Protocadherin-1 isoform 2

Overview
NameProtocadherin-1 isoform 2
Smed IDSMED30028833
Length (bp)3278
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-1 isoform 2 (SMED30028833) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-1 isoform 2 (SMED30028833) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-1 isoform 2 (SMED30028833) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-1 isoform 2 (SMED30028833) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028833

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30028833SMESG000008875.1 SmedASXL_015944SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30028833SMESG000008875.1 dd_Smed_v4_16566_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028833SMESG000008875.1 dd_Smed_v4_16566_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30028833SMESG000008875.1 dd_Smed_v6_16566_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30028833SMESG000008875.1 OX_Smed_1.0.08097ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Human
Match: PCDHGA7 (protocadherin gamma subfamily A, 7 [Source:HGNC Symbol;Acc:HGNC:8705])

HSP 1 Score: 224.942 bits (572), Expect = 2.846e-62
Identity = 172/518 (33.20%), Postives = 260/518 (50.19%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD-----AGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI---------LTVLENEPIGTLIGNVEVFDLDDGENARVT-IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  L  A D D   N + +Y LS N  + F L+++ G     YPEL++   L+ E   ER  HL LTA D G   +  T  + +T +D ND+ P+F+   Y+ TV EN      +L V A DLDEG NG+++Y F  +TP+ +   F LN LTGEI  L+ LDYE       E  ++A D   P      K+ I   D+NDN+P + +   + SIPE+  + T I   Y+ D DS  N +V C    N  F+L  S +N   +   +  D E  S++ I ++  D G PP++    +F+ + D NDN P F  + +   I+E++     +F  +A D DS +  +ITY L +     A    +V IN  TG +Y   S D E    L+  V A D G   L +++ +S+ V+D NDNPP +  P +         L     EP G L+  V   D D G+NA ++ +  +  E  LF   L     +   ++L+DR+ + Q  L + + DHG+P L++
Sbjct:  151 RFPLSEAGDPDVGTNSLQSYQLSPN--RHFSLAVQSGDDETKYPELVLERVLDREE--ERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPK-LPKMFHLNSLTGEISTLEGLDYE--ETAFYEMEVQAQD--GPGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIPENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYSVYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQSFDYEQLRELQLRVTAHDSGDPPLSSNMSLSLFVLDQNDNPPEILYPALPTDGSTGMELAPRSAEP-GYLVTKVVAVDKDSGQNAWLSYLLLKASEPGLFAVGLYTGEVRT-ARALLDRDALKQ-SLVVAVQDHGQPPLSA 656          

HSP 2 Score: 36.1946 bits (82), Expect = 2.846e-62
Identity = 37/124 (29.84%), Postives = 55/124 (44.35%), Query Frame = 3
Query:  189 KSTNVGNIFKMLNYQ---LFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKD---ICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            K + VG+I K L  +   L      II    T     + F L  +SG ++T   IDR   EEIC   + C  +   + E + N             + I+ EIID NDN P+F   + N+ ++E
Sbjct:   41 KGSFVGDIAKDLGLEPRELAERGVRIISRGRT-----QLFALNQRSGSLVTAGRIDR---EEICAQSARCLVNFNILMEDKMNL------------YPIDVEIIDINDNVPRFLTEEINVKIME 144          

HSP 3 Score: 133.65 bits (335), Expect = 3.351e-31
Identity = 134/462 (29.00%), Postives = 207/462 (44.81%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI---EILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNS-NDNFRLHSSQENSLTIY----MERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY---RLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDD----CNGSRYFQVNETSGAIYSTWS 2287
            F+LN+ +G +    ++D E    Q    L+ F I   D+          I++   DINDN PR    EI  NV I EN             D D   N ++  + S N +F L     +  T Y    +ER  D E   +H + +   D G PP ++   + + ++D ND+ P+F+  Q+   + E+  V   L    A DLD G  G++TY   ++     K F +N  TG I     LD E     E  V A DG G     KV ITV+D+NDN P +    +  ++ E+ P+GT+I    + D D G+N  VT    + EN  F     +DN  ++     +DRE +S   + LK  D G P L+    I + + D NDN P   + S          +Y+  N    + I  + A+D D ++N +I + + +D       S Y  +N  +G +Y+  S
Sbjct:   75 FALNQRSGSLVTAGRIDREEICAQSARCLVNFNILMEDK-----MNLYPIDVEIIDINDNVPRFLTEEI--NVKIMENTAPGVRFPLSEAGDPDVGTNSLQSYQLSPNRHFSLAVQSGDDETKYPELVLERVLDREEERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPKLPKMFHLNSLTGEISTLEGLDYEETAFYEMEVQAQDGPGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTC--TIPENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYS--------VYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQS 519          

HSP 4 Score: 120.553 bits (301), Expect = 5.150e-27
Identity = 124/441 (28.12%), Postives = 201/441 (45.58%), Query Frame = 2
Query:  782 ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTG-------EIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHD-DDSVHNKV-----KCNKNSNDNFRLHSSQENSLT--IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIY---LYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLK-SPKILTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSL--IDREKVSQIFLRLKLVDHGRPKLTS 2026
            +  ID NDN P F        + ENT   +     +A D D G N   SY+   L+P   N  FSL   +G       E+ L + LD E   +++    + A D G P  S +  I++   D+ND++P   + +  V++PEN  + T +++++  D D+ V+ +V     K        F L     NSLT  I      DYE ++ ++++++  D   P   T   + I ++D NDN P  T       I ED+ +   +      D DSG  G++T  + +  N  F +  S    Y      +LDRE   +    + ATDGG   L     + + V D NDNPP    S   + + EN P G  I  V   D D  +NA++T  +  +  + A   SY+ ++++   + +L   D E++ ++ LR+   D G P L+S
Sbjct:  121 VEIIDINDNVPRFLTEEINVKIMENTAPGVRFPLSEAGDPDVGTNSLQSYQ---LSP---NRHFSLAVQSGDDETKYPELVLERVLDRE--EERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPKLPKMFHL-----NSLTGEISTLEGLDYEETAFYEMEVQAQDG--PGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIPE--NLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYSVYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQSFDYEQLRELQLRVTAHDSGDPPLSS 544          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Human
Match: PCDHGA7 (protocadherin gamma subfamily A, 7 [Source:HGNC Symbol;Acc:HGNC:8705])

HSP 1 Score: 224.942 bits (572), Expect = 3.646e-62
Identity = 172/518 (33.20%), Postives = 260/518 (50.19%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD-----AGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI---------LTVLENEPIGTLIGNVEVFDLDDGENARVT-IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  L  A D D   N + +Y LS N  + F L+++ G     YPEL++   L+ E   ER  HL LTA D G   +  T  + +T +D ND+ P+F+   Y+ TV EN      +L V A DLDEG NG+++Y F  +TP+ +   F LN LTGEI  L+ LDYE       E  ++A D   P      K+ I   D+NDN+P + +   + SIPE+  + T I   Y+ D DS  N +V C    N  F+L  S +N   +   +  D E  S++ I ++  D G PP++    +F+ + D NDN P F  + +   I+E++     +F  +A D DS +  +ITY L +     A    +V IN  TG +Y   S D E    L+  V A D G   L +++ +S+ V+D NDNPP +  P +         L     EP G L+  V   D D G+NA ++ +  +  E  LF   L     +   ++L+DR+ + Q  L + + DHG+P L++
Sbjct:  151 RFPLSEAGDPDVGTNSLQSYQLSPN--RHFSLAVQSGDDETKYPELVLERVLDREE--ERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPK-LPKMFHLNSLTGEISTLEGLDYE--ETAFYEMEVQAQD--GPGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIPENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYSVYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQSFDYEQLRELQLRVTAHDSGDPPLSSNMSLSLFVLDQNDNPPEILYPALPTDGSTGMELAPRSAEP-GYLVTKVVAVDKDSGQNAWLSYLLLKASEPGLFAVGLYTGEVRT-ARALLDRDALKQ-SLVVAVQDHGQPPLSA 656          

HSP 2 Score: 36.1946 bits (82), Expect = 3.646e-62
Identity = 37/124 (29.84%), Postives = 55/124 (44.35%), Query Frame = 3
Query:  189 KSTNVGNIFKMLNYQ---LFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKD---ICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            K + VG+I K L  +   L      II    T     + F L  +SG ++T   IDR   EEIC   + C  +   + E + N             + I+ EIID NDN P+F   + N+ ++E
Sbjct:   41 KGSFVGDIAKDLGLEPRELAERGVRIISRGRT-----QLFALNQRSGSLVTAGRIDR---EEICAQSARCLVNFNILMEDKMNL------------YPIDVEIIDINDNVPRFLTEEINVKIME 144          

HSP 3 Score: 133.265 bits (334), Expect = 6.489e-31
Identity = 134/462 (29.00%), Postives = 207/462 (44.81%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI---EILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNS-NDNFRLHSSQENSLTIY----MERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY---RLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDD----CNGSRYFQVNETSGAIYSTWS 2287
            F+LN+ +G +    ++D E    Q    L+ F I   D+          I++   DINDN PR    EI  NV I EN             D D   N ++  + S N +F L     +  T Y    +ER  D E   +H + +   D G PP ++   + + ++D ND+ P+F+  Q+   + E+  V   L    A DLD G  G++TY   ++     K F +N  TG I     LD E     E  V A DG G     KV ITV+D+NDN P +    +  ++ E+ P+GT+I    + D D G+N  VT    + EN  F     +DN  ++     +DRE +S   + LK  D G P L+    I + + D NDN P   + S          +Y+  N    + I  + A+D D ++N +I + + +D       S Y  +N  +G +Y+  S
Sbjct:   75 FALNQRSGSLVTAGRIDREEICAQSARCLVNFNILMEDK-----MNLYPIDVEIIDINDNVPRFLTEEI--NVKIMENTAPGVRFPLSEAGDPDVGTNSLQSYQLSPNRHFSLAVQSGDDETKYPELVLERVLDREEERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPKLPKMFHLNSLTGEISTLEGLDYEETAFYEMEVQAQDGPGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTC--TIPENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYS--------VYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQS 519          

HSP 4 Score: 120.553 bits (301), Expect = 5.331e-27
Identity = 124/441 (28.12%), Postives = 201/441 (45.58%), Query Frame = 2
Query:  782 ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTG-------EIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHD-DDSVHNKV-----KCNKNSNDNFRLHSSQENSLT--IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIY---LYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLK-SPKILTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSL--IDREKVSQIFLRLKLVDHGRPKLTS 2026
            +  ID NDN P F        + ENT   +     +A D D G N   SY+   L+P   N  FSL   +G       E+ L + LD E   +++    + A D G P  S +  I++   D+ND++P   + +  V++PEN  + T +++++  D D+ V+ +V     K        F L     NSLT  I      DYE ++ ++++++  D   P   T   + I ++D NDN P  T       I ED+ +   +      D DSG  G++T  + +  N  F +  S    Y      +LDRE   +    + ATDGG   L     + + V D NDNPP    S   + + EN P G  I  V   D D  +NA++T  +  +  + A   SY+ ++++   + +L   D E++ ++ LR+   D G P L+S
Sbjct:  121 VEIIDINDNVPRFLTEEINVKIMENTAPGVRFPLSEAGDPDVGTNSLQSYQ---LSP---NRHFSLAVQSGDDETKYPELVLERVLDRE--EERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPKLPKMFHL-----NSLTGEISTLEGLDYEETAFYEMEVQAQDG--PGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIPE--NLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYSVYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQSFDYEQLRELQLRVTAHDSGDPPLSS 544          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Human
Match: PCDHGA4 (protocadherin gamma subfamily A, 4 [Source:HGNC Symbol;Acc:HGNC:8702])

HSP 1 Score: 216.468 bits (550), Expect = 3.512e-60
Identity = 172/519 (33.14%), Postives = 253/519 (48.75%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGGQFE--TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK-VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD-----AGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKIL----TVLENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLV--DHGRPKLTS 2026
            R  LP A+D D  +N +  Y L+ N   +F L ++ G     YPEL++  AL+ E   E   HL LTAFD G      T  + I  +D NDN P+FT   Y  +V+EN      +L V+A D DEG NG ++Y F  +   +I+  F LN L+G+I +L  LDYE       +  +EA D   P L    K+ +   D NDN+P + +     S+ E+    T I    VHD DS  N  V C+   N  F L  +  N   +   RT D E  S + I +   D G PP++T   + + ++D NDN P F  A +   I E++     +   +A D DSG+  +ITY L +     A    +V IN +TG +Y   S D E    L+  + A+D G   L ++V +S+ V+D NDN P +  P       T +E  P     G L+  V   D D G+NA ++    +  E  LF   L     +   ++L+DR+ + Q   RL +V  DHG+P L++
Sbjct:  182 RFPLPEAFDPDVGVNSLQGYQLNSN--GYFSLDVQSGADGIKYPELVLERALDREE--EAVHHLVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKATDPDEGANGDVTYSFRKVR-DKISQLFQLNSLSGDITILGGLDYE--DSGFYDIDVEAHD--GPGLRARSKVLVTVLDENDNAPEVTVTSLTSSVQESSSPGTVIALFNVHDSDSGGNGLVTCSIPDNLPFTLEKTYGNYYRLLTHRTLDREEVSEYNITVTATDQGTPPLSTETHISLQVMDINDNPPTFPHASYSAYIPENNPRGASILSMTAQDPDSGDNARITYSLAEDTFQGAPLSSYVSINSNTGILYALCSFDYEQFRDLQLLMTASDSGDPPLSSNVSLSLFVLDQNDNVPEILYPTFPTDGSTGVELAPRSADSGYLVTKVVAVDRDSGQNAWLSYSLLKSSEPGLFAVGLHTGEVRT-ARALLDRDALKQ---RLVVVVQDHGQPPLSA 687          

HSP 2 Score: 37.7354 bits (86), Expect = 3.512e-60
Identity = 37/119 (31.09%), Postives = 51/119 (42.86%), Query Frame = 3
Query:  201 VGNIFKMLNY---QLFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQ 545
            VGNI K L     +L      I+    T     + F L  +SG ++T   IDR   EE+C     C  ++       IL   + K     ++  EIID NDNPP F   +  I V E +
Sbjct:   76 VGNIAKDLGLAPRELAERGVRIVSRGRT-----QLFALNPRSGTLVTAGRIDR---EELCDRSPNCVTNL------EILLEDTVK---ILRVEVEIIDVNDNPPSFGTEQREIKVAENE 177          

