   + +  YV  +G L LY      +       L+C+    D++   +TY    N    L    S + F G+  T       +SPL Q+IT+ +     G      + L+  Y+++       W  +G+++   N   ++ + +KF   I  + +GTY L V +G D++ F F+V+V+GPP ++     P +  VME E+ +F+C   +   + +L+IN   +    +       L+  Y YL D       +  L  +   +TYSAYNL  T G      HTV    +NE+GL   ++ + V+PR+N L  ++P+ Y+CT DC + VSH F C +  D Y +   +    W ++G  +     +     F     TK LI+ PV     T   + V    +      HV       D + L PD+    VY S  D  +   M A + L  D  P   +A I W+ AVI+ +++I+ + +L     MR +GETY LD+ ER  G DPEKE++E E F+ YER E  P       G R  L+  +  +GS  DGELD Y+LDP  FNE+GS IG+Y  
Sbjct:   33 GVRHDTYFYEHPGLRNLIEIDATIK----QQVRI--RIVEHLNELPVLRIHCIVAPLDSTHELVSAYLCRRKSTHDSDECIDPKTRNVIFG-RVEFSANGNRSAGYTFSSRLPVKDELLDGFYFCKYHNRNGELI--SNFIEIQDAYYYHKRMV-RRPVKQTEYLPPLSINDLPLSLECGQTKVS--EALPSWADAAFPSPFMWSFCDV----DSPDGIQSA---GCMRRVRQ----------TSIHVTNYFESYVSPNGTLVLYK---RTASAWKDMGLVCW-SHLDSSAVYSTYFGGSNERPKLLTYDSNIPFIGSGIT------VLSPLTQRITVRI-----GPQTG--LKLMTKYRSNPEHTIVKWTKDGKRIP-SNFPGHNDYLLKFPDFIRREHSGTYNLLVENGYDQVNFQFLVSVVGPPEVIRAP--PPLLLVMEGENVTFSCQLDSF-ITESLEING--LPYQPNPTNFRTELRDQYPYLKD-----ALIQPLQRNGHILTYSAYNLLFTPGSKIGPTHTVSLVGKNEYGLARVSTLVRVLPRINIL--NAPKDYSCTTDCLNSVSHTFDCVIDTDPYQSTYFV--QTWELNGISVSKMTKDYQQSKFIKTEGTK-LIITPVDDPSLTVLFRKVNVTCRWRIFYPHVTSRIADLDTRLLEPDMK---VYDSHDDVKIHPLMTAALDLQVDHDPTPASANISWITAVIIGILVIIAIGVLTACLVMRFRGETYMLDREERALGNDPEKELREKEAFQTYERAEEPP-----LRGSRCSLNDDSAEIGSDGDGELDDYNLDPGKFNEEGSFIGEYAT 786          
BLAST of Bravo_FIGEY domain-containing protein vs. TrEMBL
Match: A0A3P8H5B2 (Bravo_FIGEY domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS21191 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.259e-42
Identity = 189/663 (28.51%), Postives = 303/663 (45.70%), Query Frame = 2
Query:  563 KTIYQTNITRDKMPATFKCAQNGLTYNPSKPTWYQQLSMNPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYIKSKDAANPINTYI----QSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYL--RKLIKGSTKNRIVSLIALYQASSSAKPYWKNNGQQLNMGNNIEYDKFSVKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQYVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDTKELILNPVKSNDST-RDKSVKDALKDNFLECHVDLKSLPDVVPEF------VYYSTSDPSLKSKMKARITL--DFQPI-NTAYIYWXXXXXXXXXXXXXXXXXXXRYCMRNKGETYQLDKIEREHGYDPEKEVQE-EMFKPYEREEHDPDMMSDNTGER-KLSITAQSVGSANDGELDMYDLDPTNFNEDGSIIGKYGA 2497
            +T Y   ++ + +P + +C Q  ++     P+W      +P  WS C V    ++   I+      C++   Q           S    + +  YV  +G L LY      +       L+C+    D++   +TY     +   L    S + F G+  T       +SPL Q+IT+ +  R  +K  TK R        +        W  +G+++   +   +  + +KF   I  + +GTY L V +G D++ F FIV+V+GPP +++    P +  VME E+ +F+C   +   + +L+IN   +    +       L+  Y YL D       +  L  +   +TYSAYNL  T G      HTV    +NE+GL   ++ + V+PR+N L   +P+ Y+CT DC + +SH F C +  D Y +   +    W ++G  +     +     F     TK LI+ PV     T   + V    +      HV  + + D+          VY S  D  ++  M A + L  D  P   +A I W+ AVI+ +++I+ + +L     MR +GETY LD+ ER  G DPEKE++E E F+ YER E  P       G R  L+  +  +GS  DGELD Y+LDP  FNE+GS IG+Y  
