Tubulin beta chain

Overview
NameTubulin beta chain
Smed IDSMED30028840
Length (bp)1021
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin beta chain (SMED30028840) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin beta chain (SMED30028840) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubulin beta chain (SMED30028840) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubulin beta chain (SMED30028840) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028840

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30028840SMESG000048308.1 Contig4262_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 491.115 bits (1263), Expect = 8.090e-175
Identity = 225/256 (87.89%), Postives = 245/256 (95.70%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQ+FD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+VTFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT
Sbjct:  102 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 491.115 bits (1263), Expect = 8.090e-175
Identity = 225/256 (87.89%), Postives = 245/256 (95.70%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQ+FD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+VTFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT
Sbjct:  102 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 491.115 bits (1263), Expect = 8.090e-175
Identity = 225/256 (87.89%), Postives = 245/256 (95.70%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQ+FD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+VTFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT
Sbjct:  102 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 491.115 bits (1263), Expect = 8.090e-175
Identity = 225/256 (87.89%), Postives = 245/256 (95.70%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQ+FD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+VTFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT
Sbjct:  102 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 491.115 bits (1263), Expect = 8.090e-175
Identity = 225/256 (87.89%), Postives = 245/256 (95.70%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQ+FD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+VTFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT
Sbjct:  102 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-4 (Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot;Acc:P41937])

HSP 1 Score: 491.115 bits (1263), Expect = 3.195e-174
Identity = 224/260 (86.15%), Postives = 246/260 (94.62%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDE 866
            +VSD VVEPYNATLS+HQLVEN DET+CIDNEALYDIC RTLKLT+PTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAAMFRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRG+KM+ TF+GN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+Q+AT DDE
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSMTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGVKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATADDE 433          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 489.96 bits (1260), Expect = 1.281e-173
Identity = 220/263 (83.65%), Postives = 247/263 (93.92%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQA 875
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PL+++ +Q YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAAMFRGRMSM+EVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+ TF+GN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDLISEYQQ+Q+AT +D++  
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATAEDDVDG 436          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 489.96 bits (1260), Expect = 1.281e-173
Identity = 220/263 (83.65%), Postives = 247/263 (93.92%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQA 875
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PL+++ +Q YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAAMFRGRMSM+EVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+ TF+GN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDLISEYQQ+Q+AT +D++  
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATAEDDVDG 436          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 489.96 bits (1260), Expect = 1.281e-173
Identity = 220/263 (83.65%), Postives = 247/263 (93.92%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQA 875
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PL+++ +Q YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAAMFRGRMSM+EVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+ TF+GN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDLISEYQQ+Q+AT +D++  
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATAEDDVDG 436          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 489.96 bits (1260), Expect = 1.281e-173
Identity = 220/263 (83.65%), Postives = 247/263 (93.92%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQA 875
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PL+++ +Q YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAAMFRGRMSM+EVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+ TF+GN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDLISEYQQ+Q+AT +D++  
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATAEDDVDG 436          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086536)

HSP 1 Score: 489.574 bits (1259), Expect = 2.319e-173
Identity = 223/256 (87.11%), Postives = 243/256 (94.92%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLN+QNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+Q+AT
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAT 429          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086537)

HSP 1 Score: 488.034 bits (1255), Expect = 1.088e-172
Identity = 223/256 (87.11%), Postives = 243/256 (94.92%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLN+QNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+Q+AT
Sbjct:  183 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAT 438          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0072270)

HSP 1 Score: 487.263 bits (1253), Expect = 2.183e-172
Identity = 224/260 (86.15%), Postives = 244/260 (93.85%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDE 866
            +VSD VVEPYNATLSIHQLVEN DETYCIDNEALYDIC RTLK+++P+YGDLNHLVS TMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQML VQNKNS+YFVEWIPNNVKTAVCDIPP+GLKMS TFIGN TAIQE+FKR+ EQFSAMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+Q+AT DDE
Sbjct:  180 KVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAVCDIPPKGLKMSSTFIGNTTAIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATADDE 439          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0343443)

HSP 1 Score: 487.263 bits (1253), Expect = 2.485e-172
Identity = 224/260 (86.15%), Postives = 244/260 (93.85%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDE 866
            +VSD VVEPYNATLSIHQLVEN DETYCIDNEALYDIC RTLK+++P+YGDLNHLVS TMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQML VQNKNS+YFVEWIPNNVKTAVCDIPP+GLKMS TFIGN TAIQE+FKR+ EQFSAMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+Q+AT DDE
Sbjct:  179 KVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAVCDIPPKGLKMSSTFIGNTTAIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATADDE 438          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub85D (gene:FBgn0003889 transcript:FBtr0082046)

HSP 1 Score: 486.878 bits (1252), Expect = 2.649e-172
Identity = 223/257 (86.77%), Postives = 243/257 (94.55%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLN+QNKNS++FVEWIPNN KTAVCDIPPRGLKMS TFIGN+TAIQE+FKRV EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+Q+AT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:65894 (zgc:65894 [Source:ZFIN;Acc:ZDB-GENE-030131-7741])

HSP 1 Score: 493.041 bits (1268), Expect = 9.783e-175
Identity = 227/256 (88.67%), Postives = 244/256 (95.31%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  SV +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRVLSVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:153426 (zgc:153426 [Source:ZFIN;Acc:ZDB-GENE-060929-220])