HSP 3 Score: 134.035 bits (336), Expect = 4.106e-31
Identity = 131/471 (27.81%), Postives = 218/471 (46.28%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----------LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNK-NSNDNFRLH-SSQENSLT---IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY---RLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKIL-TVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNN--KIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDC-NG---SRYFQVNETSGAIYSTWSCRNGQF 2305
            F+LN  +G +    ++D E   D+          L+E T++ +           ++E+   D+NDN P      + + + EN+            D D   N ++  + NSN  F L   S  + +    + +ER  D E  ++H + +  FD G P  +    + I ++D NDN P+FT+ ++   + E+  V   L    ATD D G  G +TY   ++ D  ++ F +N  +G I +   LD E     +  V A DG GL A  KV +TV+D NDN P +    +  +V E+   GT+I    V D D G N  VT    + +N L ++  K   N  ++     +DRE+VS+  + +   D G P L++   I++ ++DINDN P   + S        + I  N    + IL++ A+D D  +N +I + + +D   G   S Y  +N  +G +Y+  S    QF
Sbjct:  106 FALNPRSGTLVTAGRIDREELCDRSPNCVTNLEILLEDTVKIL-----------RVEVEIIDVNDNPPSFGTEQREIKVAENENPGARFPLPEAFDPDVGVNSLQGYQLNSNGYFSLDVQSGADGIKYPELVLERALDREEEAVHHLVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKATDPDEGANGDVTYSFRKVRDKISQLFQLNSLSGDITILGGLDYEDSGFYDIDVEAHDGPGLRARSKVLVTVLDENDNAPEVTVTSLTSSVQESSSPGTVIALFNVHDSDSGGNGLVTC--SIPDN-LPFTLEKTYGNYYRLLTHRTLDREEVSEYNITVTATDQGTPPLSTETHISLQVMDINDNPPTFPHAS------YSAYIPENNPRGASILSMTAQDPDSGDNARITYSLAEDTFQGAPLSSYVSINSNTGILYALCSFDYEQF 556          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Human
Match: PCDHGA4 (protocadherin gamma subfamily A, 4 [Source:HGNC Symbol;Acc:HGNC:8702])

HSP 1 Score: 215.698 bits (548), Expect = 5.365e-60
Identity = 172/519 (33.14%), Postives = 253/519 (48.75%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGGQFE--TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK-VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD-----AGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKIL----TVLENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLV--DHGRPKLTS 2026
            R  LP A+D D  +N +  Y L+ N   +F L ++ G     YPEL++  AL+ E   E   HL LTAFD G      T  + I  +D NDN P+FT   Y  +V+EN      +L V+A D DEG NG ++Y F  +   +I+  F LN L+G+I +L  LDYE       +  +EA D   P L    K+ +   D NDN+P + +     S+ E+    T I    VHD DS  N  V C+   N  F L  +  N   +   RT D E  S + I +   D G PP++T   + + ++D NDN P F  A +   I E++     +   +A D DSG+  +ITY L +     A    +V IN +TG +Y   S D E    L+  + A+D G   L ++V +S+ V+D NDN P +  P       T +E  P     G L+  V   D D G+NA ++    +  E  LF   L     +   ++L+DR+ + Q   RL +V  DHG+P L++
Sbjct:  182 RFPLPEAFDPDVGVNSLQGYQLNSN--GYFSLDVQSGADGIKYPELVLERALDREE--EAVHHLVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKATDPDEGANGDVTYSFRKVR-DKISQLFQLNSLSGDITILGGLDYE--DSGFYDIDVEAHD--GPGLRARSKVLVTVLDENDNAPEVTVTSLTSSVQESSSPGTVIALFNVHDSDSGGNGLVTCSIPDNLPFTLEKTYGNYYRLLTHRTLDREEVSEYNITVTATDQGTPPLSTETHISLQVMDINDNPPTFPHASYSAYIPENNPRGASILSMTAQDPDSGDNARITYSLAEDTFQGAPLSSYVSINSNTGILYALCSFDYEQFRDLQLLMTASDSGDPPLSSNVSLSLFVLDQNDNVPEILYPTFPTDGSTGVELAPRSADSGYLVTKVVAVDRDSGQNAWLSYSLLKSSEPGLFAVGLHTGEVRT-ARALLDRDALKQ---RLVVVVQDHGQPPLSA 687          

HSP 2 Score: 37.7354 bits (86), Expect = 5.365e-60
Identity = 37/119 (31.09%), Postives = 51/119 (42.86%), Query Frame = 3
Query:  201 VGNIFKMLNY---QLFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQ 545
            VGNI K L     +L      I+    T     + F L  +SG ++T   IDR   EE+C     C  ++       IL   + K     ++  EIID NDNPP F   +  I V E +
Sbjct:   76 VGNIAKDLGLAPRELAERGVRIVSRGRT-----QLFALNPRSGTLVTAGRIDR---EELCDRSPNCVTNL------EILLEDTVK---ILRVEVEIIDVNDNPPSFGTEQREIKVAENE 177          

HSP 3 Score: 133.265 bits (334), Expect = 5.429e-31
Identity = 131/471 (27.81%), Postives = 215/471 (45.65%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----------LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNK-NSNDNFRLHSSQENSLTIY----MERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY---RLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKIL-TVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNN--KIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDC-NG---SRYFQVNETSGAIYSTWSCRNGQF 2305
            F+LN  +G +    ++D E   D+          L+E T++ +           ++E+   D+NDN P      + + + EN+            D D   N ++  + NSN  F L          Y    +ER  D E  ++H + +  FD G P  +    + I ++D NDN P+FT+ ++   + E+  V   L    ATD D G  G +TY   ++ D  ++ F +N  +G I +   LD E     +  V A DG GL A  KV +TV+D NDN P +    +  +V E+   GT+I    V D D G N  VT    + +N L ++  K   N  ++     +DRE+VS+  + +   D G P L++   I++ ++DINDN P   + S        + I  N    + IL++ A+D D  +N +I + + +D   G   S Y  +N  +G +Y+  S    QF
Sbjct:  106 FALNPRSGTLVTAGRIDREELCDRSPNCVTNLEILLEDTVKIL-----------RVEVEIIDVNDNPPSFGTEQREIKVAENENPGARFPLPEAFDPDVGVNSLQGYQLNSNGYFSLDVQSGADGIKYPELVLERALDREEEAVHHLVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKATDPDEGANGDVTYSFRKVRDKISQLFQLNSLSGDITILGGLDYEDSGFYDIDVEAHDGPGLRARSKVLVTVLDENDNAPEVTVTSLTSSVQESSSPGTVIALFNVHDSDSGGNGLVTC--SIPDN-LPFTLEKTYGNYYRLLTHRTLDREEVSEYNITVTATDQGTPPLSTETHISLQVMDINDNPPTFPHASYS------AYIPENNPRGASILSMTAQDPDSGDNARITYSLAEDTFQGAPLSSYVSINSNTGILYALCSFDYEQF 556          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Human
Match: PCDHGA8 (protocadherin gamma subfamily A, 8 [Source:HGNC Symbol;Acc:HGNC:8706])

HSP 1 Score: 217.238 bits (552), Expect = 2.020e-59
Identity = 177/521 (33.97%), Postives = 258/521 (49.52%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK----FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYR-----LDDAGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKIL----TVLENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  LP A D D  +N + +Y LS NH   F L ++ G      PEL++  AL+ E   E   HL LTA D G   +  T+ + +T +D NDN P+F   +YR  V EN      +L V A D DEG NGK++Y+F     ++IN+K    F LN+ TGEI + + LDYE  S    E  I+A D G+  L G  K+ I   D+NDN P + I    S + EN    T I  + VHD DS  N +V C    N  F+L  S  N   +   +  D EN SI+ I +   D G PP++T   + + + D NDN P F  A +   I E++     +F  +A D DS    ++TY      L  A    ++ IN  TG +Y   S D E    L+  V A+D G   L +++ +S+ V+D NDN P +  P +     T +E  P     G L+  V   D D G+NA ++    +  E  LF   L     +   ++L+DR+ + Q  + + + DHG+P L++
Sbjct:  151 RYPLPEAVDPDVGVNSLQSYQLSPNHH--FSLDVQTGDNGAINPELVLERALDREE--EAAHHLVLTASDGGKPPRSSTVRIHVTVLDTNDNAPVFPHPIYRVKVLENMPPGTRLLTVTASDPDEGINGKVAYKF-----RKINEKQTPLFQLNENTGEISIAKSLDYEECS--FYEMEIQAEDVGA--LLGRTKLLISVEDVNDNRPEVIITSLFSPVLENSLPGTVIAFLSVHDQDSGKNGQVVCYTRDNLPFKLEKSIGNYYRLVTRKYLDRENVSIYNITVMASDLGTPPLSTETQIALHVADINDNPPTFPHASYSAYILENNLRGASIFSLTAHDPDSQENAQVTYSVTEDTLQGAPLSSYISINSDTGVLYALQSFDYEQIRDLQLLVTASDSGDPPLSSNMSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAERGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRT-ARALLDRDALKQSLV-VAVQDHGQPPLSA 656          

HSP 2 Score: 34.6538 bits (78), Expect = 2.020e-59
Identity = 37/117 (31.62%), Postives = 50/117 (42.74%), Query Frame = 3
Query:  180 NVPKSTN----VGNIFKMLNY---QLFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKF 506
            +VP+ T+    VGNI K L     +L      I+    T     + F L  +SG +IT   IDR   EE+C          C    N ++  +       F +  EIID NDN PKF
Sbjct:   34 SVPEETDKGSFVGNISKDLGLDPRKLAKHGVRIVSRGRT-----QLFALNPRSGSLITAGRIDR---EELC-----AQSPRCLININTLVEDKGKL----FGVEIEIIDINDNNPKF 133          

HSP 3 Score: 125.176 bits (313), Expect = 1.869e-28
Identity = 128/462 (27.71%), Postives = 210/462 (45.45%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI------LKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTI----YMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE---FVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILT-VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDC-NG---SRYFQVNETSGAIYSTWS 2287
            F+LN  +G +    ++D E    Q    LI       D+G  +L G   +EI   DINDN+P+ ++      +  +++P   R   P     V  D  V++      + N +F L     ++  I     +ER  D E  + H + +   D G PP ++   + + ++D NDN P+F    +  ++ E+      L   +A+D D G  GK+ Y+      K+   F +N +TG I +  SLD E     E  + A D G L    K+ I+V D+NDN P +    + + VLEN   GT+I  + V D D G+N +V      ++N  F     + N  ++  +  +DRE VS   + +   D G P L++   I + + DINDN P   + S        + I  N    + I +L A D D  EN ++ + + +D   G   S Y  +N  +G +Y+  S
Sbjct:   75 FALNPRSGSLITAGRIDREELCAQSPRCLININTLVEDKG--KLFG---VEIEIIDINDNNPKFQVEDLEVKINEIAVP-GARYPLPEA---VDPDVGVNSLQSYQLSPNHHFSLDVQTGDNGAINPELVLERALDREEEAAHHLVLTASDGGKPPRSSTVRIHVTVLDTNDNAPVFPHPIYRVKVLENMPPGTRLLTVTASDPDEGINGKVAYKFRKINEKQTPLFQLNENTGEISIAKSLDYEECSFYEMEIQAEDVGALLGRTKLLISVEDVNDNRPEVIITSLFSPVLENSLPGTVIAFLSVHDQDSGKNGQVVC--YTRDNLPFKLEKSIGNYYRLVTRKYLDRENVSIYNITVMASDLGTPPLSTETQIALHVADINDNPPTFPHAS------YSAYILENNLRGASIFSLTAHDPDSQENAQVTYSVTEDTLQGAPLSSYISINSDTGVLYALQS 519          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 159.073 bits (401), Expect = 6.676e-39
Identity = 138/495 (27.88%), Postives = 232/495 (46.87%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSE-NHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYVHDDDSVHNK-VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEM---LEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLD--NNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            A DLDS  NG   YSL E N K    ++ + G    +I +A   +        L + A D+G   +  T  + IT +D NDN P+F    Y  T+ EN T    I  V+A D D G NGK+ Y   ++         +++  TGE+ L +++D +   +  I   I A D   P LS +  + I+  DIND++P  I   K +++ EN  I   +  +Y  D+DS  N  +K +   +++F +    E+S  I   +  D E ++ + + +   D G P + T  ++ + + D NDN P F + ++   ISE+      +    A D D     KITYR+++A  + F I +  G      S+  E+K     +   + ATD GGL+    V++ + D+N  P     P  + + E+ PIG  +  ++  D D G+NAR+    +  +      + ++D  +  I + S +DRE  +   + +   DH  P L +
Sbjct:  294 ARDLDSGENGEIEYSLGEGNGKNLLAINAKSG----VIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHY---SMASSSGIGGLTIDYSTGEVTLRERIDAK---NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFII---DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSI-LDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ------FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNT 766          

HSP 2 Score: 142.124 bits (357), Expect = 1.108e-33
Identity = 144/528 (27.27%), Postives = 243/528 (46.02%), Query Frame = 2
Query:  719 KFHLQLTAFDRGGQF--ETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK--FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDD-SVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKL-DNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            K  L++TA++R       + ++ +  +D  DN PIF    Y   ++E+      +L V A+DLD GENG+I Y        E N K   ++N  +G I+    LD E  S  LI   + A D+G+P+   +  +EI   D+NDN+P       NV+I EN  I   I ++   D+D   + KV  +  S+      +   ++  + +    D +NS I  + I   D   P +++   L I +ID ND+ P    AQ +  + E+  + E + +  A D DSG  G I Y ++  G+++F+I+  +G I     LDRE        V A D G   L  S  +++ + DINDN P   K    +T+ E  P G+ I  ++  D D+ +     IE   +E    +S L + D   I   S   + +  ++ + +   D G   L     + + I D+N      ++P    +     + Y        ++TL A D D  +N +I + I    + S++F+++ +SG I
Sbjct:  235 KHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLG-----EGNGKNLLAINAKSGVIQTAAPLDRETLS--LIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME--GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADRE---VFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYP-------VITLKAEDHDRGDNARIVYSI----DSSQFFRIDPSSGDI 736          

HSP 3 Score: 141.739 bits (356), Expect = 1.196e-33
Identity = 121/448 (27.01%), Postives = 211/448 (47.10%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI--DRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFD-----TLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE----FVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVT 1870
            A D DS  NG+  YS+  +    F +  + G    LI +    +     ++ L++TA D G      S  I  +  D NDN P F    Y  T+ E       I+ ++A D DE +  KI+YR +       +  +I D+ ++  ++GE+K           D  +   I A D+G   L G C + +   D+N      +   +V IPE+  I  P++++   D D   N ++  + +S+  FR+  S  +   I +    D E+ +   + +   D   PP+ T   + + + D NDN P FT + +   ISED  V     Q SA D D G  G + Y L+++ +      F ++ ++G + + + LDRE   ++   ++A D G   L A+ ++++T+ D+NDN P  +     L + EN P+G+ +G +   D D+G+NA ++
Sbjct:  503 AIDEDSGPNGIIKYSMEGSED--FIIDEDSG----LIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGELK---------RQDHKVRVEISATDQGG--LQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGD---ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADIS 928          

HSP 4 Score: 121.324 bits (303), Expect = 7.076e-29
Identity = 151/575 (26.26%), Postives = 259/575 (45.04%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDR---GGQ---FETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPK-ILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLD--NNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNE 2257
            A D D   NG  +YS++ +      L+I+    E+ +   ++ +N         +TA  R   G Q     T+ L I  ID ND+ P         T++EN      + +V A D D G NG I Y        E ++ F +++ +G IK  + LD E  +   ++ T  A D G+P L+ S  I +   DINDN+P  +  + NV+I E     + I+++   D+D       +  +   + F +    +    + +      ++  + +++I   D G        ++FI   D+ ++ P F       +I E S +   +    A D D G+  +I Y +D +  + F I+ S+G I + + LDRE +      V A+D     L  S ++ + + DINDN P+  S     T+ E+ P+GT    V   D D G N  V        ++      +LD  +  + + S +DRE+ + I L +   D G P L++   IT+++ D+NDN P  E       ++    I  N+   S + T++ARD+D  +N  I FRI    + ++ F + E
Sbjct:  399 ATDEDFGTNGKVHYSMASS-SGIGGLTIDYSTGEVTLRERIDAKNS-------PITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVT--ARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGGLQGRCVVNVFI---DDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS--QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQ------LSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGAD-AKLFDIEE 944          