Sbjct:  113 QTEYLPPLSINDLPLSLECGQTQVSEE--LPSWADAAFPSPFMWSFCDV----DSPDGIQSA---GCMRRVRQ----------TSTHVTNYFESYVSPNGTLVLYK---RTTSAWKDMGLVCW-SHLDSSAVYSTYFGGSSERPKLLTYDSNIPFVGSGIT------VLSPLTQRITVRIGPRTGLKLVTKYRSTPEYTTVK--------WTKDGRRIP-PDFPGHSDYLLKFPDLIRREHSGTYNLLVDNGNDQVNFQFIVSVVGPPEVIHAP--PPLLLVMEGENVTFSCQLDSF-ITESLEING--LPYQPNPTNFRTELRDQYPYLKD-----ALIQPLQKNGHILTYSAYNLLFTPGSKVGPTHTVSLVGKNEYGLARVSTLVRVLPRINIL--KAPKDYSCTTDCLNTISHAFDCVIDTDPYQSTYFV--QTWELNGIPVSKMTKDYQQSKFIKTEGTK-LIITPVDDPSLTVLFRKVNVTCRWRIFYPHVTSR-IADLDTRLLEPNMKVYDSHEDAKIRPLMTAALDLQVDHDPTPASANISWITAVIIGILVIIAIGVLTACLVMRFRGETYMLDREERALGNDPEKELREKEAFQTYERAEEPP-----LRGSRCSLNDDSAEIGSDGDGELDDYNLDPGKFNEEGSFIGEYAT 716          
BLAST of Bravo_FIGEY domain-containing protein vs. TrEMBL
Match: A0A183MYR6 (Bravo_FIGEY domain-containing protein OS=Schistosoma margrebowiei OX=48269 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.736e-42
Identity = 189/663 (28.51%), Postives = 303/663 (45.70%), Query Frame = 2
Query:  563 KTIYQTNITRDKMPATFKCAQNGLTYNPSKPTWYQQLSMNPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYIKSKDAANPINTYI----QSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYL--RKLIKGSTKNRIVSLIALYQASSSAKPYWKNNGQQLNMGNNIEYDKFSVKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQYVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDTKELILNPVKSNDST-RDKSVKDALKDNFLECHVDLKSLPDVVPEF------VYYSTSDPSLKSKMKARITL--DFQPI-NTAYIYWXXXXXXXXXXXXXXXXXXXRYCMRNKGETYQLDKIEREHGYDPEKEVQE-EMFKPYEREEHDPDMMSDNTGER-KLSITAQSVGSANDGELDMYDLDPTNFNEDGSIIGKYGA 2497
            +T Y   ++ + +P + +C Q  ++     P+W      +P  WS C V    ++   I+      C++   Q           S    + +  YV  +G L LY      +       L+C+    D++   +TY     +   L    S + F G+  T       +SPL Q+IT+ +  R  +K  TK R        +        W  +G+++   +   +  + +KF   I  + +GTY L V +G D++ F FIV+V+GPP +++    P +  VME E+ +F+C   +   + +L+IN   +    +       L+  Y YL D       +  L  +   +TYSAYNL  T G      HTV    +NE+GL   ++ + V+PR+N L   +P+ Y+CT DC + +SH F C +  D Y +   +    W ++G  +     +     F     TK LI+ PV     T   + V    +      HV  + + D+          VY S  D  ++  M A + L  D  P   +A I W+ AVI+ +++I+ + +L     MR +GETY LD+ ER  G DPEKE++E E F+ YER E  P       G R  L+  +  +GS  DGELD Y+LDP  FNE+GS IG+Y  
Sbjct:  113 QTEYLPPLSINDLPLSLECGQTQVSEE--LPSWADAAFPSPFMWSFCDV----DSPDGIQSA---GCMRRVRQ----------TSTHVTNYFESYVSPNGTLVLYK---RTTSAWKDMGLVCW-SHLDSSAVYSTYFGGSSERPKLLTYDSNIPFVGSGIT------VLSPLTQRITVRIGPRTGLKLVTKYRSTPEYTTVK--------WTKDGRRIP-PDFPGHSDYLLKFPDLIRREHSGTYNLLVDNGNDQVNFQFIVSVVGPPEVIHAP--PPLLLVMEGENVTFSCQLDSF-ITESLEING--LPYQPNPTNFRTELRDQYPYLKD-----ALIQPLQKNGHILTYSAYNLLFTPGSKVGPTHTVSLVGKNEYGLARVSTLVRVLPRINIL--KAPKDYSCTTDCLNTISHAFDCVIDTDPYQSTYFV--QTWELNGIPVSKMTKDYQQSKFIKTEGTK-LIITPVDDPSLTVLFRKVNVTCRWRIFYPHVTSR-IADLDTRLLEPNMKVYDSHEDAKIRPLMTAALDLQVDHDPTPASANISWITAVIIGILVIIAIGVLTACLVMRFRGETYMLDREERALGNDPEKELREKEAFQTYERAEEPP-----LRGSRCSLNDDSAEIGSDGDGELDDYNLDPGKFNEEGSFIGEYAT 716          
BLAST of Bravo_FIGEY domain-containing protein vs. TrEMBL
Match: A0A4Z2CS03 (E3 ubiquitin-protein ligase TRIM56 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_007983 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 7.271e-39
Identity = 219/826 (26.51%), Postives = 357/826 (43.22%), Query Frame = 2