HSP 1 Score: 492.271 bits (1266), Expect = 2.103e-174
Identity = 226/257 (87.94%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  SV +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+ TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLSVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: tubb4b (tubulin, beta 4B class IVb [Source:ZFIN;Acc:ZDB-GENE-030131-8625])

HSP 1 Score: 491.5 bits (1264), Expect = 5.052e-174
Identity = 225/257 (87.55%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+ TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 491.115 bits (1263), Expect = 5.200e-174
Identity = 225/257 (87.55%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+ TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 491.5 bits (1264), Expect = 5.278e-174
Identity = 225/257 (87.55%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+ TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 493.426 bits (1269), Expect = 3.357e-175
Identity = 226/257 (87.94%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  137 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 393          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 492.656 bits (1267), Expect = 2.439e-174
Identity = 226/257 (87.94%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: znf330 (zinc finger protein 330 [Source:Xenbase;Acc:XB-GENE-1010548])

HSP 1 Score: 492.271 bits (1266), Expect = 3.102e-174
Identity = 226/257 (87.94%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: tubb (tubulin beta class I [Source:NCBI gene;Acc:448742])

HSP 1 Score: 491.115 bits (1263), Expect = 8.282e-174
Identity = 225/256 (87.89%), Postives = 245/256 (95.70%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQ+FD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+VTFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: ubxn11 (UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-985480])

HSP 1 Score: 487.263 bits (1253), Expect = 3.121e-172
Identity = 223/254 (87.80%), Postives = 242/254 (95.28%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQD 848
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+ TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QD
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 427          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb2b (tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:MGI:1920960])

HSP 1 Score: 492.271 bits (1266), Expect = 2.861e-174
Identity = 226/257 (87.94%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb5 (tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI:107812])

HSP 1 Score: 491.115 bits (1263), Expect = 6.273e-174
Identity = 225/256 (87.89%), Postives = 245/256 (95.70%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQ+FD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+VTFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb2a (tubulin, beta 2A class IIA [Source:MGI Symbol;Acc:MGI:107861])

HSP 1 Score: 489.574 bits (1259), Expect = 2.719e-173
Identity = 225/257 (87.55%), Postives = 243/257 (94.55%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETY IDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb4b (tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:MGI:1915472])

HSP 1 Score: 488.419 bits (1256), Expect = 7.038e-173
Identity = 224/254 (88.19%), Postives = 242/254 (95.28%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQD 848
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QD
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 427          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb4a (tubulin, beta 4A class IVA [Source:MGI Symbol;Acc:MGI:107848])

HSP 1 Score: 483.797 bits (1244), Expect = 5.688e-171
Identity = 221/254 (87.01%), Postives = 242/254 (95.28%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQD 848
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQML+VQ+KNS+YFVEWIPNNVKTAVCDIPPRGLKM+ TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QD
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 427          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P18700|TBB_STRPU (Tubulin beta chain (Fragment) OS=Strongylocentrotus purpuratus OX=7668 PE=2 SV=1)

HSP 1 Score: 494.197 bits (1271), Expect = 1.093e-176
Identity = 226/257 (87.94%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:   19 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 275          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P30883|TBB4_XENLA (Tubulin beta-4 chain OS=Xenopus laevis OX=8355 GN=tubb4 PE=2 SV=1)

HSP 1 Score: 493.041 bits (1268), Expect = 9.619e-174
Identity = 226/257 (87.94%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P11833|TBB_PARLI (Tubulin beta chain OS=Paracentrotus lividus OX=7656 PE=2 SV=1)

HSP 1 Score: 493.041 bits (1268), Expect = 1.054e-173
Identity = 226/257 (87.94%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P13602|TBB2_XENLA (Tubulin beta-2 chain OS=Xenopus laevis OX=8355 GN=tubb2 PE=2 SV=1)

HSP 1 Score: 492.656 bits (1267), Expect = 1.105e-173
Identity = 226/258 (87.60%), Postives = 245/258 (94.96%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVD 860
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNK+S+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT D
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKSSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD 431          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P02554|TBB_PIG (Tubulin beta chain OS=Sus scrofa OX=9823 PE=1 SV=1)

HSP 1 Score: 492.656 bits (1267), Expect = 1.306e-173
Identity = 226/257 (87.94%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A4E0QYI0 (Tubulin beta chain OS=Fasciola hepatica OX=6192 GN=D915_009894 PE=3 SV=1)

HSP 1 Score: 530.406 bits (1365), Expect = 0.000e+0
Identity = 246/262 (93.89%), Postives = 257/262 (98.09%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQ 872
            QVSDVVVEPYNATLSIHQLVENCDET+CIDNEALYDICNRTLKL++PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNM+PFPRLHFFMPGFSPLTSRHSQPYR  +VQDLT QMFD KNMMAACDPRHGKYLTVAA+FRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRV EQFSAMFRRRAFLHWYTGEGMDEMEF+EAE+N+NDLISEYQQFQDATV+DE+Q
Sbjct:    2 QVSDVVVEPYNATLSIHQLVENCDETFCIDNEALYDICNRTLKLSTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMVPFPRLHFFMPGFSPLTSRHSQPYRSNTVQDLTHQMFDSKNMMAACDPRHGKYLTVAAVFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVGEQFSAMFRRRAFLHWYTGEGMDEMEFSEAEANMNDLISEYQQFQDATVEDEVQ 263          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A4S2LW10 (Tubulin beta chain OS=Opisthorchis felineus OX=147828 GN=CRM22_004465 PE=3 SV=1)