HSP 5 Score: 26.9498 bits (58), Expect = 7.076e-29
Identity = 10/30 (33.33%), Postives = 16/30 (53.33%), Query Frame = 3
Query:  462 INFEIIDENDNPPKFNQFKFNINVLEEQKI 551
            +   ++D NDN P F    +N+ +LE   I
Sbjct:  361 VEITVVDVNDNAPVFASDSYNVTILENITI 390          

HSP 6 Score: 116.701 bits (291), Expect = 6.488e-26
Identity = 114/420 (27.14%), Postives = 188/420 (44.76%), Query Frame = 2
Query:  680 ILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNKVK----CNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL-DDAGNKEFVINIST---GYIYLYN--SLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILT-VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALF 1903
            ILS        + K  ++++A D+GG  +   +    ID  ++ P F D  +   + E++    P++ ++A+D D G+N +I Y  D+      +  F ++  +G+I +   LD E          + A D  SP L+ S +IE+   DINDNSP+        +I E+  + T  + +   D D   N +        +S+ + +L      S T+ +    D E  ++  + I   D G P ++    + + + D NDN P F +  +   I+E+S V   +    A D D G+   I++R+   A  K F I       G + +      D E K    FF      G L ++V V I V D+NDN P LK   IL    +N  +   IG +  FD D  +NA  T+E  ++EN L 
Sbjct:  637 ILSVSGELKRQDHKVRVEISATDQGG-LQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS------SQFFRIDPSSGDISVSSDLDRE--DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD--QNA--TLEYFLEENDLI 1043          

HSP 7 Score: 97.4413 bits (241), Expect = 5.000e-20
Identity = 96/331 (29.00%), Postives = 160/331 (48.34%), Query Frame = 2
Query: 1313 IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARV--TIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYST 2281
            I + ++ D E    H + +  ++   P ++   ++ + ++D  DN PIF +  +  +I ED+ +   +    A DLDSG  G+I Y L +   K  + IN  +G I     LDRE   ++   V A+D G    E++  V ITV+D+NDN P   S    +T+LEN  I  +I  V+  D D G N +V  ++ +      L   Y      ++ ++  ID  K S I   ++  D  +P L+S   +TI++IDIND+ P L        + ++ +I +  N      +  + A D D   NG I++ +     GS  F ++E SG I +T
Sbjct:  222 IRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDY---STGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL--------IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM----EGSEDFIIDEDSGLIKTT 536          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 143.665 bits (361), Expect = 3.394e-34
Identity = 117/422 (27.73%), Postives = 201/422 (47.63%), Query Frame = 2
Query:  782 ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYVHDDDSVHNK-VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEM---LEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLD--NNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            IT +D NDN P+F    Y  T+ EN T    I  V+A D D G NGK+ Y   ++         +++  TGE+ L +++D +   +  I   I A D   P LS +  + I+  DIND++P  I   K +++ EN  I   +  +Y  D+DS  N  +K +   +++F +    E+S  I   +  D E ++ + + +   D G P + T  ++ + + D NDN P F + ++   ISE+      +    A D D     KITYR+++A  + F I +  G      S+  E+K     +   + ATD GGL+    V++ + D+N  P     P  + + E+ PIG  +  ++  D D G+NAR+    +  +      + ++D  +  I + S +DRE  +   + +   DH  P L +
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHY---SMASSSGIGGLTIDYSTGEVTLRERIDAK---NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFII---DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSI-LDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ------FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNT 407          

HSP 2 Score: 141.739 bits (356), Expect = 1.280e-33
Identity = 121/448 (27.01%), Postives = 211/448 (47.10%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI--DRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFD-----TLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE----FVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVT 1870
            A D DS  NG+  YS+  +    F +  + G    LI +    +     ++ L++TA D G      S  I  +  D NDN P F    Y  T+ E       I+ ++A D DE +  KI+YR +       +  +I D+ ++  ++GE+K           D  +   I A D+G   L G C + +   D+N      +   +V IPE+  I  P++++   D D   N ++  + +S+  FR+  S  +   I +    D E+ +   + +   D   PP+ T   + + + D NDN P FT + +   ISED  V     Q SA D D G  G + Y L+++ +      F ++ ++G + + + LDRE   ++   ++A D G   L A+ ++++T+ D+NDN P  +     L + EN P+G+ +G +   D D+G+NA ++
Sbjct:  144 AIDEDSGPNGIIKYSMEGSED--FIIDEDSG----LIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGELK---------RQDHKVRVEISATDQGG--LQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGD---ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADIS 569          

HSP 3 Score: 120.553 bits (301), Expect = 9.939e-29
Identity = 151/575 (26.26%), Postives = 259/575 (45.04%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDR---GGQ---FETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPK-ILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLD--NNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNE 2257
            A D D   NG  +YS++ +      L+I+    E+ +   ++ +N         +TA  R   G Q     T+ L I  ID ND+ P         T++EN      + +V A D D G NG I Y        E ++ F +++ +G IK  + LD E  +   ++ T  A D G+P L+ S  I +   DINDN+P  +  + NV+I E     + I+++   D+D       +  +   + F +    +    + +      ++  + +++I   D G        ++F   ID+ ++ P F       +I E S +   +    A D D G+  +I Y +D +  + F I+ S+G I + + LDRE +      V A+D     L  S ++ + + DINDN P+  S     T+ E+ P+GT    V   D D G N  V        ++      +LD  +  + + S +DRE+ + I L +   D G P L++   IT+++ D+NDN P  E       ++    I  N+   S + T++ARD+D  +N  I FRI    + ++ F + E
Sbjct:   40 ATDEDFGTNGKVHYSMASS-SGIGGLTIDYSTGEVTLRERIDAKNS-------PITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVT--ARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGGLQGRCVVNVF---IDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS--QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQ------LSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGAD-AKLFDIEE 585          

HSP 4 Score: 26.9498 bits (58), Expect = 9.939e-29
Identity = 10/30 (33.33%), Postives = 16/30 (53.33%), Query Frame = 3
Query:  462 INFEIIDENDNPPKFNQFKFNINVLEEQKI 551
            +   ++D NDN P F    +N+ +LE   I
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITI 31          

HSP 5 Score: 116.316 bits (290), Expect = 7.327e-26
Identity = 114/420 (27.14%), Postives = 188/420 (44.76%), Query Frame = 2
Query:  680 ILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNKVK----CNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL-DDAGNKEFVINIST---GYIYLYN--SLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILT-VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALF 1903
            ILS        + K  ++++A D+GG  +   +    ID  ++ P F D  +   + E++    P++ ++A+D D G+N +I Y  D+      +  F ++  +G+I +   LD E          + A D  SP L+ S +IE+   DINDNSP+        +I E+  + T  + +   D D   N +        +S+ + +L      S T+ +    D E  ++  + I   D G P ++    + + + D NDN P F +  +   I+E+S V   +    A D D G+   I++R+   A  K F I       G + +      D E K    FF      G L ++V V I V D+NDN P LK   IL    +N  +   IG +  FD D  +NA  T+E  ++EN L 
Sbjct:  278 ILSVSGELKRQDHKVRVEISATDQGG-LQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS------SQFFRIDPSSGDISVSSDLDRE--DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD--QNA--TLEYFLEENDLI 684          

HSP 6 Score: 90.1225 bits (222), Expect = 8.314e-18
Identity = 103/395 (26.08%), Postives = 178/395 (45.06%), Query Frame = 2
Query: 1106 IEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDD-SVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKL-DNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            +EI   D+NDN+P       NV+I EN  I   I ++   D+D   + KV  +  S+      +   ++  + +    D +NS I  + I   D   P +++   L I +ID ND+ P    AQ +  + E+  + E + +  A D DSG  G I Y ++  G+++F+I+  +G I     LDRE        V A D G   L  S  +++ + DINDN P   K    +T+ E  P G+ I  ++  D D+ +     IE   +E    +S L + D   I   S   + +  ++ + +   D G   L     + + I D+N      ++P    +     + Y        ++TL A D D  +N +I + I    + S++F+++ +SG I
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME--GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADRE---VFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYP-------VITLKAEDHDRGDNARIVYSI----DSSQFFRIDPSSGDI 377          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 136.346 bits (342), Expect = 5.884e-32
Identity = 128/499 (25.65%), Postives = 227/499 (45.49%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFE--TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQL--IEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMER---------TFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPK 2017
            +A D+DS   G  +Y +      F   SI     E+     L        +FHL ++A D GGQ    + ++ IT ID++   P F+   Y     E+    I I  V       G   K+ Y   ++   + +  FS+++ TG+I + + LD +++   L  I+ T+ + +      S   ++ I   D NDN P+    L  +SI E+ ++  P   +   D D         KN    + + SS   S +I +++           DYE +  +++ ++  D GIPP ++  +LFI ++D NDN P F ++ +  ++ E+S     + +  A D DS   G+I YR+ + G++ F I+   G +Y   S+DREV   ++  + A D G     ++    I+V+D+NDNPP   S   + V    P+ T IG +   D D G N  V    ++Q +     ++   N  ++++  ++        L + + D G P+
Sbjct:  664 SASDMDSGTFGEVSYHILSESSSF---SINPVTGEVFAQKPLA-----RGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-------GAMSKVKY---SIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGE------SNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDK-------KKNGEVRYSIISSHPGS-SIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN-GSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSL----FVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVPR 1125          

HSP 2 Score: 112.464 bits (280), Expect = 1.368e-24
Identity = 118/401 (29.43%), Postives = 178/401 (44.39%), Query Frame = 2
Query:  674 LLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIF----TDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYR-FDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIE-ILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQEN------SLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLF-IAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGL--EASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNV 1828
            LL+   L+ E  +E   HL+      G         +T  D NDN P +      I   +T   + T T       AKD D G+NG I Y   DT       +  S++K TG I +   +D  I S+  I+F + A D GSP LS   ++     D     P+ E  L  V IPE+  I T ++ +       V N  +C  +    + L +  E+      S T+ +++TFD+E    +Q  +   ++      T  SL  I + D NDN+PIF   ++   + E  K  E L   SA+D+DSG FG+++Y +  + +  F IN  TG ++    L R         V A DGGG   E S  + ITV+D +   P+    K  +   E+   G  IG+V
Sbjct:  395 LLLCGILDRETASEH--HLKFLLEKDGQIIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGGSRTLT-------AKDPDLGQNGWIRYSVLDT-------ELVSIDKETGRIFVPNTIDCNIGSE--IKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKV-------VANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNAN---SETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHI-LSESSSFSINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV 763          

HSP 3 Score: 108.997 bits (271), Expect = 1.215e-23
Identity = 125/467 (26.77%), Postives = 202/467 (43.25%), Query Frame = 2
Query:  644 QLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKS-LFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYR-LDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVS--ITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
             L+++     + I    +FE   ++ +   + A +   +  T  + I   D NDN PIF    Y  TV+E      P+L V A D+D G  G++SY   + +       FS+N +TGE+   + L    +        + A D G      S  I I   D +  +P+    K  +   E+      I S+         +KVK +  S D     S  E++  IY+ R   Y ++ +H   +    + +P   + ++ + I I D NDN P F+ +     I ED K++E  +   A+D D    G++ Y  +         I+  TG +   + LD E     +  V ATD G    S  ++  I V+D+NDN P   KS   + VLEN P  T++G V   D D  EN ++ +      +  F    KL N  ++ K  IDRE +S + + +   D G P  +S
Sbjct:  585 HLTVDTMSGTVCIQKTFDFEK--QKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSES-----SSFSINPVTGEVFAQKPLARGRF-----HLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV------GAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTR---YLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQI-VYRITNGSEYFGIDEKLGN--VYTKRSIDREVISHVDISIVAEDKGVPPRSS 1027          

HSP 4 Score: 86.6557 bits (213), Expect = 4.448e-18
Identity = 142/621 (22.87%), Postives = 247/621 (39.77%), Query Frame = 2
Query:  560 SLPTAYDLDSSINGVYNYS-LSENHKKFFQLSIEKGYPELLILSALNFENVNE--RKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNK---LTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEIL-----KNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNK----NSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREK------------------VSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQF 2305
            +LPT  D D     V+ +  L  N    F+L+  K   +L     +N +   E   K+ L + A D G   +   +   I  ID NDN P+F+   Y  +V  N +    ++ VQA D D GEN +ISY     T    N  F++++   +T    LL    +++         + A D GSP LS S  + I       +SP ++I+      +  + EN  + + +  +      S+  + +  K     S+      + Q +   + +    D E +S H +       G   +       + I D NDN P +  +Q    ++     +  L   +A D D G  G I Y + D    E V I+  TG I++ N++D  +   ++F V A DGG   L   ++V   ++D    PP+  K+   + + E+ PIGT +  V   +   G + R+    + Q+  L    +   +  + I+   D EK                   S I +RLK V+   P                     + YP+E  +      +    +    +L + A D D    G++ + I+ +   S  F +N  +G +++      G+F
Sbjct:  142 ALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKK-TSAPSNSNFAISQSGVITTTASLLPASTHDVI--------VVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARV------SIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDG--QIIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGGSRTL---TAKDPDLGQNGWIRYSVLDT---ELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTM---SGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWP---------------------IFYPNEYHLT-----VREGPKPEEPLLVVSASDMDSGTFGEVSYHILSE---SSSFSINPVTGEVFAQKPLARGRF 707          

HSP 5 Score: 25.0238 bits (53), Expect = 4.448e-18
Identity = 21/80 (26.25%), Postives = 30/80 (37.50%), Query Frame = 3
Query:  267 TSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKF 506
            TS F K  E     +SG+I T   +D + R +                   I+  +  +      I  E+ DENDN P F
Sbjct:   65 TSKFLKVDE-----RSGEISTIAHLDYEKRSKF-----------------DIVAVKVEESGETIDILVEVDDENDNAPSF 122          

HSP 6 Score: 88.5817 bits (218), Expect = 2.405e-17
Identity = 135/535 (25.23%), Postives = 227/535 (42.43%), Query Frame = 2
Query:  812 PIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKF-SLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSG-SCKIEIHSTDINDNSPRI--EILKNVSIPENKRIATPIMSIYVHDDDS----VHNKVKCNKNSNDNFRLHSSQEN---SLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY---RLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKILT-----VLENEPIGTLIGNVEVFDLDDGENARVTIENEV--QENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYP---SEGDVMNS-----RSLIYVN---TQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIY--STWSCRNGQFI 2308
            P F   L + TV E+      I  +  K  +       + ++  + P E   KF  +++ +GEI  +  LDYE  S    +F I AV     + SG +  I +   D NDN+P    +++K + I E  ++ T      V D D     VH  V    N N+ F+L S + N      + +    D E    +++ IE  D G P         I IID NDN P+F+R+++   +S +  +   L    ATD D G   +I+Y   +     N  F I+ S G I    SL        +  V A+D G   L +S  V+ITV+    + P L    ++      ++EN  +G+++  V +         R+   + +  Q+    + YL      + +  ++DRE  S+  L+  L   G+                     I+E+P   + GD+ ++      S I+++   TQ  S   TL A+D D  +NG IR+ ++D    +    +++ +G I+  +T  C  G  I
Sbjct:   20 PTFCQCLTKFTVPESAQIGTRIGWISGKREESA-----APKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRS----KFDIVAVKV---EESGETIDILVEVDDENDNAPSFADQVVK-LEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQS-GVITTTASL--LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYL------LLLCGILDRETASEHHLKFLLEKDGQ--------------------IIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGGS--RTLTAKDPDLGQNGWIRYSVLD----TELVSIDKETGRIFVPNTIDCNIGSEI 506          