Query:   95 GSSRDTGLLQSPILLSLTSNNAAIDVYSGRQIIIYKDLARHSN---IFIIYCLVSGYGPNRDLVYRF-CKEDSCPNEWKEAEQFSGITMFNYKISREENPA---GKLGLKLKLQFPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIYYWSQSIVLNNENTKTIYQTNITRDKMPATFKCAQNGLTYNPSKPTWYQQLSMNPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYIKSKDAANPINTY----IQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYL--RKLIKGSTKNRIVSLIALYQASSSAKPYWKNNGQQLNMGNNIEYDKFSVKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQYVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDTKELILNPVKSNDSTRDKSVKDALKDNFLEC-------HVDLKSLPDVVPEF------VYYSTSDPSLKSKMKARITL--DFQPI-NTAYIYWXXXXXXXXXXXXXXXXXXXRYCMRNKGETYQLDKIEREHGYDPEKEVQE-EMFKPYEREEHDPDMMSDNTGER-KLSITAQSVGSANDGELDMYDLDPTNFNEDGSI 2479
            G S  T   + P L     N   +D    +Q+ I   +  H N   +  I+C+V+      +LV  + C+  S      ++++       N    R E  A      G     + P       G + C+  ++ G  +  SN I+I+D YY+ + +V      +T +   ++ + +P + +C Q  ++     P+W      +P  WS C V +      A        C++   Q           S+   + +  YV  +G L LY      +       L+C+    D++   +TY    ++   L    S + F G   T       +SPL QKIT+ +  R  +K  TK R                 W  +G+++   +   ++ + +KF   I  + +G Y L V +  +++ F F V+V+GPP ++     P +  VME E+ +F+C + +   + +L+IN   +    +       L+  Y YL D+      +  L  +   +TYSAYNL  T G      HTV    +NE+GL   ++ + V+PRLN  I  +P+ Y+CT DC +  SH F C +  D Y +  ++    W ++G  +     +     F     TK LI+ PV       D S+    +   + C       HV  + + D+          VY S  D  + S M A   L  D  P   +A I W+ AVI+ +++I+ + +L     MR +GETY LD+ ER  G DPEKE++E E F+ YER E  P       G R  L+  +  +GS  DGELD Y+LDP N N   SI
Sbjct:   32 GVSHGTYFYEHPGL----RNPIEVDATVQQQVRIR--IVEHLNELPVLRIHCIVAPLDSTHELVSAYLCRRKSV----HDSDECIDPKTRNVVFGRVEFSAIGNRSSGYTFSSRLPVRDELLDGFYSCKFHNQNGELI--SNFIEIQDAYYYHKRMV-RRPVKQTEFLPPLSINNLPLSLECGQTQVS--EELPSWADAAFPSPFMWSFCDVDIPDGIQSA-------GCMRRVRQ----------TSIHVTNYFESYVSPNGTLVLYK---RTASAWKDMGLVCW-SHLDSSAVYSTYFGGSLERPRLLTYDSNIPFIGNEIT------VLSPLIQKITVRIGPRTGLKLVTKYR--------SNPKHTTVRWTKDGKKI-PSDFPRHNDYLLKFPDLIHRNHSGMYNLLVENEHNRVNFQFSVSVVGPPEVIRAP--PPLILVMEGENVTFSC-HLDSFITESLEING--LPYQPNAANFRTELRDQYPYLKDV-----LIQPLQKNGHILTYSAYNLFFTPGSKIGPTHTVSLVGKNEYGLARVSTVVRVLPRLN--ILKAPKDYSCTTDCLNTASHIFDCVINTDSYESAYIV--QTWELNGIAVSKMTKDYQQSKFLKTEGTK-LIITPVD------DPSLTVLFRKVNVTCRWRIFYPHVTSR-IADLDTRLLEPNMKVYDSHDDVKIHSLMTAAFNLQVDHDPAPASANISWITAVIIGILVIIAIGVLTACLVMRFRGETYMLDREERALGNDPEKELREKEAFQTYERVEEPPLR-----GSRCSLNDDSAEIGSDADGELDDYNLDPENSNRTPSI 779          
BLAST of Bravo_FIGEY domain-containing protein vs. Planmine SMEST
Match: SMESG000065363.1 (SMESG000065363.1)

HSP 1 Score: 1628.61 bits (4216), Expect = 0.000e+0
Identity = 807/821 (98.29%), Postives = 813/821 (99.03%), Query Frame = 2
Query:   62 LLFCQISCLRWGSSRDTGLLQSPILLSLTSNNAAIDVYSGRQIIIYKDLARHSNIFIIYCLVSGYGPNRDLVYRFCKEDSCPNEWKEAEQFSGITMFNYKISREENPAGKLGLKLKLQFPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIYYWSQSIVLNNENTKTIYQTNITRDKMPATFKCAQNGLTYNPSKPTWYQQLSMNPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYIKSKDAANPINTYIQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYLRKLIKGSTKNRIVSLIALYQASSSAKPYWKNNGQQLNMGNNIEYDKFSVKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQYVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDTKELILNPVKSNDSTRDKSVKDALKDNFLECHVDLKSLPDVVPEFVYYSTSDPSLKSKMKARITLDFQPINTAYIYWXXXXXXXXXXXXXXXXXXXRYCMRNKGETYQLDKIEREHGYDPEKEVQEEMFKPYEREEHDPDMMSDNTGERKLSITAQSVGSANDGELDMYDLDPTNFNEDGSIIGKYGANPRSRAAMT 2524