HSP 1 Score: 519.235 bits (1336), Expect = 0.000e+0
Identity = 241/262 (91.98%), Postives = 256/262 (97.71%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQ 872
            +VSDVVVEPYNATLSIHQLVENCDET+CIDNEALYDICNRTLKL++PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNM+PFPRLHFFMPGFSPLTSRHS PYR  +VQDLT QMFD KNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQN+NSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRV EQF+AMFRRRAFLHWYTGEGMDEMEF+EAESN++DLISEYQQFQDATV+D+++
Sbjct:  102 KVSDVVVEPYNATLSIHQLVENCDETFCIDNEALYDICNRTLKLSTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMVPFPRLHFFMPGFSPLTSRHSMPYRSNTVQDLTHQMFDNKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNRNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVGEQFAAMFRRRAFLHWYTGEGMDEMEFSEAESNMDDLISEYQQFQDATVEDQVE 363          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A419PIP4 (Tubulin beta chain OS=Clonorchis sinensis OX=79923 GN=tbb-4 PE=3 SV=1)

HSP 1 Score: 519.235 bits (1336), Expect = 0.000e+0
Identity = 241/262 (91.98%), Postives = 256/262 (97.71%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQ 872
            +VSDVVVEPYNATLSIHQLVENCDET+CIDNEALYDICNRTLKL++PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNM+PFPRLHFFMPGFSPLTSRHS PYR  +VQDLT QMFD KNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQN+NSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRV EQF+AMFRRRAFLHWYTGEGMDEMEF+EAESN++DLISEYQQFQDATV+D+++
Sbjct:  174 KVSDVVVEPYNATLSIHQLVENCDETFCIDNEALYDICNRTLKLSTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMVPFPRLHFFMPGFSPLTSRHSMPYRSNTVQDLTHQMFDSKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNRNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVGEQFAAMFRRRAFLHWYTGEGMDEMEFSEAESNMDDLISEYQQFQDATVEDQVE 435          
BLAST of Tubulin beta chain vs. TrEMBL
Match: H2KQS1 (Tubulin beta chain (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_104575 PE=3 SV=1)

HSP 1 Score: 519.235 bits (1336), Expect = 0.000e+0
Identity = 241/262 (91.98%), Postives = 256/262 (97.71%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQ 872
            +VSDVVVEPYNATLSIHQLVENCDET+CIDNEALYDICNRTLKL++PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNM+PFPRLHFFMPGFSPLTSRHS PYR  +VQDLT QMFD KNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQN+NSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRV EQF+AMFRRRAFLHWYTGEGMDEMEF+EAESN++DLISEYQQFQDATV+D+++
Sbjct:  155 KVSDVVVEPYNATLSIHQLVENCDETFCIDNEALYDICNRTLKLSTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMVPFPRLHFFMPGFSPLTSRHSMPYRSNTVQDLTHQMFDSKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNRNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVGEQFAAMFRRRAFLHWYTGEGMDEMEFSEAESNMDDLISEYQQFQDATVEDQVE 416          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A5J4P2B8 (Tubulin beta chain OS=Paragonimus westermani OX=34504 GN=DEA37_0008870 PE=3 SV=1)

HSP 1 Score: 518.464 bits (1334), Expect = 0.000e+0
Identity = 242/262 (92.37%), Postives = 255/262 (97.33%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQ 872
            +VSDVVVEPYNATLSIHQLVENCDET+CIDNEALYDICNRTLKL +PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNM+PFPRLHFFMPGFSPLTSR SQPYR  +VQDLT QMFD KNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQN+NSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRV EQF+AMF+RRAFLHWYTGEGMDEMEF+EAE+N+NDLISEYQQFQDATV+DE+Q
Sbjct:  200 KVSDVVVEPYNATLSIHQLVENCDETFCIDNEALYDICNRTLKLNTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMVPFPRLHFFMPGFSPLTSRRSQPYRSNTVQDLTHQMFDSKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNRNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVGEQFAAMFQRRAFLHWYTGEGMDEMEFSEAEANMNDLISEYQQFQDATVEDEVQ 461          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000019550.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1405913:1407004:-1 gene:ENSAMXG00000018987.2 transcript:ENSAMXT00000019550.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 488.419 bits (1256), Expect = 3.879e-174
Identity = 223/254 (87.80%), Postives = 243/254 (95.67%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQD 848
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQ+FD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+VTFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QD
Sbjct:   93 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 346          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: zgc:55461 (tubulin beta-4B chain [Source:NCBI gene;Acc:103024068])

HSP 1 Score: 491.5 bits (1264), Expect = 4.376e-174
Identity = 225/257 (87.55%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+ TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: TUBB2A (tubulin beta-2A chain [Source:NCBI gene;Acc:103041736])

HSP 1 Score: 491.5 bits (1264), Expect = 7.305e-173
Identity = 224/259 (86.49%), Postives = 245/259 (94.59%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDD 863
            +VSD VVEPYNATLS+HQLVEN DET+ IDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  SV +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQML+VQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+F+R+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT D+
Sbjct:  251 KVSDTVVEPYNATLSVHQLVENTDETFSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALSVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLSVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFRRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADE 509          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: TUBB1 (tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HGNC:16257])