HSP 7 Score: 80.8777 bits (198), Expect = 5.549e-15
Identity = 90/401 (22.44%), Postives = 178/401 (44.39%), Query Frame = 2
Query:  647 LSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEI--YSDQLIEFTIEAVDEGSPQLS--GSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSN-----DNFRLHSSQEN---------SLTIYMERTFDYENSSIHQIDIECFD----SGIPPMATYKSLFIAIIDENDNF-PIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIS--TGYIYLYNSL--DREVK-EMLEFFVYATDGGGLEASVKVSITVMDINDNPPRL 1765
             SI+K +  L +   ++ E     +F +++       Q       +  +D NDN P+FT + Y  ++K++  +   I Q+ A D D GENG++SYR   L+  ++N   +LN  TG I+L +  D ++  + +   +  +EA D G P  +  G  ++ +  +  + ++P   +              P+  ++V +D SV   ++  + SN     ++  L+S +E+         +  + ++   D+E+  I  + +   D    S + P+         +++  D F P+FT++ +  QI   +   E + Q  A D D G  G + Y + D   ++  + I   TG I L   L   R +  E +    Y++     + +V + I   D+  + P+L
Sbjct: 2174 FSIDK-FGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRI--LSGNDLN-IVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVL--------------PVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVVPLKI-------VVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISD---RQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEIGPFDVQPSLPKL 2546          

HSP 8 Score: 77.411 bits (189), Expect = 5.336e-14
Identity = 96/413 (23.24%), Postives = 172/413 (41.65%), Query Frame = 2
Query:  680 ILSALNFENVNERKFHLQLT--AFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENT-TYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSP-----------RIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSN----DNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFV-INISTGYIYLYNSLDREVKEM----LEFFVYATDGG----GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEV 1834
            + + L+FE + E    ++ T  +FD    F  +++F++ I  NDN P F+  LY+ TV   T +   P  +++A DLD    G ++Y       Q  +  F +   +G   L  K+        L+  T+ A D G P  S S  +   S  I +  P           R E++      EN +I   I ++   +    H +++  + S     D F           +++    D E  + H+  +E  +  +          + ++DENDN P+FT   +   + +     + + Q  A+D DSG  G+++YR+    +   V +N  TG I L    D ++ E      +  V A D G         V+VS+ +   + + P    P   + VLE+  +GT++  +  
Sbjct: 1986 LTAPLDFEVLPEHTLTIKATDGSFD---TFTNLTIFVSDI--NDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD--ARGALTYSLG----QGSSSIFRVAPESG--ALFMKVLPPAGERYLV--TVTATDNGVPSFSTSVPV---SVIIGEAEPTDKPGFEKAEFRFEVM------ENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKFG---------RLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRA 2365          

HSP 9 Score: 69.707 bits (169), Expect = 1.237e-11
Identity = 113/494 (22.87%), Postives = 199/494 (40.28%), Query Frame = 2
Query:  623 ENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKE----NTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSL------NKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK------VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFP----IFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVI-NISTGYIYLY---NSLDREVKEMLEF-FVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            E   KF ++    G  E+  ++ L++E     KF +     +  G  ET+ + +   D NDN P F D + +  + E     T++ +P +        +G+  K       +    +N+ F L       +L  ++ +  +LD E + D+  E  IEA D G P   G  +  I   D NDN+P     +   S+  N  I + ++++   D D   N        K +  SN NF +  SQ   +T     T     +S H + +   D G P +++   + I ++    + P    I+    +   + E+S +   + + S        +     RL   G+           ++YL      LDRE        F+   DG  +    ++ +T+ DINDN P+  S +I   L     G+    +   D D G+N    I   V +  L    +  +  +IF+ + ID    S+I  R++  D G P L++
Sbjct:   63 EQTSKFLKVDERSG--EISTIAHLDYEK--RSKFDIVAVKVEESG--ETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVT-------DGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDRE-FRDKY-ELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAI--SQSGVITT----TASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQ----QYRDTKLRL--IGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQL-LTIGDINDNAPQWHSSQIHISLNRTQGGSR--TLTAKDPDLGQNGW--IRYSVLDTELV--SIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALST 522          

HSP 10 Score: 62.003 bits (149), Expect = 3.164e-9
Identity = 85/328 (25.91%), Postives = 136/328 (41.46%), Query Frame = 2
Query:  899 LDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIE--ILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDY---ENSSIH--QIDIECFDSGIPPMATYKSLFIAIIDEND--NFPI-FTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINI-STGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDD 1849
            L  G   +  +RF    P     KFS+N  TG I +L  LD E   + L+   I   D GS   + SC + +   D NDN P+++      + I E+ R+   +      D D         +N   +F L      SL +  E T D      SS+   +I +   D G+P +   K+L I+  +       P+ F +  ++  I E     +F+ +             +TY + + GN +   ++ S G I     LDRE+ E     V  T G G +   +V + V ++NDN P     K   V EN  +G+ +  V   D+D+
Sbjct: 1654 LATGMTEESRFRFQGNAP-----KFSINSTTGSISVL-PLDREASQEHLL--IIILTDGGS--RNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMD-------IGQNGKFSFELLEDSSGSLDLVPE-TGDLVLRRLSSLQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQP------ELAGLTYSIVE-GNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGT-GSGQQIGTRVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVATVGAKDVDN 1955          

HSP 11 Score: 61.2326 bits (147), Expect = 4.548e-9
Identity = 57/212 (26.89%), Postives = 94/212 (44.34%), Query Frame = 2
Query: 1391 PPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRL--KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKL 2020
            PP  +  S  +  I+EN     F R      ++E+S+   F FQ +A                     +F IN +TG I +   LDRE  +     +  TDGG    S  V +TV D NDN P+L   +P  L + E+  +G ++      D+D G+N + +   E+ E++     L  +   + ++ L     +    ++L++VDHG P L
Sbjct: 1628 PPKISSTSCGVVTIEENVGIEDFKRILAT-GMTEESR---FRFQGNA--------------------PKFSINSTTGSISVL-PLDREASQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSF--ELLEDSSGSLDLVPETGDLVLRRL---SSLQSWKIKLRVVDHGVPGL 1809          

HSP 12 Score: 54.6842 bits (130), Expect = 5.165e-7
Identity = 96/399 (24.06%), Postives = 167/399 (41.85%), Query Frame = 2
Query:  683 LSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKP-IFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPR-IEILKNV---SIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL--DDAGNKEFVINIS--TGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPI--GTLIGNVEVFDLD 1846
            +S L  +    ++  L +   D G + ++ ++ +T  D+NDNKP +         + E++     + + +A D+D G+NGK S+       ++ +    L   TG++ +L++L     S Q  +  +  VD G P L     +EI + +    +   +E LK     +I E       I  +        ++ V+ N +S   F + S  E  +   +E   D E    + + +    SG         + + + + NDN P F  ++   ++ E+ +V  ++    A D+D  N   + Y L  D +G      NI   TG I+L   LD EV       + ATDG   +    ++I V DINDN P    P   T +       G     +E  DLD
Sbjct: 1682 ISVLPLDREASQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFEL----LEDSSGSLDLVPETGDL-VLRRLS----SLQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELAGLTYSIVEGNIDSA--FSVDS--EGVIRTNLE--LDREILERYSLKVIGTGSG---QQIGTRVDVRVNNLNDNVPSFPMSKP-RRVPENLRVGSYVATVGAKDVD--NLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGS-FDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD 2058          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 130.954 bits (328), Expect = 2.910e-30
Identity = 150/500 (30.00%), Postives = 226/500 (45.20%), Query Frame = 2
Query:  635 KFFQLS-IEKG--YPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI-DRNDNKPIFTDILYRKTVKENTTYT--------IPILQVQAKDLD-EGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGS-------CKIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLH-SSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQ-ISEDSKVNEFLFQCSATDLDSG-NFGKITYRLDDAGNKE-FVINISTGYIYLYNSLDREVKEMLE---FFVYAT--DGGGLEASVKVSITVMDINDNPPRLKSPKILTVLEN-EPI---GTLIGNVEVFDLDDGENARVTIENEVQENALF--YSYLKLDNN--KIFIKSLIDREKVS--QIFLRLKLVDHGRP 2014
            KF Q +  E G  + E++I+  L++E VN   + L LTA D   +  +   F+  + D ND  P FT  L+  T+ E  T           PI+ V+A D D +G   ++ YR       E    F +++LTGEI   +K D E   D  I  T+EA D     L G+        K++I   D+NDN+P  E  K +  + E++     +++I  HD D  H+ ++ +       R+    + +S TI+++   D+E S  + + +   D          +++I I D NDN P F + ++    I ED  + + LF   ATD D      +I YRL+  G  E F I   +G I L  +LDR+    +    F V A   DG GL     V + V DINDN P         + EN EPI   G    +V+  D DD       IE  +  N L    S  ++D N  KIF    +DRE  S  +  + ++  D G P
Sbjct: 1148 KFRQFNKFENGNEWVEVVIMEGLDYEQVN--NYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKI-DMYI-LTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK-HSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGR---HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVP 1639          

HSP 2 Score: 119.398 bits (298), Expect = 9.252e-27
Identity = 143/478 (29.92%), Postives = 207/478 (43.31%), Query Frame = 2
Query:  584 DSSINGVYNYSL----SENHKKFFQLSIEKGYPELLILSALNFENVNERKFH-LQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIE------FTIEAVDEGSP-QLSGSCKIEIHSTDINDNSPRIEILKNVS--IPENKRIATPIMSIYVHD---DDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTF------DYEN----SSIHQIDIECFDSGIPPMATYKSLFIAIIDENDN---FPIFTRAQHIYQISEDSKVNE--FLFQCSATDLDSGNFGKITYRL---DDAGNKEFVINISTGYIY--LYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKILTVLEN-EPIGTLIGNVEVFDLDDGENARVTIENEVQENA 1897
            D    G   YSL     E+  K+F++    G   L  L  L+F++    K H L++TA +   +   + L I   D NDN P FT  LY   V+E+      IL+V A D D G+N +I+Y  D       N  FS+N   GEI    +LD    +DQL E      F + A D G P  LS S  I I + + ND S         +  + E+ +  TP++ I   D   D+  ++ +  N  S     L S  E++  + +          + EN    + I Q D  C         +Y +L I I D N+N   FP   +   I +I E +   +   + +  ATD DS   G I Y L        K FVI+  TG +    +   DRE +   +  V ATD G   L    + S+ V+DINDN P+ + P   T +   E +GT +  V  FD D   NA +T   E+   A
Sbjct:  562 DGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRL--LDFDDPALPKLHKLKVTAREDNRESH-VDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVD-------NHNFSINS-NGEISAKVRLD----ADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTA 1024          

HSP 3 Score: 92.0485 bits (227), Expect = 1.936e-18
Identity = 97/401 (24.19%), Postives = 169/401 (42.14%), Query Frame = 2
Query:  722 FHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILY------RKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK--FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDI------------ECFDSGI----PPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKS-PKILTVLENEPIGTLIGNVEVFDLD 1846
            F +Q    D  G      + +   D NDN PIF + L+      R+ +  +  Y    + VQA+D D+      +  +  +  + IN +  F +++ TG+I  ++ LD EI S++     + A D G P   G   + I  TD+NDN+P  E  +   S+ E   I   +MS    D D         + + DN   +   E S   Y+    D + SS+  + +            + F  GI           ++ +A++D ND+ P    A   +++ ED      + + +ATD D+G+  +          ++F I+   G + + ++LDRE   +    + A D         V++ + D+NDN P   + P+     EN P+  L G  E+   D
Sbjct: 1514 FVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVY---FMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDAD---------EEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATE-HRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQL-GTCEIRATD 1899          

HSP 4 Score: 81.6481 bits (200), Expect = 3.422e-15
Identity = 109/426 (25.59%), Postives = 178/426 (41.78%), Query Frame = 2
Query:  794 DRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQEN--------SLTIYMERTFDYENSS---IHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKV----NEFLFQCSATDLDSGN-------FGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFF--VYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNK-----IFIKSLIDREKVSQ 1975
            D NDN P F +  Y   VKE+      ++ ++A DLD+  N     R+  +        F +   +G I + + LD+E  SDQ     + A D    + + +  + IH  D+NDN+P+ E  K  +    + +  P +   VH  D+  ++    K+S   +RL     +        S TI + +  D +  +        ++  D     +  Y  + + + D NDN PIF      Y I E+ +       +     A D D          +G +  +L + G   F I+ +TG I+   SLDRE+    EF   V A D G    E    V+I V D+NDN P  +  +   +V E  PIG  + +   FD D+     V      +E+  FY     D+ +     + +K  +D E V+Q
Sbjct: 1327 DVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN----LRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEA-SDQY-HLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDE----KSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLIN-GESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQ 1737          

HSP 5 Score: 72.0182 bits (175), Expect = 2.610e-12
Identity = 103/458 (22.49%), Postives = 179/458 (39.08%), Query Frame = 2
Query:  773 SLFITTIDRNDNKPIFTDIL-YRKTVK--ENTTYTIP--ILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK------------VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIP-PMATYKSLFIAIIDENDNFPIFTRAQHI---YQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNK------------EFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKV-SITVMDINDNPPRLKSPKILTVLENEPI---------GTLIGNVEVFDLD-DGENARVTIENEVQENALFYSYLKLD--NNKIFIKSLIDREKVSQIFLRLKLVDH 2005
            +L I   D N+NKP F D   Y    K  E T  T P  I++V+A D D   NG I Y     T  E    F +++ TG +     + ++  +    + T++A D G   L G C+  +   DINDNSP+ E      S+   + + T +++++  D+D+ HN              + ++N  D F L + +   +T+        +    + I     D+GIP  + +   + + ++D+    P +  +        + E+ ++N+ + +C A          + Y+L  +G              +F        + +   LD E        + ATD     AS K   + V D+ND  P+         ++ E           G  I  V+  D D DG    V      + N     + ++D    +IF     DREK+    L ++  D 
Sbjct:  850 TLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSL-YYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVI---ADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDR 1303          