            +L   I CLRWGSSRDTGLLQSPILLSLTS+N AIDVYSGRQIIIYKDLA + +I ++YCLVSGYGPNRDLVYRFCKEDSCPNEWKEAEQFSGITMFNYKISREENPAGKLGLKLKLQFPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIYYWSQSIVLNNENTKTIYQTNITRDKMPATFKCAQNGLTYNPSKPTWYQQLSMNPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYIKSKDAANPINTYIQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYLRKLIKGSTKNRIVSLIALYQASSSAKPYWKNNGQQLNMGNNIEYDKFSVKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQYVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDTKELILNPVKSNDSTRDKSVKDALKDNFLECHVDLKSLPDVVPEFVYYSTSDPSLKSKMKARITLDFQPINTAYIYWVVAVILALVIILLMIILLVRYCMRNKGETYQLDKIEREHGYDPEKEVQEEMFKPYEREEHDPDMMSDNTGERKLSITAQSVGSANDGELDMYDLDPTNFNEDGSIIGKYGANPRSRAAMT
Sbjct:   10 ILSGSICCLRWGSSRDTGLLQSPILLSLTSSNTAIDVYSGRQIIIYKDLATYDSI-LVYCLVSGYGPNRDLVYRFCKEDSCPNEWKEAEQFSGITMFNYKISREENPAGKLGLKLKLQFPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIYYWSQSIVLNNENTKTIYQTNITRDKMPATFKCAQNGLTYNPSKPTWYQQLSMNPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYIKSKDAANPINTYIQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYLRKLIKGSTKNRIVSLIALYQASSSAKPYWKNNGQQLNMGNNIEYDKFSVKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQYVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDTKELILNPVKSNDSTRDKSVKDALKDNFLECHVDLKSLPDVVPEFVYYSTSDPSLKSKMKARITLDFQPINTAYIYWVVAVILALVIILLMIILLVRYCMRNKGETYQLDKIEREHGYDPEKEVQEEMFKPYEREEHDPDMMSDNTGERKLSITAQSVGSANDGELDMYDLDPTNFNEDGSIIGKYGANPRSRAAMT 829          
BLAST of Bravo_FIGEY domain-containing protein vs. Planmine SMEST
Match: SMESG000043141.1 (SMESG000043141.1)

HSP 1 Score: 1213.75 bits (3139), Expect = 0.000e+0
Identity = 590/635 (92.91%), Postives = 602/635 (94.80%), Query Frame = 2
Query:   74 QISCLRWGSSRDTGLLQSPILLSLTSNNAAIDVYSGRQIIIYKDLARHSNIFIIYCLVSGYGPNRDLVYRFCKEDSCPNEWKEAEQFSGITMFNYKISREENPAGKLGLKLKLQFPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIYYWSQSI--------------VLNNENTKTIYQTNITRDKMPATFKCAQNGLTYNPSKPTWYQQLSMNPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYIKSKDAANPINTYIQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYLRKLIKGSTKNRIVSLIALYQASSSAKPYWKNNGQQLNMGNNIEYDKFSVKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQYVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDT 1936
            QISCLRWGSSRDTGLLQSPILLSLTS+NAAIDVYSGRQIIIYKDLARHSNIFIIYCLVSGYGPNRDLVYRFCKEDSCPNEWKEAEQFS ITMFNYKISR  NPAGKLGLKL L+FPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIY+WSQSI              VLNNENTKTIYQTN+TRDKMPATFKCAQNGLTYNPS+P WYQQL M+PVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQ+YDIAFEQSPPAVTYALMCYIK KD+ANPINTYIQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYL+  IK + KNRI SLIALYQASS AK YWKNNGQQLNMGNNIEYDKFSVKFIGDIT DMAGTYTLDVTDGADKLTFTFIVTV GPPTLVN SCMPMVQYVMEFESTSFNCTYKN+PQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKT GQ QYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAI+QFAPYFTLNPDT