HSP 1 Score: 463.766 bits (1192), Expect = 3.117e-163
Identity = 212/256 (82.81%), Postives = 233/256 (91.02%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLSIHQL+EN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVS TMSGVTT LRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLT+R SQ YR  +V +LTQQMFD +NMM ACDPR G+YLTVA +FRGRMS KEVDEQML +Q KNS YFV+WIP+NVK AVCDIPPRGLKM+ TFIGNNTAIQEIF+RV EQF+ MFRR+AFLHWYTGEGMDEMEFTEAE+NLNDL+SEYQQ+QDAT
Sbjct:  148 KVSDTVVEPYNATLSIHQLIENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDARNMMTACDPRRGRYLTVAGIFRGRMSTKEVDEQMLAIQQKNSNYFVDWIPHNVKVAVCDIPPRGLKMASTFIGNNTAIQEIFRRVGEQFAMMFRRKAFLHWYTGEGMDEMEFTEAENNLNDLVSEYQQYQDAT 403          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000019223.2 (tubulin alpha-1 chain [Source:NCBI gene;Acc:103031418])

HSP 1 Score: 224.172 bits (570), Expect = 1.968e-69
Identity = 107/271 (39.48%), Postives = 159/271 (58.67%), Query Frame = 3
Query:   69 ADYDLFQVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPR--------GLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            A Y   QVS  VVEPYN+ L+ H  +E+ D  + +DNEA+YDIC R L +  P+Y +LN L+   +S +T  LRF G LN DL +  TN++P+PR+HF +  +SP+ S     +   SV ++T   F+  N M  CDPRHGKY+    ++RG +  K+V+  + N++ K S  FV+W P   K  +   PP          ++ +V  + N TAI E + R+  +F  M+ +RAF+HWY GEGM+E EF+EA  +L  L  +Y++    TV
Sbjct:  171 AIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISTEKAYHEQLSVAEITSACFEPSNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIANIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDTV 441          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 416.387 bits (1069), Expect = 2.794e-146
Identity = 192/219 (87.67%), Postives = 207/219 (94.52%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRR 743
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+
Sbjct:  157 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRK 375          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 162.155 bits (409), Expect = 2.431e-47
Identity = 73/181 (40.33%), Postives = 109/181 (60.22%), Query Frame = 3
Query:   69 ADYDLFQVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNN 611
            A Y   QVS  VVEPYN+ L+ H  +E+ D  + +DNEA+YDIC R L +  PTY +LN L+   +S +T  LRF G LN DL +  TN++P+PR+HF +  ++P+ S     +   SV ++T   F+  N M  CDPRHGKY+    ++RG +  K+V+  +  ++ K +  FV+W P  
Sbjct:  170 AIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001368.1 (pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-1 gene:ENSPMAG00000001230.1 transcript:ENSPMAT00000001368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.303 bits (399), Expect = 8.520e-45
Identity = 89/272 (32.72%), Postives = 138/272 (50.74%), Query Frame = 3
Query:   96 DVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRT----------------------LKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTG-EGMDEMEFTEAESNLNDLISEYQQF 842
            DVV  PYN+ L++ +L E+ D    I+N+AL DI N+                       LK     +  +N++V+  M  +T+  RF G LN DL ++  N++PFPRLH+ +   +PL +          +  +    F  +N +   DPR   YL  A M RG + + +V   +  +  K S +FV+W     KT +C +PP G   S+  + NNT ++  F  + E+F+ ++RR+A LH YT  EGM+   FTEA S+L  +I EY Q 
Sbjct:  188 DVVTSPYNSVLAMRELTEHADCVLPIENQALVDIVNKINHAAALGKSVRSQTTLSSSHGCLKGQEKPFDTMNNIVANLMLNMTSSSRFEGSLNVDLNEITMNLVPFPRLHYLVSSLTPLYALADVALPPRRLDQMFSDAFSKENQLLRVDPRRSLYLACALMVRGNVQLSDVRRNIERL--KPSLHFVDWNEEGWKTGLCSVPPVGYPHSLLALANNTCVKHTFADIQERFARLYRRKAHLHHYTDVEGMELSCFTEAASSLASVIEEYNQL 457          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 157.147 bits (396), Expect = 1.742e-44
Identity = 85/260 (32.69%), Postives = 143/260 (55.00%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHS-QPYRCYSVQDLTQQMFDCKNMMAACDPRHGK---YLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPP---RGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGM---DEMEFTEAESNLNDLISEYQ 836
            ++SDVVV+PYN+ L++ +L +N D    +DN AL  I    L + +P++  +N LVS  MS  TT LR+PG +N DL  L  ++IP PRLHF M G++PLT+  S    R  +V D+ +++   KN+M +          Y+ +  + +G +   +V + +  ++ +  A F+ W P +++ A+    P      ++S   + N+T+I  +F R C+Q+  + +R AFL  +  E M   D  EF ++   +  LI EYQ
Sbjct:  172 EMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLTSAHRVSGLMMANHTSISSLFDRTCKQYDKLRKREAFLDQFRKEDMFKEDLSEFDDSREVVQQLIDEYQ 431          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.836 bits (390), Expect = 1.789e-44
Identity = 69/179 (38.55%), Postives = 111/179 (62.01%), Query Frame = 3
Query:   75 YDLFQVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNN 611
            Y   QVS  VVEPYNA L+ H  +E+ D ++ +DNEA+YDIC + L +  P+Y +LN L++  +S +T  LRF G LN DL +  TN++P+PR+HF +  ++P+ S     +   SV ++T   F+  N M  CDPR+GKY+    ++RG +  K+V+  +  ++++ +  FV+W P  
Sbjct:  177 YPAPQVSTAVVEPYNAILTTHTTLEHSDCSFMVDNEAIYDICRKKLDIDFPSYFNLNRLIAQMVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLTTYAPVISAEKAYHEQLSVAEITNACFEPSNQMVKCDPRNGKYMACCLLYRGDIVPKDVNTAIAIIKSRRAVRFVDWCPTG 355          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 420.239 bits (1079), Expect = 9.711e-147
Identity = 188/265 (70.94%), Postives = 233/265 (87.92%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQAAE 881
            + SD VVEPYNATLS+HQLVE+ DET+CIDNEALYDIC RTLKL  P+YGDLN+LVS+ MSGVTT LR+PGQLN+DLRKLA N++PFPRLHFFM G++PLT+  SQ +R  +V +LTQQMFD KNMMAA DPR+G+YLTVAA FRG++S+KEV+++M  VQ+KNS YFVEWIPNNV+TAVC + P+GL M+ TFI N+T+IQE+FKRV +QFSAMF+R+AFLHWYT EGMDE+EF+EAESN+NDL+SEYQQ+Q+ATV+D+ +  E
Sbjct:  174 KTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSEYQQYQEATVEDDEEVDE 438          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 222.631 bits (566), Expect = 1.189e-69
Identity = 104/263 (39.54%), Postives = 156/263 (59.32%), Query Frame = 3
Query:   69 ADYDLFQVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRG--------LKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEY 833
            A Y   QVS  VVEPYN  L+ H  +E+ D T+ +DNEA+YD+C R L +  P++ +LN+L++  +S VT  LRF G LN DL +  TN++P+PR+HF +  +SP+ S+    +   SV ++T   F+  N M  CDPR GKY+    ++RG +  ++V   +  V+NK +   V+W P   K  +C  PP          +  +V  + N T+I E +KR+  +F  M+ +RAF+HWY GEGM+E EFTEA  +L  L  +Y
Sbjct:  171 AVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDY 433          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 219.935 bits (559), Expect = 9.894e-69
Identity = 103/263 (39.16%), Postives = 156/263 (59.32%), Query Frame = 3
Query:   69 ADYDLFQVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMS--------VTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEY 833
            A Y   Q+S  VVEPYN  L+ H  +E+ D T+ +DNEA+YDIC R L ++ P++ +LN L++  +S VT  LRF G LN DL +  TN++P+PR+HF +  ++P+ S+    +   SV ++T   F+  N M  CDP  GKY+    ++RG +  ++V   +  V+NK +   V+W P   K  +C  PP  +  S        V  + N TAI + +KR+ ++F  M+ +RAF+HWY GEGM+E EFTEA  +L  L  +Y
Sbjct:  171 AVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDY 433          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 102.834 bits (255), Expect = 6.277e-25
Identity = 74/305 (24.26%), Postives = 136/305 (44.59%), Query Frame = 3
Query:   36 SICRPYRPYNVADYDLF--QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQ---PYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNV------KTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWY-TGEGMDEM-----EFTEAESNLNDLISEY------QQFQDATVDDEIQAAE 881
            ++C  Y    +  Y +F  + S+VVV+ YN  L++ +L+E+ D T   DN +L +I  +  +  +      N L+S  +S VT  +RFP  + + +  + + +IP P LHF  P F+P TS +      ++ +S  D+   + D  N + +    +  Y  V     G +  +++   M  +Q +    F  W  + +      ++    + P   ++S   + N + +  +F+  C  F  +F + AFL+ Y  G+    M     EF E+   +  L+ +Y          D  VDDE    E
Sbjct:  157 ALCDRYPKKILTTYSVFPARSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHTNQLISTIISSVTNSIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYNTIIGNVEPRQISRAMTKLQQR--IKFPSWSSSAMHVNIGRRSPYLPLQPNENEVSGMMLSNMSTVVNVFENACNTFDKVFAKGAFLNNYNVGDLFQSMQNVQDEFAESREVVQSLMEDYVAAEQDSYLDDVLVDDENMVGE 459          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO36734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHY4])