HSP 6 Score: 64.3142 bits (155), Expect = 6.033e-10
Identity = 98/416 (23.56%), Postives = 164/416 (39.42%), Query Frame = 2
Query:  593 INGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG----GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLD-EGENGKISYRFDTLTP--QEINDKFSLNKLTGEIKLLQKLDYE-IYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDS----GIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCS--ATDLDSGNFG-------KITYRLDDAGNKEFVINISTG----YIYLYNSLDREVK---EMLEFFVYATDGGGLEASVKVSITVMDINDN 1753
            ING   + + +N  K F +             +L+ E  +ER+F +++ A DRG      F  +++ +T  D NDN P F    Y  +V+E       ++   A D D E ++   +Y+    +       DK S     G +++ Q LDYE +         I   D    +      + +   D ND++P I       + E+    T I      D D+    + + N+ S+   +    Q+ +L +    T D E+ +++ + IE +D+    G   +A Y      + D NDN P            E++ VN+ L  C   ATD D+  FG         +++     N  F  N   G     I      DRE     ++LE  +   D  G      V + + D+NDN
Sbjct: 1596 INGESVFRIDQNTGKIFAMR------------SLDREISSEREFIIEVRANDRGVPSREGFANVTIKVT--DMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRV--AHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVY------LQDVNDNGPEPYTVPRPCIFRENTPVNQ-LGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRRNEASVHVIIGDLNDN 1985          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 130.954 bits (328), Expect = 2.910e-30
Identity = 150/500 (30.00%), Postives = 226/500 (45.20%), Query Frame = 2
Query:  635 KFFQLS-IEKG--YPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI-DRNDNKPIFTDILYRKTVKENTTYT--------IPILQVQAKDLD-EGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGS-------CKIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLH-SSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQ-ISEDSKVNEFLFQCSATDLDSG-NFGKITYRLDDAGNKE-FVINISTGYIYLYNSLDREVKEMLE---FFVYAT--DGGGLEASVKVSITVMDINDNPPRLKSPKILTVLEN-EPI---GTLIGNVEVFDLDDGENARVTIENEVQENALF--YSYLKLDNN--KIFIKSLIDREKVS--QIFLRLKLVDHGRP 2014
            KF Q +  E G  + E++I+  L++E VN   + L LTA D   +  +   F+  + D ND  P FT  L+  T+ E  T           PI+ V+A D D +G   ++ YR       E    F +++LTGEI   +K D E   D  I  T+EA D     L G+        K++I   D+NDN+P  E  K +  + E++     +++I  HD D  H+ ++ +       R+    + +S TI+++   D+E S  + + +   D          +++I I D NDN P F + ++    I ED  + + LF   ATD D      +I YRL+  G  E F I   +G I L  +LDR+    +    F V A   DG GL     V + V DINDN P         + EN EPI   G    +V+  D DD       IE  +  N L    S  ++D N  KIF    +DRE  S  +  + ++  D G P
Sbjct: 1148 KFRQFNKFENGNEWVEVVIMEGLDYEQVN--NYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKI-DMYI-LTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK-HSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGR---HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVP 1639          

HSP 2 Score: 119.398 bits (298), Expect = 9.252e-27
Identity = 143/478 (29.92%), Postives = 207/478 (43.31%), Query Frame = 2
Query:  584 DSSINGVYNYSL----SENHKKFFQLSIEKGYPELLILSALNFENVNERKFH-LQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIE------FTIEAVDEGSP-QLSGSCKIEIHSTDINDNSPRIEILKNVS--IPENKRIATPIMSIYVHD---DDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTF------DYEN----SSIHQIDIECFDSGIPPMATYKSLFIAIIDENDN---FPIFTRAQHIYQISEDSKVNE--FLFQCSATDLDSGNFGKITYRL---DDAGNKEFVINISTGYIY--LYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKILTVLEN-EPIGTLIGNVEVFDLDDGENARVTIENEVQENA 1897
            D    G   YSL     E+  K+F++    G   L  L  L+F++    K H L++TA +   +   + L I   D NDN P FT  LY   V+E+      IL+V A D D G+N +I+Y  D       N  FS+N   GEI    +LD    +DQL E      F + A D G P  LS S  I I + + ND S         +  + E+ +  TP++ I   D   D+  ++ +  N  S     L S  E++  + +          + EN    + I Q D  C         +Y +L I I D N+N   FP   +   I +I E +   +   + +  ATD DS   G I Y L        K FVI+  TG +    +   DRE +   +  V ATD G   L    + S+ V+DINDN P+ + P   T +   E +GT +  V  FD D   NA +T   E+   A
Sbjct:  562 DGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRL--LDFDDPALPKLHKLKVTAREDNRESH-VDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVD-------NHNFSINS-NGEISAKVRLD----ADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTA 1024          

HSP 3 Score: 92.0485 bits (227), Expect = 1.936e-18
Identity = 97/401 (24.19%), Postives = 169/401 (42.14%), Query Frame = 2
Query:  722 FHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILY------RKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK--FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDI------------ECFDSGI----PPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKS-PKILTVLENEPIGTLIGNVEVFDLD 1846
            F +Q    D  G      + +   D NDN PIF + L+      R+ +  +  Y    + VQA+D D+      +  +  +  + IN +  F +++ TG+I  ++ LD EI S++     + A D G P   G   + I  TD+NDN+P  E  +   S+ E   I   +MS    D D         + + DN   +   E S   Y+    D + SS+  + +            + F  GI           ++ +A++D ND+ P    A   +++ ED      + + +ATD D+G+  +          ++F I+   G + + ++LDRE   +    + A D         V++ + D+NDN P   + P+     EN P+  L G  E+   D
Sbjct: 1514 FVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVY---FMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDAD---------EEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATE-HRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQL-GTCEIRATD 1899          

HSP 4 Score: 81.6481 bits (200), Expect = 3.422e-15
Identity = 109/426 (25.59%), Postives = 178/426 (41.78%), Query Frame = 2
Query:  794 DRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQEN--------SLTIYMERTFDYENSS---IHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKV----NEFLFQCSATDLDSGN-------FGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFF--VYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNK-----IFIKSLIDREKVSQ 1975
            D NDN P F +  Y   VKE+      ++ ++A DLD+  N     R+  +        F +   +G I + + LD+E  SDQ     + A D    + + +  + IH  D+NDN+P+ E  K  +    + +  P +   VH  D+  ++    K+S   +RL     +        S TI + +  D +  +        ++  D     +  Y  + + + D NDN PIF      Y I E+ +       +     A D D          +G +  +L + G   F I+ +TG I+   SLDRE+    EF   V A D G    E    V+I V D+NDN P  +  +   +V E  PIG  + +   FD D+     V      +E+  FY     D+ +     + +K  +D E V+Q
Sbjct: 1327 DVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN----LRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEA-SDQY-HLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDE----KSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLIN-GESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQ 1737          

HSP 5 Score: 72.0182 bits (175), Expect = 2.610e-12
Identity = 103/458 (22.49%), Postives = 179/458 (39.08%), Query Frame = 2
Query:  773 SLFITTIDRNDNKPIFTDIL-YRKTVK--ENTTYTIP--ILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK------------VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIP-PMATYKSLFIAIIDENDNFPIFTRAQHI---YQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNK------------EFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKV-SITVMDINDNPPRLKSPKILTVLENEPI---------GTLIGNVEVFDLD-DGENARVTIENEVQENALFYSYLKLD--NNKIFIKSLIDREKVSQIFLRLKLVDH 2005
            +L I   D N+NKP F D   Y    K  E T  T P  I++V+A D D   NG I Y     T  E    F +++ TG +     + ++  +    + T++A D G   L G C+  +   DINDNSP+ E      S+   + + T +++++  D+D+ HN              + ++N  D F L + +   +T+        +    + I     D+GIP  + +   + + ++D+    P +  +        + E+ ++N+ + +C A          + Y+L  +G              +F        + +   LD E        + ATD     AS K   + V D+ND  P+         ++ E           G  I  V+  D D DG    V      + N     + ++D    +IF     DREK+    L ++  D 
Sbjct:  850 TLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSL-YYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVI---ADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDR 1303          

HSP 6 Score: 64.3142 bits (155), Expect = 6.033e-10
Identity = 98/416 (23.56%), Postives = 164/416 (39.42%), Query Frame = 2
Query:  593 INGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG----GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLD-EGENGKISYRFDTLTP--QEINDKFSLNKLTGEIKLLQKLDYE-IYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDS----GIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCS--ATDLDSGNFG-------KITYRLDDAGNKEFVINISTG----YIYLYNSLDREVK---EMLEFFVYATDGGGLEASVKVSITVMDINDN 1753
            ING   + + +N  K F +             +L+ E  +ER+F +++ A DRG      F  +++ +T  D NDN P F    Y  +V+E       ++   A D D E ++   +Y+    +       DK S     G +++ Q LDYE +         I   D    +      + +   D ND++P I       + E+    T I      D D+    + + N+ S+   +    Q+ +L +    T D E+ +++ + IE +D+    G   +A Y      + D NDN P            E++ VN+ L  C   ATD D+  FG         +++     N  F  N   G     I      DRE     ++LE  +   D  G      V + + D+NDN
Sbjct: 1596 INGESVFRIDQNTGKIFAMR------------SLDREISSEREFIIEVRANDRGVPSREGFANVTIKVT--DMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRV--AHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVY------LQDVNDNGPEPYTVPRPCIFRENTPVNQ-LGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRRNEASVHVIIGDLNDN 1985          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 186.037 bits (471), Expect = 3.490e-47
Identity = 172/624 (27.56%), Postives = 293/624 (46.96%), Query Frame = 2
Query:  545 KNYRMSL---PTAYDLDSSINGVYNYSLSENHKKFFQLS-------------IEKGYPELLILSALNFENVNERKFH-LQLTAFDRGGQFETMS---LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDS-VHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG-------------NKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNN--------KIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMD--DCNGSRYFQVNETSGAI 2272
            + Y++SL   P A    SS   V   +   ++  F Q+S             I++   E+ ++   +  +V  +  H L ++A D GG   + +   +F++ ID     PIF    Y   VKE+      +  V A   D      + Y   +  P   +  FS+   +G I++ + LD+E  S  L+   I+A   G P + G  ++ I   D+NDN+P  E  +  +S+PE+  +  P+ + + HD DS    +V  +        L +    S  + + +  DYE+S  H + +   D G+P ++T  ++ + + D NDN P+F + ++   +SE   +N  + Q +A+DLD+GN  +ITYR+ DAG             ++ F I  ++G+IYL   LDRE ++  +  V ATD G     A  +V + V+D NDN P+ +  K    + EN   G+++G V   DLD GENA           A+ YS L ++++        +I  +  +DRE      L ++  D G P  ++   + I + D+NDN P +  P E DV++ R      T+    ++ + A D D  +N  I + I+   D +G   F ++ TSG I
Sbjct:  718 REYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRP-DMLSVRTQPMHMLNISATD-GGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDP---DGYFSIETNSGNIRIAKPLDHEAKSQVLL--NIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENA-----------AIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQE-DVVSVREEQPPGTE----VVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVI 1317          

HSP 2 Score: 168.318 bits (425), Expect = 1.610e-44
Identity = 160/604 (26.49%), Postives = 272/604 (45.03%), Query Frame = 2
Query:  581 LDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKN--VSIPENKRIATPIMSIYVHDDDSVHNKVK----CNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDL----------DSGNFGKITYRLD----DAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG----LEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE--------NEVQENALFYSYLKLDN--NKIFIKSLIDREKVSQIFLRLKLVDHGR---PKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            +D+ ++ V N   S +  + F +    G+  + + + L+ E  +  ++ L + A D G         + +  +D NDN P F    Y   ++EN      +  V A DLD GEN  I Y   +L P  IN  F ++ +TGEI   + LD E+   +L +  +EA D+G+P  S    + IH +D+NDN+P I   +   VS+ E +   T ++ +   D D   N            +D   L S    S  I      D+E  SI+++ +   D G PP  T + L + ++D NDN P FT +  ++++ ED+ +   +   S  +           +S    ++TY L+    D     F I+  +G + +   LDREV+      + A D         +++ V I V D+NDN P   + P  L V E  P+GT+I N    D D G N  +           NE QE A+  S  ++D+    + +++ +D E V +  L ++ +D       +L +  T+ + I+D ND+ P    P+      +   I   T+    +  ++A D D  +NG++ + I    NG   F++N  +G I
Sbjct: 1076 VDAGVDNVTNSISSSDVSQHFGIFPNSGW--IYLRAPLDRETRD--RYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRY---SLLP--INSSFQVHPVTGEISTREPLDRELR--ELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAM--SLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEIT-GGNGEGRFRINSQTGII 1665          

HSP 3 Score: 32.7278 bits (73), Expect = 1.610e-44
Identity = 13/35 (37.14%), Postives = 22/35 (62.86%), Query Frame = 3
Query:  447 AVNFQINFEIIDENDNPPKFNQFKFNINVLEEQKI 551
            + N  I  ++ D NDNPP F + ++++NV E + I
Sbjct: 1017 STNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSI 1051          

HSP 4 Score: 164.081 bits (414), Expect = 2.196e-40
Identity = 152/521 (29.17%), Postives = 244/521 (46.83%), Query Frame = 2
Query:  770 MSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK---FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI--LKNVSIPENKRIATP---IMSIYVHDDDSV--HNKVKCNKNSNDNFRLHSSQENSL-TIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE---FVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARV--TIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIY 2275
            M++ IT  D NDN+PIF    Y  TV EN T    +LQV A D D  ENG + Y  +    +  +DK   F ++  TG I + + LD+E  + +L E  + A D G   L  +  + I  TD+NDN P I +  L + + P+    A P   +  I VHD DS   +  V    N  D     ++++NS+  + +    D E  S + + +   D G PP+   KS+F+ I D NDN P F +  +   + E +     + Q  A D D G    +TY L +        F I+  TG I   + +D E + + +  V A DGG   L ++  V +T+ D+NDN P   +S   ++V ENEP+G  I  V   D D G NA V  TI    +    F   ++  + +I I   +D E+ S     +   D G    T+        +   +++  + YP E  V    S    +   ++ I+ ++A D D+   G++ +RI+   N +  F+++ ++G I+
Sbjct:  270 MTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAIN----RRQSDKEQMFRIDPRTGAIYINKALDFE--TKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEF--EVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAM---IKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIV-AGNEAGIFRIDRSTGEIF 778          

HSP 5 Score: 130.183 bits (326), Expect = 5.409e-30
Identity = 140/521 (26.87%), Postives = 225/521 (43.19%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSE-NHKKFFQLSIEKGYPELLILSALNFENVNER-KFHLQLTAFDRG---GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEI-NDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCK---------------------IEIHSTDINDNSP--RIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIP-PMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLE---ASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLV--DHGRPKLTS 2026
            A D DS  NG   Y ++  N +  F+++ + G  EL+       E+V +  +F+L + A D G    +  +++L +     ++N P F   +YR T+ EN      +LQV AK L   EN  +SY      P  + ND F ++   G I    + D E  +  ++   +   +  S   S + +                     I I   D+NDNSP  R      +S+PEN      I ++   D D   N       +  N     S ++S      R  D E  S + + I+  D G P     + ++ I + D+NDN P F  +++   + ED+ +   + Q SA D D G   ++ Y L +    +F I+  +G I     LDRE++    F V ATDGG  E   A+V V I V+DINDN P   + P I  V      G  +  V+  D D G NA + + +   EN+   +  +++ +   + +       S   L L++V  D G P  +S
Sbjct: 1632 AVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI----PAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEI-VYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSS 2146          