Sbjct:  185 QISCLRWGSSRDTGLLQSPILLSLTSSNAAIDVYSGRQIIIYKDLARHSNIFIIYCLVSGYGPNRDLVYRFCKEDSCPNEWKEAEQFSDITMFNYKISRAPNPAGKLGLKLMLKFPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIYFWSQSIQCCTVTNCDCLLGIVLNNENTKTIYQTNLTRDKMPATFKCAQNGLTYNPSEPAWYQQLKMSPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQIYDIAFEQSPPAVTYALMCYIKWKDSANPINTYIQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYLKTKIKDNYKNRIFSLIALYQASSFAKSYWKNNGQQLNMGNNIEYDKFSVKFIGDITDDMAGTYTLDVTDGADKLTFTFIVTVRGPPTLVNPSCMPMVQYVMEFESTSFNCTYKNQPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTLGQTQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAIHQFAPYFTLNPDT 819          
BLAST of Bravo_FIGEY domain-containing protein vs. Planmine SMEST
Match: SMESG000043141.1 (SMESG000043141.1)

HSP 1 Score: 1211.82 bits (3134), Expect = 0.000e+0
Identity = 595/659 (90.29%), Postives = 607/659 (92.11%), Query Frame = 2
Query:   59 GLLFC-------------------QISCLRWGSSRDTGLLQSPILLSLTSNNAAIDVYSGRQIIIYKDLARHSNIFIIYCLVSGYGPNRDLVYRFCKEDSCPNEWKEAEQFSGITMFNYKISREENPAGKLGLKLKLQFPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIYYWSQSI--------------VLNNENTKTIYQTNITRDKMPATFKCAQNGLTYNPSKPTWYQQLSMNPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYIKSKDAANPINTYIQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYLRKLIKGSTKNRIVSLIALYQASSSAKPYWKNNGQQLNMGNNIEYDKFSVKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQYVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDT 1936
            GLLFC                   QISCLRWGSSRDTGLLQSPILLSLTS+NAAIDVYSGRQIIIYKDLARHSNIFIIYCLVSGYGPNRDLVYRFCKEDSCPNEWKEAEQFS ITMFNYKISR  NPAGKLGLKL L+FPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIY+WSQSI              VLNNENTKTIYQTN+TRDKMPATFKCAQNGLTYNPS+P WYQQL M+PVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQ+YDIAFEQSPPAVTYALMCYIK KD+ANPINTYIQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYL+  IK + KNRI SLIALYQASS AK YWKNNGQQLNMGNNIEYDKFSVKFIGDIT DMAGTYTLDVTDGADKLTFTFIVTV GPPTLVN SCMPMVQYVMEFESTSFNCTYKN+PQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKT GQ QYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAI+QFAPYFTLNPDT
Sbjct:    9 GLLFCKFPFTVNKINYYLIGHFSGQISCLRWGSSRDTGLLQSPILLSLTSSNAAIDVYSGRQIIIYKDLARHSNIFIIYCLVSGYGPNRDLVYRFCKEDSCPNEWKEAEQFSDITMFNYKISRAPNPAGKLGLKLMLKFPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIYFWSQSIQCCTVTNCDCLLGIVLNNENTKTIYQTNLTRDKMPATFKCAQNGLTYNPSEPAWYQQLKMSPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQIYDIAFEQSPPAVTYALMCYIKWKDSANPINTYIQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYLKTKIKDNYKNRIFSLIALYQASSFAKSYWKNNGQQLNMGNNIEYDKFSVKFIGDITDDMAGTYTLDVTDGADKLTFTFIVTVRGPPTLVNPSCMPMVQYVMEFESTSFNCTYKNQPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTLGQTQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAIHQFAPYFTLNPDT 667          
BLAST of Bravo_FIGEY domain-containing protein vs. Planmine SMEST
Match: SMESG000003824.1 (SMESG000003824.1)

HSP 1 Score: 934.095 bits (2413), Expect = 0.000e+0
Identity = 457/752 (60.77%), Postives = 585/752 (77.79%), Query Frame = 2
Query:   83 CLRWGSSRDTGLLQSPILLSLTSNNAAIDVYSGRQIIIYKDLARHSNIFIIYCLVSGYGPNRDLVYRFCKEDSCPNEWKEAEQFSGITMFNYKISREENPAGKLGLKLKLQFPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIYYWSQSIVLNNENTKTIYQTNITRDKMPATFKCAQNGLTYNPSKPTWYQQLSMNPVEWSICPVKV-NYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYIKSKDAANPINTYIQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYLRKLIKGSTKNRIVSLIALYQASSSAKPYWKNNGQQLNMGNNIEYDKFSVKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQYVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDTKELILNPVKSNDSTRDKSVKDALKDNFLECHVDLKSLPDVVPEFVYYSTSDPSLKSKMKARITLDFQPINTAYIYWXXXXXXXXXXXXXXXXXXXRYCMRNKGETYQLDKIEREHGYDPEKEVQEEMFKPYER 2335