HSP 1 Score: 494.967 bits (1273), Expect = 2.508e-177
Identity = 227/256 (88.67%), Postives = 244/256 (95.31%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAAMFRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT
Sbjct:   84 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 339          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO35958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJX9])

HSP 1 Score: 494.197 bits (1271), Expect = 1.187e-175
Identity = 227/256 (88.67%), Postives = 244/256 (95.31%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAAMFRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO39945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8I3])

HSP 1 Score: 493.426 bits (1269), Expect = 2.165e-175
Identity = 227/257 (88.33%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAAMFRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO35959 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJY0])

HSP 1 Score: 485.723 bits (1249), Expect = 1.430e-174
Identity = 224/256 (87.50%), Postives = 241/256 (94.14%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAAMFRGRMSMKEV EQMLNVQNKNS+YFVEWIPNNVKTAVCDIPP  LKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT
Sbjct:   28 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVFEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPLVLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 283          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO42890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S027])

HSP 1 Score: 486.108 bits (1250), Expect = 1.691e-172
Identity = 224/256 (87.50%), Postives = 242/256 (94.53%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDAT 854
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRL FFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDP HG+YLTVAAMFRGRMSMKE+DEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT
Sbjct:  170 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLPFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPLHGRYLTVAAMFRGRMSMKELDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 425          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tubb2 (tubulin beta-2B chain [Source:NCBI gene;Acc:101162245])