HSP 6 Score: 120.939 bits (302), Expect = 6.403e-29
Identity = 107/411 (26.03%), Postives = 183/411 (44.53%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSE---NHKKFFQLSIEKGYPELLILSALNFENVNERKFH-LQLTAFDRGGQ-FETMSLF-ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLL---QKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDSVHNKV---KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNK--EFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPP 1759
            A D D+  NG+  Y+++    + ++ F++    G   + I  AL+FE    ++ H L + A D G Q  ET +   I   D NDN+P    I          + +    +  A+      + K  Y    +T    +  F+L      I L+     LD EI S+  +  ++ A D+G+P L  S  I +  TD+NDN P  E  L + ++ E     T ++ +  HD D   N        +    + +       +  I      D E   + Q+ +   D G+PP+++  ++ + I D NDN PIF ++ +   ++E+  V   + + SA+D D G    + Y + +      EF +  ++G I +   LD E +   EF V ATD GGL  +  + + + D+NDN P
Sbjct:  310 ASDTDADENGLVEYAINRRQSDKEQMFRIDPRTG--AIYINKALDFET---KELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTL--SVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRP 713          

HSP 7 Score: 27.7202 bits (60), Expect = 6.403e-29
Identity = 15/39 (38.46%), Postives = 19/39 (48.72%), Query Frame = 3
Query:  438 TKPAVNFQ-INFEIIDENDNPPKFNQFKFNINVLEEQKI 551
            T P   F  +N  I D NDN P FNQ ++   V E   +
Sbjct:  263 TPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATV 301          

HSP 8 Score: 125.561 bits (314), Expect = 1.580e-28
Identity = 122/443 (27.54%), Postives = 194/443 (43.79%), Query Frame = 2
Query:  770 MSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLD-EGENGKISYRFDTLTPQEINDKFSLNK-------LTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKN-VSIPENKRIATPIMSIYVHDDDSVHNKV---KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFP----IFTRAQHIYQISEDSKVNEFLFQCSATDLDSGN-FGKITYRLDDAGNKEFVINISTGYIYL---YNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            + + +T  D NDN P F          ENT   +    + A+DLD E  N   + R++ ++   +ND F L+        L  ++++   LD E          IEA+D G+P L G   + I   D+NDN P     +   ++PEN  + T ++ +Y  D D+  N +     N+  +D  ++      +  IY+ +  D+E   +H++ +   D G  P+ T   + I + D NDN P    IF       +ISE ++  EF+ + S  D DS   +  +   L + G+  F +      IYL   +  LDRE+       V ATD G   L AS  + + + D+NDNPP  +       V+E    GT +  V   D D+G N+ +T    E  E    +  +      I  +S ID E      L +   D G P L+S
Sbjct:  158 IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYN---TQRYNIVS-GNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPG--YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTL-NGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSS 593          

HSP 9 Score: 119.398 bits (298), Expect = 1.230e-26
Identity = 115/383 (30.03%), Postives = 178/383 (46.48%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSG-SCKIEIHSTDINDNSPRI-EILKNVSIPEN-----KRIATPIMSIYVHDDDSVHNKVKCN---KNSNDNFRLHSSQENSLTIYMERT----FDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLD-DAGNKE--FVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL--------KSPKILTVLENEPIGTLIGNVEVFDLDDG---ENARVTIENEVQENALFYSYLKLDNNKIFIKSL---IDREKVSQIFLRLKLVDHGRPKL 2020
             ++++ TGEI+   KLD E  +     +++ A+      LSG + ++ +   D NDN+P   +   ++  PEN     KR   P   +    D   +N  + N    N ND FRL S +E    +Y++       D E +  + + IE  D G PP+  + ++ I I D NDN PIF ++++   + E++ V   + Q  A+D D+   G + Y ++    +KE  F I+  TG IY+  +LD E KE+ E  V A D G   LE +  VSI V D+NDN P +         SPKI    E+   G  +  + V D D      N  VT+       A     L   +N I++  +   +DRE VS   L +   D G P L
Sbjct:  123 LAIDRATGEIRTKVKLDRETRA----SYSLVAI-----PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDL----DLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKI---SESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFA-----LTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPL 484          

HSP 10 Score: 115.546 bits (288), Expect = 2.080e-25
Identity = 135/539 (25.05%), Postives = 230/539 (42.67%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFE----TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKI------------------EIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYVHDDD------SVHNKVKCNKN---SNDNFR------------LH-------------SSQENSLTIYMERTFDYENSSIHQIDIECF--DSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE--FVINIS-TGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDD--------GENARVTIENEVQENALFYSYLKLD--NNKIFIKSLIDRE 1963
            +A D D  +N    YSL+   +  F +  + G    LI +    +   +  ++  + A D GG++E    T+ + I  +D NDN+PIF    Y   V         +L+VQA D D G N +I Y  +      ++ KF +N  TG +   Q L  E  S +L+   + A D+G+P  S    I                  E +   + +NSP    +L+ V++  + R      S    ++D      S+  +++ NK      D F             LH             ++   S       +F   NS  ++I +      +  P +A+Y  L I + DENDN P F++ Q +  +SE +    F+ Q  A D D+G+  ++ Y + D GN +  FVI  + +G +     LDRE++++ +  + ATD G   +  +  + + ++D+NDN P      ++TV E   +G +I ++   D+D         G  + V IEN         S   LD  + K+ +K  +D E
Sbjct: 1975 SAVDADLGVNARLVYSLANETQWQFAIDGQSG----LITTVGKLDRELQASYNFMVLATD-GGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAEN-SAVSAKFRINPSTGALSASQSLASE--SGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVD-GNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIEN--------MSIFALDRYSGKLVLKRRLDYE 2496          

HSP 11 Score: 94.7449 bits (234), Expect = 4.355e-19
Identity = 115/435 (26.44%), Postives = 192/435 (44.14%), Query Frame = 2
Query:  776 LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLN-KLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDD---SVHNKVKCNKNSN-DNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQ---------HIYQISEDSKVNEFLFQCSATDLDS-GNFGKITYRLDDAGNKEFVINISTGYIYLYNS-LDREVKEMLEFFV--YATDGG--GLEASVKVSITVMDINDNPPR-LKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVD-HGRP 2014
            L I   D NDN P F+   +  TV E       + QV A D D G N ++ Y    +     ++ F +    +G ++    LD EI    + +  I A DEG PQ++G+  I +   D+NDN P       V++ E   +   I SI  +D D   ++  ++      + +N  + +    S  + ++R  DYE    +++D+   D+          L + + DENDN P+F   Q          I +ISE   V+  L   +ATD DS GN  K+ Y ++ A  + F ++ S G + +  S L   V    ++FV   A D G   L++S  + +   D      + L++     + E  P+G+++  +    LD  ++  +   NE  E+A    +  L +  I +   +DRE+     LRL L   HG P
Sbjct: 2308 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYH---IVDGNHDNAFVIEPAFSGIVRTNIVLDREIR--DIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA-QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALD--QSLAIIAGNE--ESA----FELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPP 2725          

HSP 12 Score: 72.0182 bits (175), Expect = 3.407e-12
Identity = 45/166 (27.11%), Postives = 83/166 (50.00%), Query Frame = 2
Query: 1394 PMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL-----DDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENE---PIGTLIGNVEVFDLDDGENARV 1867
            P+ + +   + + DENDN P F   ++++ ++E+  V   +F+  A+DLD G FG++ Y +     D++  K F ++  +G +      D E ++  +  + A+D GG +ASV V + +   ++  P+        VL      P G ++G V   D D G + RV
Sbjct: 2841 PLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRV 3006          

HSP 13 Score: 62.003 bits (149), Expect = 4.002e-12
Identity = 101/426 (23.71%), Postives = 182/426 (42.72%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSE-NHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIF--TDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK--FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSP---------RIEILKNVS-IPENKRIATPIMSIYVHDDDSVHNKVKC---NKNSNDNFRLHSSQENSLTIYMERTFDYENSSI-HQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVIN-ISTGYIYLYNSLDREVKEMLEFFVYATDGGG--------LEASVKVSITVMDINDNPP 1759
            A+D D+  N    Y + + NH   F   IE  +  ++  + +    + +  + L++ A D G      T ++ +  +D NDN+P F   +++   TV E T     I  + A D+D      ++YR    +  +I +   F+L++ +G++ L ++LDYE+   Q  E  + A D           + +   D NDN+P            IL  +S I E+  +   ++++   D DS  N  K     + + + F +H S    +++ M R     +SS  + + I   D+G P + +   L +   D       F + Q+  QISE + +   + Q     LD  +   I      AGN+E     + +  I L   LDRE  ++ +  +  +   G          + + V IT++D NDN P
Sbjct: 2346 AFDSDAGSNARLRYHIVDGNHDNAF--VIEPAFSGIVRTNIVLDREIRD-IYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV---TVSEATELGAVITSISANDVDTYP--ALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYEL--QQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSN-GVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQ-SLAII------AGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP 2750          

HSP 14 Score: 30.0314 bits (66), Expect = 4.002e-12
Identity = 13/27 (48.15%), Postives = 18/27 (66.67%), Query Frame = 3
Query:  459 QINFEIIDENDNPPKFNQFKFNINVLE 539
            ++  E+ DENDN PKF+Q +F   V E
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSE 2333          

HSP 15 Score: 56.9954 bits (136), Expect = 2.249e-9
Identity = 52/197 (26.40%), Postives = 89/197 (45.18%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLS-----ENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIP----ILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKL------DYEIYSD-QLIEFTIEAVDEGSPQLSGSCKIEI 1114
            A DLD    G  NYS+      E+  K F++  E G    L+ SA  F+    +++ ++L A D GG+  ++++ +    R++  P FT+  YR  +       +P    + QV A D D G +G++ Y+         +  F +N+ +G + + +KL      D  +Y D + I   I A       LS    +EI
Sbjct: 2886 ASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG----LVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLP--AAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAP-----HSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVVEI 3071          

HSP 16 Score: 25.7942 bits (55), Expect = 2.249e-9
Identity = 11/23 (47.83%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  441 KPAVNFQ-INFEIIDENDNPPKF 506
            +P  + Q    E+ DENDN PKF
Sbjct: 2840 RPLCSLQPFRLELHDENDNEPKF 2862          

HSP 17 Score: 61.6178 bits (148), Expect = 4.388e-9
Identity = 74/304 (24.34%), Postives = 134/304 (44.08%), Query Frame = 2
Query:  776 LFITTIDRNDNKPIF-TDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSC---KIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDD-----SVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAI-IDENDNF-PIFTRAQHIYQISEDSKVNE--FLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSL 1645
            + IT +D NDN PIF     Y   + E       I Q+QA D D+ EN   S     +T       F+++ +TG + +  +LDY+  +    E  I A D    +   S    ++E+H  D NDN P+  + + V  + EN+ + + +   +  D D      ++  +    +   ++++      S  +     FDYE    + +++   D G        S+ + + I+  D F P FT   + + +     + +   + Q +ATD DSG  G++ Y+L  A +  F +N S+G + +   L
Sbjct: 2738 VIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQ-ENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSY-ELIIRACDSHHQRPLCSLQPFRLELH--DENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG----GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL-SAPHSHFKVNRSSGAVLIKRKL 3032          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 186.037 bits (471), Expect = 3.490e-47
Identity = 172/624 (27.56%), Postives = 293/624 (46.96%), Query Frame = 2
Query:  545 KNYRMSL---PTAYDLDSSINGVYNYSLSENHKKFFQLS-------------IEKGYPELLILSALNFENVNERKFH-LQLTAFDRGGQFETMS---LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDS-VHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG-------------NKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNN--------KIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMD--DCNGSRYFQVNETSGAI 2272
            + Y++SL   P A    SS   V   +   ++  F Q+S             I++   E+ ++   +  +V  +  H L ++A D GG   + +   +F++ ID     PIF    Y   VKE+      +  V A   D      + Y   +  P   +  FS+   +G I++ + LD+E  S  L+   I+A   G P + G  ++ I   D+NDN+P  E  +  +S+PE+  +  P+ + + HD DS    +V  +        L +    S  + + +  DYE+S  H + +   D G+P ++T  ++ + + D NDN P+F + ++   +SE   +N  + Q +A+DLD+GN  +ITYR+ DAG             ++ F I  ++G+IYL   LDRE ++  +  V ATD G     A  +V + V+D NDN P+ +  K    + EN   G+++G V   DLD GENA           A+ YS L ++++        +I  +  +DRE      L ++  D G P  ++   + I + D+NDN P +  P E DV++ R      T+    ++ + A D D  +N  I + I+   D +G   F ++ TSG I
Sbjct:  718 REYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRP-DMLSVRTQPMHMLNISATD-GGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDP---DGYFSIETNSGNIRIAKPLDHEAKSQVLL--NIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENA-----------AIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQE-DVVSVREEQPPGTE----VVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVI 1317          

HSP 2 Score: 168.318 bits (425), Expect = 1.610e-44
Identity = 160/604 (26.49%), Postives = 272/604 (45.03%), Query Frame = 2
Query:  581 LDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKN--VSIPENKRIATPIMSIYVHDDDSVHNKVK----CNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDL----------DSGNFGKITYRLD----DAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG----LEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE--------NEVQENALFYSYLKLDN--NKIFIKSLIDREKVSQIFLRLKLVDHGR---PKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            +D+ ++ V N   S +  + F +    G+  + + + L+ E  +  ++ L + A D G         + +  +D NDN P F    Y   ++EN      +  V A DLD GEN  I Y   +L P  IN  F ++ +TGEI   + LD E+   +L +  +EA D+G+P  S    + IH +D+NDN+P I   +   VS+ E +   T ++ +   D D   N            +D   L S    S  I      D+E  SI+++ +   D G PP  T + L + ++D NDN P FT +  ++++ ED+ +   +   S  +           +S    ++TY L+    D     F I+  +G + +   LDREV+      + A D         +++ V I V D+NDN P   + P  L V E  P+GT+I N    D D G N  +           NE QE A+  S  ++D+    + +++ +D E V +  L ++ +D       +L +  T+ + I+D ND+ P    P+      +   I   T+    +  ++A D D  +NG++ + I    NG   F++N  +G I
Sbjct: 1076 VDAGVDNVTNSISSSDVSQHFGIFPNSGW--IYLRAPLDRETRD--RYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRY---SLLP--INSSFQVHPVTGEISTREPLDRELR--ELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAM--SLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEIT-GGNGEGRFRINSQTGII 1665          

HSP 3 Score: 32.7278 bits (73), Expect = 1.610e-44
Identity = 13/35 (37.14%), Postives = 22/35 (62.86%), Query Frame = 3
Query:  447 AVNFQINFEIIDENDNPPKFNQFKFNINVLEEQKI 551
            + N  I  ++ D NDNPP F + ++++NV E + I
Sbjct: 1017 STNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSI 1051          

HSP 4 Score: 164.081 bits (414), Expect = 2.196e-40
Identity = 152/521 (29.17%), Postives = 244/521 (46.83%), Query Frame = 2
Query:  770 MSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK---FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI--LKNVSIPENKRIATP---IMSIYVHDDDSV--HNKVKCNKNSNDNFRLHSSQENSL-TIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE---FVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARV--TIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIY 2275
            M++ IT  D NDN+PIF    Y  TV EN T    +LQV A D D  ENG + Y  +    +  +DK   F ++  TG I + + LD+E  + +L E  + A D G   L  +  + I  TD+NDN P I +  L + + P+    A P   +  I VHD DS   +  V    N  D     ++++NS+  + +    D E  S + + +   D G PP+   KS+F+ I D NDN P F +  +   + E +     + Q  A D D G    +TY L +        F I+  TG I   + +D E + + +  V A DGG   L ++  V +T+ D+NDN P   +S   ++V ENEP+G  I  V   D D G NA V  TI    +    F   ++  + +I I   +D E+ S     +   D G    T+        +   +++  + YP E  V    S    +   ++ I+ ++A D D+   G++ +RI+   N +  F+++ ++G I+
Sbjct:  270 MTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAIN----RRQSDKEQMFRIDPRTGAIYINKALDFE--TKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEF--EVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAM---IKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIV-AGNEAGIFRIDRSTGEIF 778          