            CL+W  S    +LQSPI LS+TS++  ID+Y   QIIIYKD+  ++ IF+IYCLVSG+GPN +LVYRFCK+ SCPNEWK+ E  + + MF Y +SR  NP G  G+ LKL+FPG  +D+SGNFHCEV+DK+GNF++RSNDIQIRD YYWSQ+I+LN +N KTI+  N+TRD+MP TF C  NGLTYNP KP WYQQLS++PVEWSICPV V N++ LK+I+KQTF KCVQ+TTQI S  + I P S SDM +WT YVDNDGNL +YDI  E SPP +T+ALMCY   + +A PINTY Q  N +DI SGVYF+GTP  Y IPL+AISPL Q +TLYL+K I   TKNRIVSLIALY+ASS+AK  WK NG+QLN  N I++D++SVKF+GDIT  MAG YTLDVTD  DKL FTFIVTV GPPTLVN  CMP+++YVME++S S NC+Y+N+P+SL+LKINSE+IK GQS ++S V +KK Y +L DLNFT Q  P       +ITY A++LRK+QGQ + QDH+VMFFA+N+FGLNLK+SSIY++PR+      +P+SYNCT DC+S VSH F+C V +D+YAN+EL++DH+WTV+G+RLE NA ++FAPYF +N DTKELIL PV SND+ RD+ VK AL +NF+ECH+DL S   V  +F Y+S++DP LKS MKARITLD++     YIYW+V  ++ LVI+L+++ILLVR C+RN+ +TYQL+K+E + G+DP+ E + E    + R
Sbjct:   15 CLQWSFSDKRNILQSPIKLSMTSSDPVIDMYYRDQIIIYKDIEPYNRIFMIYCLVSGFGPNSELVYRFCKDQSCPNEWKDTETVNDLLMFYYNVSRVTNPKGIKGMILKLRFPGGSLDASGNFHCEVEDKIGNFLLRSNDIQIRDTYYWSQNIILNKDNMKTIFSNNVTRDEMPITFNCTDNGLTYNPDKPIWYQQLSISPVEWSICPVSVKNHDILKSIQKQTFTKCVQFTTQI-STLSSITPISHSDMVKWTSYVDNDGNLHIYDIVSEYSPPQMTFALMCYFVKEGSAVPINTYYQLANGDDIISGVYFHGTPLAYIIPLRAISPLLQNVTLYLKKWISDYTKNRIVSLIALYRASSTAKALWKFNGKQLNSNNQIQFDRYSVKFVGDITNKMAGIYTLDVTDKPDKLAFTFIVTVAGPPTLVNPDCMPLIKYVMEYDSISLNCSYQNEPKSLSLKINSEEIKHGQSSNLSMVMIKKLYPHLYDLNFTTQLEPD------SITYQAFSLRKSQGQTKSQDHSVMFFAKNDFGLNLKSSSIYIVPRITFPPKQAPDSYNCTVDCSSQVSHIFRCPVDLDQYANKELVVDHHWTVNGYRLELNATHRFAPYFFVNIDTKELILKPVISNDTKRDEFVKKALGNNFIECHMDLVSSDRVTSDFKYFSSTDPGLKSLMKARITLDYKGKRMTYIYWIVVGVVLLVIVLIVLILLVRGCIRNRLKTYQLEKLELQRGFDPDNESRSESLVDFSR 759          
BLAST of Bravo_FIGEY domain-containing protein vs. Planmine SMEST
Match: SMESG000003824.1 (SMESG000003824.1)

HSP 1 Score: 933.71 bits (2412), Expect = 0.000e+0
Identity = 457/752 (60.77%), Postives = 585/752 (77.79%), Query Frame = 2
Query:   83 CLRWGSSRDTGLLQSPILLSLTSNNAAIDVYSGRQIIIYKDLARHSNIFIIYCLVSGYGPNRDLVYRFCKEDSCPNEWKEAEQFSGITMFNYKISREENPAGKLGLKLKLQFPGSGVDSSGNFHCEVQDKVGNFMVRSNDIQIRDIYYWSQSIVLNNENTKTIYQTNITRDKMPATFKCAQNGLTYNPSKPTWYQQLSMNPVEWSICPVKV-NYEALKAIEKQTFDKCVQYTTQIFSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYIKSKDAANPINTYIQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITLYLRKLIKGSTKNRIVSLIALYQASSSAKPYWKNNGQQLNMGNNIEYDKFSVKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQYVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYLSDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFGLNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYANRELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDTKELILNPVKSNDSTRDKSVKDALKDNFLECHVDLKSLPDVVPEFVYYSTSDPSLKSKMKARITLDFQPINTAYIYWXXXXXXXXXXXXXXXXXXXRYCMRNKGETYQLDKIEREHGYDPEKEVQEEMFKPYER 2335