HSP 1 Score: 489.574 bits (1259), Expect = 2.510e-173
Identity = 224/257 (87.16%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DET+CIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  SV +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSM+EVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+F+R+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALSVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFRRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tubb5 (tubulin beta chain [Source:NCBI gene;Acc:101157969])

HSP 1 Score: 487.649 bits (1254), Expect = 1.388e-172
Identity = 223/254 (87.80%), Postives = 243/254 (95.67%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQD 848
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQ+FD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKM+VTFIGN+TAIQE+FKR+ EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QD
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 427          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000045809.1 (tubulin beta-6 chain [Source:NCBI gene;Acc:101166121])

HSP 1 Score: 456.062 bits (1172), Expect = 9.623e-160
Identity = 207/258 (80.23%), Postives = 232/258 (89.92%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVD 860
            +VSD VVEPYNATLS+HQL+EN D T+CIDNEALYDIC RTLKLT+PTYGDLNHLV  TMSGVTT LRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLT+R SQ YR  +V +LTQQMFD +NMM ACDPR G+YLTVA +FRG+MS KEVDEQML +Q KNS YFV+WIP+NVK AVCDIPP+GL+M+ TFIGNNTAIQEIF+RV EQFS MFRR+AFLHWYTGEGMDEMEFTEAESNLNDL+SEYQQ+Q+AT D
Sbjct:  174 KVSDTVVEPYNATLSVHQLLENADATFCIDNEALYDICFRTLKLTTPTYGDLNHLVCMTMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDARNMMTACDPRRGRYLTVAGIFRGKMSTKEVDEQMLAIQQKNSTYFVDWIPHNVKVAVCDIPPKGLRMASTFIGNNTAIQEIFRRVGEQFSLMFRRKAFLHWYTGEGMDEMEFTEAESNLNDLVSEYQQYQEATAD 431          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000020157.2 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:101166346])

HSP 1 Score: 224.557 bits (571), Expect = 6.520e-70
Identity = 106/274 (38.69%), Postives = 160/274 (58.39%), Query Frame = 3
Query:   69 ADYDLFQVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPP--------RGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDE 866
            A Y   QVS  VVEPYN+ L+ H  +E+ D  + +DNEA+YDIC R L +  PTY +LN L+   +S +T  LRF G LN DL +  TN++P+PR+HF +  ++P+ S     +   SV D+T   F+  N M  CDPRHGKY+    ++RG +  K+V+  +  ++ K +  FV+W P   K  +   PP          ++ +V  + N TAI E + R+  +F  M+ +RAF+HWY GEGM+E EF+EA  +L  L  +Y++     V+D+
Sbjct:  135 AIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNTCFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDNVEDD 408          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000028969.1 (tubulin alpha-1C chain-like [Source:NCBI gene;Acc:101160296])

HSP 1 Score: 224.557 bits (571), Expect = 1.429e-69
Identity = 105/277 (37.91%), Postives = 163/277 (58.84%), Query Frame = 3
Query:   75 YDLFQVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPR--------GLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQAAE 881
            Y   QVS  VVEPYN+ L+ H  +E+ D  + +DNEA+YDIC R L +  P+Y +LN L+S  +S +T  LRF G LN DL +  TN++P+PR+HF +  ++P+ S     +   SV ++T   F+  N M  CDPRHGKY+    ++RG +  K+V+  +  ++ K S  FV+W P   K  +   PP          ++ +V  + N TAI E + R+  +F  M+ +RAF+HWY GEGM+E EF+EA  ++  L  +Y++    +++DE +  E
Sbjct:  172 YPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSLEDEDEGEE 448          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000048308.1 (SMESG000048308.1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 265/266 (99.62%), Postives = 266/266 (100.00%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQAAEA 884
            +VSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQAAEA
Sbjct:  174 KVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDEIQAAEA 439          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000062548.1 (SMESG000062548.1)

HSP 1 Score: 501.516 bits (1290), Expect = 6.836e-179
Identity = 229/260 (88.08%), Postives = 251/260 (96.54%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDDE 866
            +VSDVVVEPYNATL+IHQLVE  DET+ IDNEALYDIC RTLKL++PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKL TN+IPFPRLHFF+PGF+PLTSRHSQPYR YSV DLTQQMFDCKN+MAACDPRHGKYLTVAAMFRGR+S+KEVDE+MLNVQNKNSAYFVEWIP+NVKTAVCDIPPRG+KM+VTFIGNNTAIQEIFKR+ EQ++AM+RR+AFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQD T+D+E
Sbjct:  143 KVSDVVVEPYNATLAIHQLVEMADETFTIDNEALYDICFRTLKLSNPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRHSQPYRTYSVHDLTQQMFDCKNLMAACDPRHGKYLTVAAMFRGRLSVKEVDEEMLNVQNKNSAYFVEWIPSNVKTAVCDIPPRGMKMAVTFIGNNTAIQEIFKRIAEQYAAMYRRKAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDTTIDEE 402          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000074579.1 (SMESG000074579.1)

HSP 1 Score: 493.041 bits (1268), Expect = 8.016e-175
Identity = 226/257 (87.94%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFF+PGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAAMFRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNN KTAVCDIPPRGLKMSVTFIGN+T+IQE+FKRV EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNAKTAVCDIPPRGLKMSVTFIGNSTSIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000074423.1 (SMESG000074423.1)