HSP 5 Score: 130.183 bits (326), Expect = 5.409e-30
Identity = 140/521 (26.87%), Postives = 225/521 (43.19%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSE-NHKKFFQLSIEKGYPELLILSALNFENVNER-KFHLQLTAFDRG---GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEI-NDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCK---------------------IEIHSTDINDNSP--RIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIP-PMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLE---ASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLV--DHGRPKLTS 2026
            A D DS  NG   Y ++  N +  F+++ + G  EL+       E+V +  +F+L + A D G    +  +++L +     ++N P F   +YR T+ EN      +LQV AK L   EN  +SY      P  + ND F ++   G I    + D E  +  ++   +   +  S   S + +                     I I   D+NDNSP  R      +S+PEN      I ++   D D   N       +  N     S ++S      R  D E  S + + I+  D G P     + ++ I + D+NDN P F  +++   + ED+ +   + Q SA D D G   ++ Y L +    +F I+  +G I     LDRE++    F V ATDGG  E   A+V V I V+DINDN P   + P I  V      G  +  V+  D D G NA + + +   EN+   +  +++ +   + +       S   L L++V  D G P  +S
Sbjct: 1632 AVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI----PAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEI-VYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSS 2146          

HSP 6 Score: 120.939 bits (302), Expect = 6.403e-29
Identity = 107/411 (26.03%), Postives = 183/411 (44.53%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSE---NHKKFFQLSIEKGYPELLILSALNFENVNERKFH-LQLTAFDRGGQ-FETMSLF-ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLL---QKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDSVHNKV---KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNK--EFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPP 1759
            A D D+  NG+  Y+++    + ++ F++    G   + I  AL+FE    ++ H L + A D G Q  ET +   I   D NDN+P    I          + +    +  A+      + K  Y    +T    +  F+L      I L+     LD EI S+  +  ++ A D+G+P L  S  I +  TD+NDN P  E  L + ++ E     T ++ +  HD D   N        +    + +       +  I      D E   + Q+ +   D G+PP+++  ++ + I D NDN PIF ++ +   ++E+  V   + + SA+D D G    + Y + +      EF +  ++G I +   LD E +   EF V ATD GGL  +  + + + D+NDN P
Sbjct:  310 ASDTDADENGLVEYAINRRQSDKEQMFRIDPRTG--AIYINKALDFET---KELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTL--SVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRP 713          

HSP 7 Score: 27.7202 bits (60), Expect = 6.403e-29
Identity = 15/39 (38.46%), Postives = 19/39 (48.72%), Query Frame = 3
Query:  438 TKPAVNFQ-INFEIIDENDNPPKFNQFKFNINVLEEQKI 551
            T P   F  +N  I D NDN P FNQ ++   V E   +
Sbjct:  263 TPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATV 301          

HSP 8 Score: 125.561 bits (314), Expect = 1.580e-28
Identity = 122/443 (27.54%), Postives = 194/443 (43.79%), Query Frame = 2
Query:  770 MSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLD-EGENGKISYRFDTLTPQEINDKFSLNK-------LTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKN-VSIPENKRIATPIMSIYVHDDDSVHNKV---KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFP----IFTRAQHIYQISEDSKVNEFLFQCSATDLDSGN-FGKITYRLDDAGNKEFVINISTGYIYL---YNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            + + +T  D NDN P F          ENT   +    + A+DLD E  N   + R++ ++   +ND F L+        L  ++++   LD E          IEA+D G+P L G   + I   D+NDN P     +   ++PEN  + T ++ +Y  D D+  N +     N+  +D  ++      +  IY+ +  D+E   +H++ +   D G  P+ T   + I + D NDN P    IF       +ISE ++  EF+ + S  D DS   +  +   L + G+  F +      IYL   +  LDRE+       V ATD G   L AS  + + + D+NDNPP  +       V+E    GT +  V   D D+G N+ +T    E  E    +  +      I  +S ID E      L +   D G P L+S
Sbjct:  158 IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYN---TQRYNIVS-GNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPG--YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTL-NGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSS 593          

HSP 9 Score: 119.398 bits (298), Expect = 1.230e-26
Identity = 115/383 (30.03%), Postives = 178/383 (46.48%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSG-SCKIEIHSTDINDNSPRI-EILKNVSIPEN-----KRIATPIMSIYVHDDDSVHNKVKCN---KNSNDNFRLHSSQENSLTIYMERT----FDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLD-DAGNKE--FVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL--------KSPKILTVLENEPIGTLIGNVEVFDLDDG---ENARVTIENEVQENALFYSYLKLDNNKIFIKSL---IDREKVSQIFLRLKLVDHGRPKL 2020
             ++++ TGEI+   KLD E  +     +++ A+      LSG + ++ +   D NDN+P   +   ++  PEN     KR   P   +    D   +N  + N    N ND FRL S +E    +Y++       D E +  + + IE  D G PP+  + ++ I I D NDN PIF ++++   + E++ V   + Q  A+D D+   G + Y ++    +KE  F I+  TG IY+  +LD E KE+ E  V A D G   LE +  VSI V D+NDN P +         SPKI    E+   G  +  + V D D      N  VT+       A     L   +N I++  +   +DRE VS   L +   D G P L
Sbjct:  123 LAIDRATGEIRTKVKLDRETRA----SYSLVAI-----PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDL----DLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKI---SESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFA-----LTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPL 484          

HSP 10 Score: 115.546 bits (288), Expect = 2.080e-25
Identity = 135/539 (25.05%), Postives = 230/539 (42.67%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFE----TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKI------------------EIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYVHDDD------SVHNKVKCNKN---SNDNFR------------LH-------------SSQENSLTIYMERTFDYENSSIHQIDIECF--DSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE--FVINIS-TGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDD--------GENARVTIENEVQENALFYSYLKLD--NNKIFIKSLIDRE 1963
            +A D D  +N    YSL+   +  F +  + G    LI +    +   +  ++  + A D GG++E    T+ + I  +D NDN+PIF    Y   V         +L+VQA D D G N +I Y  +      ++ KF +N  TG +   Q L  E  S +L+   + A D+G+P  S    I                  E +   + +NSP    +L+ V++  + R      S    ++D      S+  +++ NK      D F             LH             ++   S       +F   NS  ++I +      +  P +A+Y  L I + DENDN P F++ Q +  +SE +    F+ Q  A D D+G+  ++ Y + D GN +  FVI  + +G +     LDRE++++ +  + ATD G   +  +  + + ++D+NDN P      ++TV E   +G +I ++   D+D         G  + V IEN         S   LD  + K+ +K  +D E
Sbjct: 1975 SAVDADLGVNARLVYSLANETQWQFAIDGQSG----LITTVGKLDRELQASYNFMVLATD-GGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAEN-SAVSAKFRINPSTGALSASQSLASE--SGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVD-GNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIEN--------MSIFALDRYSGKLVLKRRLDYE 2496          

HSP 11 Score: 94.7449 bits (234), Expect = 4.355e-19
Identity = 115/435 (26.44%), Postives = 192/435 (44.14%), Query Frame = 2
Query:  776 LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLN-KLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDD---SVHNKVKCNKNSN-DNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQ---------HIYQISEDSKVNEFLFQCSATDLDS-GNFGKITYRLDDAGNKEFVINISTGYIYLYNS-LDREVKEMLEFFV--YATDGG--GLEASVKVSITVMDINDNPPR-LKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVD-HGRP 2014
            L I   D NDN P F+   +  TV E       + QV A D D G N ++ Y    +     ++ F +    +G ++    LD EI    + +  I A DEG PQ++G+  I +   D+NDN P       V++ E   +   I SI  +D D   ++  ++      + +N  + +    S  + ++R  DYE    +++D+   D+          L + + DENDN P+F   Q          I +ISE   V+  L   +ATD DS GN  K+ Y ++ A  + F ++ S G + +  S L   V    ++FV   A D G   L++S  + +   D      + L++     + E  P+G+++  +    LD  ++  +   NE  E+A    +  L +  I +   +DRE+     LRL L   HG P
Sbjct: 2308 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYH---IVDGNHDNAFVIEPAFSGIVRTNIVLDREIR--DIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA-QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALD--QSLAIIAGNE--ESA----FELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPP 2725          

HSP 12 Score: 72.0182 bits (175), Expect = 3.407e-12
Identity = 45/166 (27.11%), Postives = 83/166 (50.00%), Query Frame = 2
Query: 1394 PMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL-----DDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENE---PIGTLIGNVEVFDLDDGENARV 1867
            P+ + +   + + DENDN P F   ++++ ++E+  V   +F+  A+DLD G FG++ Y +     D++  K F ++  +G +      D E ++  +  + A+D GG +ASV V + +   ++  P+        VL      P G ++G V   D D G + RV
Sbjct: 2841 PLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRV 3006          

HSP 13 Score: 62.003 bits (149), Expect = 4.002e-12
Identity = 101/426 (23.71%), Postives = 182/426 (42.72%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSE-NHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIF--TDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK--FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSP---------RIEILKNVS-IPENKRIATPIMSIYVHDDDSVHNKVKC---NKNSNDNFRLHSSQENSLTIYMERTFDYENSSI-HQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVIN-ISTGYIYLYNSLDREVKEMLEFFVYATDGGG--------LEASVKVSITVMDINDNPP 1759
            A+D D+  N    Y + + NH   F   IE  +  ++  + +    + +  + L++ A D G      T ++ +  +D NDN+P F   +++   TV E T     I  + A D+D      ++YR    +  +I +   F+L++ +G++ L ++LDYE+   Q  E  + A D           + +   D NDN+P            IL  +S I E+  +   ++++   D DS  N  K     + + + F +H S    +++ M R     +SS  + + I   D+G P + +   L +   D       F + Q+  QISE + +   + Q     LD  +   I      AGN+E     + +  I L   LDRE  ++ +  +  +   G          + + V IT++D NDN P
Sbjct: 2346 AFDSDAGSNARLRYHIVDGNHDNAF--VIEPAFSGIVRTNIVLDREIRD-IYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV---TVSEATELGAVITSISANDVDTYP--ALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYEL--QQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSN-GVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQ-SLAII------AGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP 2750          

HSP 14 Score: 30.0314 bits (66), Expect = 4.002e-12
Identity = 13/27 (48.15%), Postives = 18/27 (66.67%), Query Frame = 3
Query:  459 QINFEIIDENDNPPKFNQFKFNINVLE 539
            ++  E+ DENDN PKF+Q +F   V E
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSE 2333          

HSP 15 Score: 56.9954 bits (136), Expect = 2.249e-9
Identity = 52/197 (26.40%), Postives = 89/197 (45.18%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLS-----ENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIP----ILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKL------DYEIYSD-QLIEFTIEAVDEGSPQLSGSCKIEI 1114
            A DLD    G  NYS+      E+  K F++  E G    L+ SA  F+    +++ ++L A D GG+  ++++ +    R++  P FT+  YR  +       +P    + QV A D D G +G++ Y+         +  F +N+ +G + + +KL      D  +Y D + I   I A       LS    +EI
Sbjct: 2886 ASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG----LVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLP--AAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAP-----HSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVVEI 3071          

HSP 16 Score: 25.7942 bits (55), Expect = 2.249e-9
Identity = 11/23 (47.83%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  441 KPAVNFQ-INFEIIDENDNPPKF 506
            +P  + Q    E+ DENDN PKF
Sbjct: 2840 RPLCSLQPFRLELHDENDNEPKF 2862          

HSP 17 Score: 61.6178 bits (148), Expect = 4.388e-9
Identity = 74/304 (24.34%), Postives = 134/304 (44.08%), Query Frame = 2
Query:  776 LFITTIDRNDNKPIF-TDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSC---KIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDD-----SVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAI-IDENDNF-PIFTRAQHIYQISEDSKVNE--FLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSL 1645
            + IT +D NDN PIF     Y   + E       I Q+QA D D+ EN   S     +T       F+++ +TG + +  +LDY+  +    E  I A D    +   S    ++E+H  D NDN P+  + + V  + EN+ + + +   +  D D      ++  +    +   ++++      S  +     FDYE    + +++   D G        S+ + + I+  D F P FT   + + +     + +   + Q +ATD DSG  G++ Y+L  A +  F +N S+G + +   L
Sbjct: 2738 VIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQ-ENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSY-ELIIRACDSHHQRPLCSLQPFRLELH--DENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG----GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL-SAPHSHFKVNRSSGAVLIKRKL 3032          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 166.777 bits (421), Expect = 6.960e-44
Identity = 146/502 (29.08%), Postives = 231/502 (46.02%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHD---DDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD------AGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            A D D   N    Y++   + +  Q SI+    ++ ++  L++E+V  R + L + A D G   +  T  L +  ID NDN P F    ++++V EN      I++VQA D DEG N +I+Y   +++ ++ N   +++  TG ++ ++ LD E        F + A D G P  S S  + I   D+NDN P         ++ E++   TP+ ++   D   D  +H ++    N+   F + +SQ     I + ++ DY+      + +   DSG    +   ++ I I D N+  PIF  A +   + ED+ V   +   SATD D G   +ITY L++           F IN  TG I     LDRE        V A DGG   L  +  V I V D+NDN P  KSP    ++LE+  +GT +  V   D D G N R+   + +   E+  F   +   +  I     +DRE V+   L    VD G P L+S
Sbjct:  608 ATDADQGNNAAIRYAIIGGNTQS-QFSIDSMSGDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITY---SISERDDNFPLAVDPRTGWVQTIKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT-TGNTRGRFAI-TSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF--VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSS 1095          

HSP 2 Score: 31.9574 bits (71), Expect = 6.960e-44
Identity = 11/38 (28.95%), Postives = 23/38 (60.53%), Query Frame = 3
Query:  432 QSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQ 545
            QS +      +  +++D+NDN P+F++  + + V E+Q
Sbjct:  557 QSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQ 594          

HSP 3 Score: 151.369 bits (381), Expect = 2.470e-38
Identity = 138/479 (28.81%), Postives = 217/479 (45.30%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGE--IKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDD-SVHNKVKCNKNSNDNFRLHSSQENSL-----TIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG--NKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDR 1960
            AYD D   N    YS+SE     F L+++     +  +  L+ E   + +F  Q+ A D G   +  + S+ IT  D NDN P F    Y   V E+     P+  V A D D  E+ ++ Y    +T      +F++    G   I + Q LDY+   ++    T+ A D G    S +  + I+ TD N+ +P  E    + S+ E+  + T ++ +   D D  V+ ++  + N      L S    S+      I      D E +S + + +   D G P ++    + I + D NDN P F    +   I ED+ V   + Q +A+D D G  G+I Y L D    +  FVI+ ++G I     LDRE   +      A D G   L ++V+V I + D+ND+PP   S KI L V EN P+G+++G +   D D+G NA V            YS +  D++  F  SL+ R
Sbjct:  713 AYDSDEGANAEITYSISERDDN-FPLAVDPRTGWVQTIKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYE---ITTGNTRGRFAITSQNGRGLITIAQSLDYK--QEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVV-----------HYSIIGGDDSNAF--SLVTR 1166          