            CL+W  S    +LQSPI LS+TS++  ID+Y   QIIIYKD+  ++ IF+IYCLVSG+GPN +LVYRFCK+ SCPNEWK+ E  + + MF Y +SR  NP G  G+ LKL+FPG  +D+SGNFHCEV+DK+GNF++RSNDIQIRD YYWSQ+I+LN +N KTI+  N+TRD+MP TF C  NGLTYNP KP WYQQLS++PVEWSICPV V N++ LK+I+KQTF KCVQ+TTQI S  + I P S SDM +WT YVDNDGNL +YDI  E SPP +T+ALMCY   + +A PINTY Q  N +DI SGVYF+GTP  Y IPL+AISPL Q +TLYL+K I   TKNRIVSLIALY+ASS+AK  WK NG+QLN  N I++D++SVKF+GDIT  MAG YTLDVTD  DKL FTFIVTV GPPTLVN  CMP+++YVME++S S NC+Y+N+P+SL+LKINSE+IK GQS ++S V +KK Y +L DLNFT Q  P       +ITY A++LRK+QGQ + QDH+VMFFA+N+FGLNLK+SSIY++PR+      +P+SYNCT DC+S VSH F+C V +D+YAN+EL++DH+WTV+G+RLE NA ++FAPYF +N DTKELIL PV SND+ RD+ VK AL +NF+ECH+DL S   V  +F Y+S++DP LKS MKARITLD++     YIYW+V  ++ LVI+L+++ILLVR C+RN+ +TYQL+K+E + G+DP+ E + E    + R
Sbjct:   12 CLQWSFSDKRNILQSPIKLSMTSSDPVIDMYYRDQIIIYKDIEPYNRIFMIYCLVSGFGPNSELVYRFCKDQSCPNEWKDTETVNDLLMFYYNVSRVTNPKGIKGMILKLRFPGGSLDASGNFHCEVEDKIGNFLLRSNDIQIRDTYYWSQNIILNKDNMKTIFSNNVTRDEMPITFNCTDNGLTYNPDKPIWYQQLSISPVEWSICPVSVKNHDILKSIQKQTFTKCVQFTTQI-STLSSITPISHSDMVKWTSYVDNDGNLHIYDIVSEYSPPQMTFALMCYFVKEGSAVPINTYYQLANGDDIISGVYFHGTPLAYIIPLRAISPLLQNVTLYLKKWISDYTKNRIVSLIALYRASSTAKALWKFNGKQLNSNNQIQFDRYSVKFVGDITNKMAGIYTLDVTDKPDKLAFTFIVTVAGPPTLVNPDCMPLIKYVMEYDSISLNCSYQNEPKSLSLKINSEEIKHGQSSNLSMVMIKKLYPHLYDLNFTTQLEPD------SITYQAFSLRKSQGQTKSQDHSVMFFAKNDFGLNLKSSSIYIVPRITFPPKQAPDSYNCTVDCSSQVSHIFRCPVDLDQYANKELVVDHHWTVNGYRLELNATHRFAPYFFVNIDTKELILKPVISNDTKRDEFVKKALGNNFIECHMDLVSSDRVTSDFKYFSSTDPGLKSLMKARITLDYKGKRMTYIYWIVVGVVLLVIVLIVLILLVRGCIRNRLKTYQLEKLELQRGFDPDNESRSESLVDFSR 756          
The following BLAST results are available for this feature:
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KT094.058e-4927.43Putative immunoglobulin domain superfamily (Sensor... [more]
G4V9E14.884e-4927.43Putative immunoglobulin domain superfamily (Sensor... [more]
A0A3P8H5B22.259e-4228.51Bravo_FIGEY domain-containing protein OS=Schistoso... [more]
A0A183MYR62.736e-4228.51Bravo_FIGEY domain-containing protein OS=Schistoso... [more]
A0A4Z2CS037.271e-3926.51E3 ubiquitin-protein ligase TRIM56 (Fragment) OS=S... [more]
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065363.10.000e+098.29SMESG000065363.1[more]
SMESG000043141.10.000e+092.91SMESG000043141.1[more]
SMESG000043141.10.000e+090.29SMESG000043141.1[more]
SMESG000003824.10.000e+060.77SMESG000003824.1[more]
SMESG000003824.10.000e+060.77SMESG000003824.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028890 ID=SMED30028890|Name=Bravo_FIGEY domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2826bp
TTTATATCAAGCGAATTGAATTCATTATTAATAAATGATTAGAGCTATTA
TAATTATCGGCCTATTGTTTTGTCAAATCTCCTGTCTGCGATGGGGTTCG
TCAAGGGATACAGGACTGCTACAATCTCCGATATTACTATCTCTGACATC
CAACAACGCAGCGATTGATGTATATTCTGGCCGCCAGATCATCATTTATA
AGGACTTAGCCAGACACAGCAACATATTCATAATATATTGCTTAGTATCG
GGATATGGTCCCAATAGAGACTTGGTATACAGGTTTTGCAAAGAAGATTC
ATGTCCAAACGAATGGAAAGAGGCAGAACAGTTTTCAGGTATTACGATGT
TCAACTACAAAATATCAAGAGAAGAAAACCCAGCCGGCAAATTGGGATTG
AAATTAAAGCTGCAGTTCCCCGGCAGTGGAGTCGATTCATCAGGAAATTT
CCATTGTGAAGTTCAGGACAAAGTTGGTAACTTCATGGTGAGATCTAATG
ATATTCAAATCAGGGACATTTACTATTGGTCGCAAAGTATTGTACTCAAC
AATGAAAACACTAAAACAATATATCAGACTAATATAACGAGAGACAAGAT
GCCCGCCACATTCAAATGTGCACAGAATGGCTTGACCTATAATCCAAGTA
AGCCAACTTGGTATCAACAACTGTCAATGAATCCTGTCGAATGGAGCATC
TGTCCAGTGAAGGTTAATTATGAAGCATTGAAAGCAATTGAGAAGCAAAC
ATTTGACAAATGCGTTCAATATACAACTCAAATCTTTTCTGGAGATAATA
TTATAAAGCCGAAAAGCCTTTCTGACATGAGTCAATGGACTGGCTATGTG
GATAATGACGGGAATCTACAATTATATGATATCGCATTTGAACAAAGTCC
GCCTGCAGTCACCTATGCCCTCATGTGCTACATCAAATCGAAAGATGCCG
CAAATCCAATTAACACCTACATTCAATCATATAATTTAAATGACATTGCC