HSP 1 Score: 493.041 bits (1268), Expect = 8.016e-175
Identity = 226/257 (87.94%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DETYCIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFF+PGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAAMFRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNN KTAVCDIPPRGLKMSVTFIGN+T+IQE+FKRV EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNAKTAVCDIPPRGLKMSVTFIGNSTSIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000035755.1 (SMESG000035755.1)

HSP 1 Score: 491.886 bits (1265), Expect = 1.679e-174
Identity = 226/257 (87.94%), Postives = 244/257 (94.94%), Query Frame = 3
Query:   87 QVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 857
            +VSD VVEPYNATLS+HQLVEN DET+CIDNEALYDIC RTLKLT+PTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA NM+PFPRLHFFMPGF+PLTSR SQ YR  +V +LTQQMFD KNMMAACDPRHG+YLTVAA+FRGRMSMKEVDEQMLNVQNKNS+YFVEWIPNNVKTAVCDIPPRGLKMS TFIGN+TAIQE+FKRV EQF+AMFRR+AFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QDAT 
Sbjct:  174 KVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAALFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
The following BLAST results are available for this feature:
BLAST of Tubulin beta chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBB8.090e-17587.89tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB8.090e-17587.89tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB8.090e-17587.89tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB8.090e-17587.89tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB8.090e-17587.89tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbb-43.195e-17486.15Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.281e-17383.65Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.281e-17383.65Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.281e-17383.65Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.281e-17383.65Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
betaTub56D2.319e-17387.11gene:FBgn0284243 transcript:FBtr0086536[more]
betaTub56D1.088e-17287.11gene:FBgn0284243 transcript:FBtr0086537[more]
betaTub60D2.183e-17286.15gene:FBgn0003888 transcript:FBtr0072270[more]
betaTub60D2.485e-17286.15gene:FBgn0003888 transcript:FBtr0343443[more]
betaTub85D2.649e-17286.77gene:FBgn0003889 transcript:FBtr0082046[more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:658949.783e-17588.67zgc:65894 [Source:ZFIN;Acc:ZDB-GENE-030131-7741][more]
zgc:1534262.103e-17487.94zgc:153426 [Source:ZFIN;Acc:ZDB-GENE-060929-220][more]
tubb4b5.052e-17487.55tubulin, beta 4B class IVb [Source:ZFIN;Acc:ZDB-GE... [more]
zgc:554615.200e-17487.55zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
zgc:554615.278e-17487.55zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reps23.357e-17587.94RALBP1 associated Eps domain containing 2 [Source:... [more]
reps22.439e-17487.94RALBP1 associated Eps domain containing 2 [Source:... [more]
znf3303.102e-17487.94zinc finger protein 330 [Source:Xenbase;Acc:XB-GEN... [more]
tubb8.282e-17487.89tubulin beta class I [Source:NCBI gene;Acc:448742][more]
ubxn113.121e-17287.80UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tubb2b2.861e-17487.94tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:... [more]
Tubb56.273e-17487.89tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI... [more]
Tubb2a2.719e-17387.55tubulin, beta 2A class IIA [Source:MGI Symbol;Acc:... [more]
Tubb4b7.038e-17388.19tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:... [more]
Tubb4a5.688e-17187.01tubulin, beta 4A class IVA [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P18700|TBB_STRPU1.093e-17687.94Tubulin beta chain (Fragment) OS=Strongylocentrotu... [more]
sp|P30883|TBB4_XENLA9.619e-17487.94Tubulin beta-4 chain OS=Xenopus laevis OX=8355 GN=... [more]
sp|P11833|TBB_PARLI1.054e-17387.94Tubulin beta chain OS=Paracentrotus lividus OX=765... [more]
sp|P13602|TBB2_XENLA1.105e-17387.60Tubulin beta-2 chain OS=Xenopus laevis OX=8355 GN=... [more]
sp|P02554|TBB_PIG1.306e-17387.94Tubulin beta chain OS=Sus scrofa OX=9823 PE=1 SV=1[more]
back to top
BLAST of Tubulin beta chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0QYI00.000e+093.89Tubulin beta chain OS=Fasciola hepatica OX=6192 GN... [more]
A0A4S2LW100.000e+091.98Tubulin beta chain OS=Opisthorchis felineus OX=147... [more]
A0A419PIP40.000e+091.98Tubulin beta chain OS=Clonorchis sinensis OX=79923... [more]
H2KQS10.000e+091.98Tubulin beta chain (Fragment) OS=Clonorchis sinens... [more]
A0A5J4P2B80.000e+092.37Tubulin beta chain OS=Paragonimus westermani OX=34... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000019550.23.879e-17487.80pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
zgc:554614.376e-17487.55tubulin beta-4B chain [Source:NCBI gene;Acc:103024... [more]
TUBB2A7.305e-17386.49tubulin beta-2A chain [Source:NCBI gene;Acc:103041... [more]
TUBB13.117e-16382.81tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HG... [more]
ENSAMXT00000019223.21.968e-6939.48tubulin alpha-1 chain [Source:NCBI gene;Acc:103031... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb22.794e-14687.67tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
TUBA3C2.431e-4740.33tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000001368.18.520e-4532.72pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-... [more]
tubg11.742e-4432.69tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
ENSPMAT00000001139.11.789e-4438.55pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB29.711e-14770.94Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB11.189e-6939.54Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB39.894e-6939.16Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB46.277e-2524.26Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367342.508e-17788.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359581.187e-17588.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399452.165e-17588.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359591.430e-17487.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428901.691e-17287.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb22.510e-17387.16tubulin beta-2B chain [Source:NCBI gene;Acc:101162... [more]
tubb51.388e-17287.80tubulin beta chain [Source:NCBI gene;Acc:101157969... [more]
ENSORLT00000045809.19.623e-16080.23tubulin beta-6 chain [Source:NCBI gene;Acc:1011661... [more]
ENSORLT00000020157.26.520e-7038.69tubulin alpha-1A chain-like [Source:NCBI gene;Acc:... [more]
ENSORLT00000028969.11.429e-6937.91tubulin alpha-1C chain-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tubulin beta chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048308.10.000e+099.62SMESG000048308.1[more]
SMESG000062548.16.836e-17988.08SMESG000062548.1[more]
SMESG000074579.18.016e-17587.94SMESG000074579.1[more]
SMESG000074423.18.016e-17587.94SMESG000074423.1[more]
SMESG000035755.11.679e-17487.94SMESG000035755.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028840 ID=SMED30028840|Name=Tubulin beta chain|organism=Schmidtea mediterranea sexual|type=transcript|length=1021bp
CCTAAATATCATATCTTCAAATCATTAACGCCATCAGCATTTGTCGCCCA
TATCGTCCTTATAACGTTGCTGATTATGATTTATTTCAGGTGTCTGATGT
CGTTGTTGAACCTTATAATGCAACTTTATCAATCCATCAATTGGTTGAAA
ATTGTGATGAAACCTACTGTATTGATAATGAAGCTCTTTATGATATATGT
AATCGAACTTTGAAGTTGACAAGTCCAACATATGGAGATCTTAATCATTT
GGTTAGTGCTACAATGTCCGGTGTTACTACTTGTTTAAGATTCCCGGGTC
AATTGAATGCAGATTTACGGAAGTTAGCTACAAATATGATTCCATTTCCA
CGACTTCATTTCTTTATGCCTGGTTTCTCACCGTTAACAAGCCGACATTC
TCAACCATACCGATGTTATTCAGTTCAAGATCTCACTCAACAAATGTTCG
ATTGTAAAAACATGATGGCTGCGTGCGATCCTCGACATGGGAAATATCTA
ACAGTTGCGGCAATGTTCCGTGGTCGAATGTCAATGAAAGAAGTCGACGA
GCAAATGCTAAATGTACAAAACAAAAATAGTGCGTATTTTGTCGAATGGA
TTCCCAACAATGTCAAAACTGCAGTTTGTGACATTCCTCCGAGAGGGTTG
AAAATGTCTGTAACATTCATTGGAAACAATACTGCAATACAGGAAATATT
CAAAAGGGTTTGCGAACAGTTTTCGGCTATGTTCAGGAGACGTGCTTTCT
TGCATTGGTATACGGGTGAAGGCATGGATGAAATGGAGTTCACGGAAGCT
GAGTCCAATCTCAATGATTTAATAAGTGAATATCAACAATTTCAAGACGC
CACGGTCGACGACGAGATTCAAGCCGCCGAAGCTTAATTTTATGAATGAT
TTTGATGGATCTTTTTATTTTTAAAAATCTCATTTATTGTGAGAATGTAT
GTATAAAATATGCTACTTATGGTAGTGATAACTAAATTTCATCTATAATA
TTATTTTTACGTAAAATGAAT
back to top