TCTGGTGTCTATTTCTATGGAACACCTTCAACTTACACAATCCCATTAAA
GGCCATTAGTCCGTTGGAGCAGAAAATTACTCTTTATCTTAGAAAGCTGA
TCAAAGGAAGTACCAAAAATAGAATCGTTTCACTCATTGCCTTATATCAA
GCATCATCATCCGCAAAGCCGTATTGGAAAAACAATGGACAACAATTGAA
TATGGGTAACAATATCGAATATGATAAATTTTCCGTGAAATTTATTGGGG
ATATCACTGGGGATATGGCTGGCACCTATACTCTAGATGTGACGGACGGG
GCAGACAAACTGACATTTACATTCATCGTCACTGTGCTGGGGCCCCCGAC
ATTAGTTAATACAAGCTGCATGCCTATGGTCCAATACGTGATGGAATTCG
AGTCGACATCTTTCAACTGCACTTACAAAAACAAACCACAGTCACTGGCA
TTGAAAATAAACAGTGAAGATATCAAACTCGGTCAATCATTAGATATGTC
AACTGTTAGTCTCAAAAAGTCATATGCGTATTTAAGTGATTTGAATTTTA
CAATTCAATCTGTCCCCCAGCTTCCATCGGATACGGTTACCATAACTTAT
TCAGCCTATAATTTAAGGAAAACTCAAGGCCAAATCCAATATCAAGATCA
TACGGTTATGTTCTTTGCGAGAAATGAGTTCGGCCTCAACCTGAAAACCA
GTTCAATCTATGTCATTCCGAGATTAAATAATCTAATAGATTCATCCCCG
GAATCGTATAATTGTACTAATGATTGTACCAGTCTGGTTTCTCATAAATT
CCAATGTCAAGTACAAGTGGACAAATATGCTAATAGAGAGCTGCTGATTG
ATCATTATTGGACAGTAAGTGGTCACCGACTGGAACCGAACGCTATCAAC
CAATTCGCGCCATATTTCACCCTCAATCCAGATACGAAAGAATTAATCTT
GAATCCAGTCAAGTCTAATGACTCAACTAGGGACAAATCTGTTAAGGACG
CACTCAAAGACAATTTTTTAGAATGCCACGTGGATTTGAAATCACTTCCT
GATGTCGTGCCAGAATTTGTATACTATTCCACCAGTGATCCCTCCTTGAA
ATCTAAAATGAAAGCTCGAATAACATTGGACTTTCAACCAATAAACACGG
CATATATCTACTGGGTTGTGGCCGTCATTCTAGCATTGGTGATCATTTTG
CTGATGATAATCCTTCTCGTGCGTTATTGTATGCGGAACAAAGGTGAAAC
CTACCAATTGGATAAAATTGAACGTGAACACGGATATGATCCGGAAAAGG
AAGTGCAGGAAGAAATGTTCAAGCCATATGAACGAGAAGAGCACGATCCA
GATATGATGTCCGATAATACTGGCGAGAGGAAGCTATCAATCACTGCCCA
GAGCGTCGGTAGTGCCAATGACGGCGAGTTGGACATGTACGATTTGGACC
CTACGAATTTCAATGAAGACGGTTCAATCATTGGTAAATACGGAGCGAAC
CCCCGCAGTAGAGCAGCAATGACATAACCAATCATATCCAAAATACTGAT
GACCACCACTAATACTAAAATGGAATTCTAGATCCATTTACCCCCCGTGA
AAACAATTTGATATCAATTTGTATATTATTATTATCATTACCGTTATTAC
CGCAACAGAGGTTCTGTATAATATTTCACAAGTTTGACAGCGTTCACTTG
TAAAGTATTACAATTATTTATTAACCGCTCTTTTTTATCTTTTCTAATAT
GTTGATTTATTAGTGCTTTATTAATTATCCAAGATAACTGTTGCTCAATA
TTGAATAAATACTATTTATCTAAAAA
back to top

protein sequence of SMED30028890-orf-1

>SMED30028890-orf-1 ID=SMED30028890-orf-1|Name=SMED30028890-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=831bp
MIRAIIIIGLLFCQISCLRWGSSRDTGLLQSPILLSLTSNNAAIDVYSGR
QIIIYKDLARHSNIFIIYCLVSGYGPNRDLVYRFCKEDSCPNEWKEAEQF
SGITMFNYKISREENPAGKLGLKLKLQFPGSGVDSSGNFHCEVQDKVGNF
MVRSNDIQIRDIYYWSQSIVLNNENTKTIYQTNITRDKMPATFKCAQNGL
TYNPSKPTWYQQLSMNPVEWSICPVKVNYEALKAIEKQTFDKCVQYTTQI
FSGDNIIKPKSLSDMSQWTGYVDNDGNLQLYDIAFEQSPPAVTYALMCYI
KSKDAANPINTYIQSYNLNDIASGVYFYGTPSTYTIPLKAISPLEQKITL
YLRKLIKGSTKNRIVSLIALYQASSSAKPYWKNNGQQLNMGNNIEYDKFS
VKFIGDITGDMAGTYTLDVTDGADKLTFTFIVTVLGPPTLVNTSCMPMVQ
YVMEFESTSFNCTYKNKPQSLALKINSEDIKLGQSLDMSTVSLKKSYAYL
SDLNFTIQSVPQLPSDTVTITYSAYNLRKTQGQIQYQDHTVMFFARNEFG
LNLKTSSIYVIPRLNNLIDSSPESYNCTNDCTSLVSHKFQCQVQVDKYAN
RELLIDHYWTVSGHRLEPNAINQFAPYFTLNPDTKELILNPVKSNDSTRD
KSVKDALKDNFLECHVDLKSLPDVVPEFVYYSTSDPSLKSKMKARITLDF
QPINTAYIYWVVAVILALVIILLMIILLVRYCMRNKGETYQLDKIEREHG
YDPEKEVQEEMFKPYEREEHDPDMMSDNTGERKLSITAQSVGSANDGELD
MYDLDPTNFNEDGSIIGKYGANPRSRAAMT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR026966Neurofascin/L1/NrCAM_C
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026966Neurofascin/L1/NrCAM, C-terminal domainPFAMPF13882Bravo_FIGEYcoord: 629..717
e-value: 2.3E-14
score: 54.5
NoneNo IPR availableTMHMMTMhelixcoord: 603..625