protein sequence of SMED30028840-orf-1

>SMED30028840-orf-1 ID=SMED30028840-orf-1|Name=SMED30028840-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=208bp
MSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYR
CYSVQDLTQQMFDCKNMMAACDPRHGKYLTVAAMFRGRMSMKEVDEQMLN
VQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVC
EQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATVDD
EIQAAEA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036525Tubulin/FtsZ_GTPase_sf
IPR037103Tubulin/FtsZ_C_sf
IPR000217Tubulin
IPR002453Beta_tubulin
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR003008Tubulin_FtsZ_GTPase
IPR023123Tubulin_C
IPR008280Tub_FtsZ_C
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
Vocabulary: molecular function
TermDefinition
GO:0005200structural constituent of cytoskeleton
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 176..196
NoneNo IPR availablePANTHERPTHR11588:SF293TUBULIN BETA CHAIN-RELATEDcoord: 1..204
NoneNo IPR availableCDDcd02187beta_tubulincoord: 1..194
e-value: 4.60727E-148
score: 416.197
IPR002453Beta tubulinPRINTSPR01163BETATUBULINcoord: 115..138
score: 81.05
coord: 97..111
score: 84.42
coord: 180..198
score: 75.16
coord: 145..156
score: 67.38
coord: 13..26
score: 80.41
coord: 33..49
score: 70.59
coord: 79..97
score: 80.27
IPR018316Tubulin/FtsZ, 2-layer sandwich domainSMARTSM00865Tubulin_C_4coord: 14..151
e-value: 4.9E-45
score: 165.6
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 29..150
e-value: 4.9E-44
score: 149.5
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..31
e-value: 3.1E-8
score: 35.3
IPR037103Tubulin/FtsZ, C-terminal domain superfamilyGENE3DG3DSA:3.30.1330.20coord: 32..141
e-value: 2.6E-56
score: 190.6
IPR023123Tubulin, C-terminalGENE3DG3DSA:1.10.287.600coord: 142..198
e-value: 8.1E-34
score: 117.2
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 1..204
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 12..197