HSP 4 Score: 28.8758 bits (63), Expect = 2.470e-38
Identity = 12/27 (44.44%), Postives = 17/27 (62.96%), Query Frame = 3
Query:  459 QINFEIIDENDNPPKFNQFKFNINVLE 539
            Q+   +ID NDN P+F   +F  +VLE
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLE 700          

HSP 5 Score: 144.436 bits (363), Expect = 2.436e-34
Identity = 146/537 (27.19%), Postives = 236/537 (43.95%), Query Frame = 2
Query:  722 FHLQLTAFD-RGGQFE----TMSLFITTIDRNDNKPIFTDILYRKTVKENT---TYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK--VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIST----GYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLK-SPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYS---YLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            +HL +TA D    Q E    T S+ +  +D NDN P F++  Y   V E+    T    +  ++A D D+G N  I Y    +       +FS++ ++G++ L++ LDYE  S +     I A D GSP  S + ++ ++  D NDN+PR    +   S+ EN  +   I+ +  +D D   N          +DNF L         +   +  D E        +   D G+PP +   S+ I + D NDN P F    +   + ED      +   +ATD D  +  ++ Y +   GN      I++    G I +  SLD + ++     V ATD GG   +  V I + D N+  P  + +P   +V E+ P+GT +  V   D D G NA++T   NE   N L       +      I   + +DRE  S   L +   D G P L+    + I + D+NDN P  + P        ++ I  +    + ++ + A D D   NG+I++ + D       F ++ TSG I
Sbjct:  544 YHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY---AIIGGNTQSQFSIDSMSGDVSLVKPLDYE--SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEIT-TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL------YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTI 1065          

HSP 6 Score: 132.494 bits (332), Expect = 1.076e-31
Identity = 119/426 (27.93%), Postives = 198/426 (46.48%), Query Frame = 2
Query:  626 NHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEIN-----DKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIE-ILKNVSIPENKRIATPIMSIYVHDDD-SVHNKVKCNKNSND----NFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL---DDAGNKEFVINIST--GYIYLYNSLDRE-VKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKIL--TVLENEPIGTLIGNVEVFDLD 1846
            N +  F ++ + G   + I  +L+++   E++F L + A D GG+ +T ++ I   D N+  PIF +  Y  +V E+      +L V A D D G N +I+Y   +L  + IN     D FS+N  TG I     LD E  S  L+  T+ A D G+P LS +  +EI  TD+NDN+P  +  L   SI E+  + T ++ +   D D  ++ ++K   +  D    +F +  +   S TI   +  D E+ ++  +     D G PP+++   + I + D ND+ P F   +    + E+S V   + +  A D D G    + Y +   DD+     V    +    +     LD E  ++  E  V A     L     + I V D+NDN P L+  +++     ++ P G  IG +  FD D
Sbjct:  835 NTRGRFAITSQNGRGLITIAQSLDYKQ--EKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITY---SLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLL--TVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPT---SGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS-PPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGE-IGRIPAFDAD 1248          

HSP 7 Score: 25.409 bits (54), Expect = 1.076e-31
Identity = 11/22 (50.00%), Postives = 13/22 (59.09%), Query Frame = 3
Query:  480 DENDNPPKFNQFKFNINVLEEQ 545
            D NDN P FN   +  NV E+Q
Sbjct:  786 DVNDNDPAFNPKYYEANVGEDQ 807          

HSP 8 Score: 119.013 bits (297), Expect = 1.521e-26
Identity = 111/393 (28.24%), Postives = 176/393 (44.78%), Query Frame = 2
Query:  767 TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLT-------PQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQ---LSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIAT---PIMSIYVHDDDSVHNK----VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDA-GNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI--LTVLENEPIGTLIGNVEVFDLDDGENARVTIE 1876
            T +L +  +D ND+ P F    +  +++E  T    ++ ++A D D G+N +I Y  + +T        QE+   F ++  +G I     LD E  SD      + A D  S Q    + +  +++   D NDN P+  E    V +PE++   T    +  I   D D  +N          N+   F + S    S  + + +  DYE+   +++ I   D G P  +    L + +ID NDN P F  +Q    + E+  V   + +  A D D G   +ITY + +   N    ++  TG++     LDRE +    F V A DGG     AS  V ITV D+NDN P   +PK     V E++P GT +  V   D D  E++R+  E
Sbjct:  447 TTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEM-PIFRIDSRSGVISTRSSLDRET-SDSY-HLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSM---SGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF-NPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYE 830          

HSP 9 Score: 69.707 bits (169), Expect = 1.623e-11
Identity = 67/251 (26.69%), Postives = 103/251 (41.04%), Query Frame = 2
Query: 1328 TFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL----DDAGNKE------FVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLE-----ASVKVSITVMDINDNPPRLKSPK-ILTVLENEPIGT---LIGNVEVFDLDDGENARVT---IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRP 2014
            + D E   +H   +   D   PP +   +L + ++D ND+ P F   Q    I E + V   +    ATD D G   +I Y +    D AG  +      F I+  +G I   +SLDRE  +     V A D    +     A+  V + V+D NDN P+       + V E++  GT    + ++   D D G NA +    I    Q     +S   +  +   +K L D E V    L ++  D G P
Sbjct:  421 SLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ---FSIDSMSGDVSLVKPL-DYESVRSYRLVIRAQDGGSP 667          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 166.777 bits (421), Expect = 7.018e-44
Identity = 146/502 (29.08%), Postives = 231/502 (46.02%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHD---DDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD------AGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            A D D   N    Y++   + +  Q SI+    ++ ++  L++E+V  R + L + A D G   +  T  L +  ID NDN P F    ++++V EN      I++VQA D DEG N +I+Y   +++ ++ N   +++  TG ++ ++ LD E        F + A D G P  S S  + I   D+NDN P         ++ E++   TP+ ++   D   D  +H ++    N+   F + +SQ     I + ++ DY+      + +   DSG    +   ++ I I D N+  PIF  A +   + ED+ V   +   SATD D G   +ITY L++           F IN  TG I     LDRE        V A DGG   L  +  V I V D+NDN P  KSP    ++LE+  +GT +  V   D D G N R+   + +   E+  F   +   +  I     +DRE V+   L    VD G P L+S
Sbjct:  608 ATDADQGNNAAIRYAIIGGNTQS-QFSIDSMSGDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITY---SISERDDNFPLAVDPRTGWVQTIKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT-TGNTRGRFAI-TSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF--VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSS 1095          

HSP 2 Score: 31.9574 bits (71), Expect = 7.018e-44
Identity = 11/38 (28.95%), Postives = 23/38 (60.53%), Query Frame = 3
Query:  432 QSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQ 545
            QS +      +  +++D+NDN P+F++  + + V E+Q
Sbjct:  557 QSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQ 594          

HSP 3 Score: 151.754 bits (382), Expect = 2.312e-38
Identity = 138/479 (28.81%), Postives = 217/479 (45.30%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGE--IKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDD-SVHNKVKCNKNSNDNFRLHSSQENSL-----TIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG--NKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDR 1960
            AYD D   N    YS+SE     F L+++     +  +  L+ E   + +F  Q+ A D G   +  + S+ IT  D NDN P F    Y   V E+     P+  V A D D  E+ ++ Y    +T      +F++    G   I + Q LDY+   ++    T+ A D G    S +  + I+ TD N+ +P  E    + S+ E+  + T ++ +   D D  V+ ++  + N      L S    S+      I      D E +S + + +   D G P ++    + I + D NDN P F    +   I ED+ V   + Q +A+D D G  G+I Y L D    +  FVI+ ++G I     LDRE   +      A D G   L ++V+V I + D+ND+PP   S KI L V EN P+G+++G +   D D+G NA V            YS +  D++  F  SL+ R
Sbjct:  713 AYDSDEGANAEITYSISERDDN-FPLAVDPRTGWVQTIKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYE---ITTGNTRGRFAITSQNGRGLITIAQSLDYK--QEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVV-----------HYSIIGGDDSNAF--SLVTR 1166          

HSP 4 Score: 28.8758 bits (63), Expect = 2.312e-38
Identity = 12/27 (44.44%), Postives = 17/27 (62.96%), Query Frame = 3
Query:  459 QINFEIIDENDNPPKFNQFKFNINVLE 539
            Q+   +ID NDN P+F   +F  +VLE
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLE 700          

HSP 5 Score: 144.821 bits (364), Expect = 2.218e-34
Identity = 146/537 (27.19%), Postives = 236/537 (43.95%), Query Frame = 2
Query:  722 FHLQLTAFD-RGGQFE----TMSLFITTIDRNDNKPIFTDILYRKTVKENT---TYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK--VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIST----GYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLK-SPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYS---YLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            +HL +TA D    Q E    T S+ +  +D NDN P F++  Y   V E+    T    +  ++A D D+G N  I Y    +       +FS++ ++G++ L++ LDYE  S +     I A D GSP  S + ++ ++  D NDN+PR    +   S+ EN  +   I+ +  +D D   N          +DNF L         +   +  D E        +   D G+PP +   S+ I + D NDN P F    +   + ED      +   +ATD D  +  ++ Y +   GN      I++    G I +  SLD + ++     V ATD GG   +  V I + D N+  P  + +P   +V E+ P+GT +  V   D D G NA++T   NE   N L       +      I   + +DRE  S   L +   D G P L+    + I + D+NDN P  + P        ++ I  +    + ++ + A D D   NG+I++ + D       F ++ TSG I
Sbjct:  544 YHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY---AIIGGNTQSQFSIDSMSGDVSLVKPLDYE--SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEIT-TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL------YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTI 1065          

HSP 6 Score: 132.494 bits (332), Expect = 1.050e-31
Identity = 119/426 (27.93%), Postives = 198/426 (46.48%), Query Frame = 2
Query:  626 NHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEIN-----DKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIE-ILKNVSIPENKRIATPIMSIYVHDDD-SVHNKVKCNKNSND----NFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL---DDAGNKEFVINIST--GYIYLYNSLDRE-VKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKIL--TVLENEPIGTLIGNVEVFDLD 1846
            N +  F ++ + G   + I  +L+++   E++F L + A D GG+ +T ++ I   D N+  PIF +  Y  +V E+      +L V A D D G N +I+Y   +L  + IN     D FS+N  TG I     LD E  S  L+  T+ A D G+P LS +  +EI  TD+NDN+P  +  L   SI E+  + T ++ +   D D  ++ ++K   +  D    +F +  +   S TI   +  D E+ ++  +     D G PP+++   + I + D ND+ P F   +    + E+S V   + +  A D D G    + Y +   DD+     V    +    +     LD E  ++  E  V A     L     + I V D+NDN P L+  +++     ++ P G  IG +  FD D
Sbjct:  835 NTRGRFAITSQNGRGLITIAQSLDYKQ--EKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITY---SLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLL--TVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPT---SGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS-PPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGE-IGRIPAFDAD 1248          

HSP 7 Score: 25.409 bits (54), Expect = 1.050e-31
Identity = 11/22 (50.00%), Postives = 13/22 (59.09%), Query Frame = 3
Query:  480 DENDNPPKFNQFKFNINVLEEQ 545
            D NDN P FN   +  NV E+Q
Sbjct:  786 DVNDNDPAFNPKYYEANVGEDQ 807          

HSP 8 Score: 119.013 bits (297), Expect = 1.483e-26
Identity = 108/391 (27.62%), Postives = 175/391 (44.76%), Query Frame = 2
Query:  767 TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLT-------PQEINDKFSLNKLTGEIKLLQKLDYEIY-SDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIAT---PIMSIYVHDDDSVHNK----VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDA-GNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI--LTVLENEPIGTLIGNVEVFDLDDGENARVTIE 1876
            T +L +  +D ND+ P F    +  +++E  T    ++ ++A D D G+N +I Y  + +T        QE+   F ++  +G I     LD E   S  L+    +     S + + +  +++   D NDN P+  E    V +PE++   T    +  I   D D  +N          N+   F + S    S  + + +  DYE+   +++ I   D G P  +    L + +ID NDN P F  +Q    + E+  V   + +  A D D G   +ITY + +   N    ++  TG++     LDRE +    F V A DGG     AS  V ITV D+NDN P   +PK     V E++P GT +  V   D D  E++R+  E
Sbjct:  447 TTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEM-PIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSM---SGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF-NPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYE 830          

HSP 9 Score: 69.707 bits (169), Expect = 1.665e-11
Identity = 67/251 (26.69%), Postives = 103/251 (41.04%), Query Frame = 2
Query: 1328 TFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL----DDAGNKE------FVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLE-----ASVKVSITVMDINDNPPRLKSPK-ILTVLENEPIGT---LIGNVEVFDLDDGENARVT---IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRP 2014
            + D E   +H   +   D   PP +   +L + ++D ND+ P F   Q    I E + V   +    ATD D G   +I Y +    D AG  +      F I+  +G I   +SLDRE  +     V A D    +     A+  V + V+D NDN P+       + V E++  GT    + ++   D D G NA +    I    Q     +S   +  +   +K L D E V    L ++  D G P
Sbjct:  421 SLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ---FSIDSMSGDVSLVKPL-DYESVRSYRLVIRAQDGGSP 667          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 166.777 bits (421), Expect = 7.018e-44
Identity = 146/502 (29.08%), Postives = 231/502 (46.02%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHD---DDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD------AGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            A D D   N    Y++   + +  Q SI+    ++ ++  L++E+V  R + L + A D G   +  T  L +  ID NDN P F    ++++V EN      I++VQA D DEG N +I+Y   +++ ++ N   +++  TG ++ ++ LD E        F + A D G P  S S  + I   D+NDN P         ++ E++   TP+ ++   D   D  +H ++    N+   F + +SQ     I + ++ DY+      + +   DSG    +   ++ I I D N+  PIF  A +   + ED+ V   +   SATD D G   +ITY L++           F IN  TG I     LDRE        V A DGG   L  +  V I V D+NDN P  KSP    ++LE+  +GT +  V   D D G N R+   + +   E+  F   +   +  I     +DRE V+   L    VD G P L+S
Sbjct:  608 ATDADQGNNAAIRYAIIGGNTQS-QFSIDSMSGDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITY---SISERDDNFPLAVDPRTGWVQTIKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT-TGNTRGRFAI-TSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF--VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSS 1095          

HSP 2 Score: 31.9574 bits (71), Expect = 7.018e-44
Identity = 11/38 (28.95%), Postives = 23/38 (60.53%), Query Frame = 3
Query:  432 QSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQ 545
            QS +      +  +++D+NDN P+F++  + + V E+Q
Sbjct:  557 QSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQ 594          

HSP 3 Score: 151.754 bits (382), Expect = 2.312e-38
Identity = 138/479 (28.81%), Postives = 217/479 (45.30%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGE--IKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDD-SVHNKVKCNKNSNDNFRLHSSQENSL-----TIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG--NKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDR 1960
            AYD D   N    YS+SE     F L+++     +  +  L+ E   + +F  Q+ A D G   +  + S+ IT  D NDN P F    Y   V E+     P+  V A D D  E+ ++ Y    +T      +F++    G   I + Q LDY+   ++    T+ A D G    S +  + I+ TD N+ +P  E    + S+ E+  + T ++ +   D D  V+ ++  + N      L S    S+      I      D E +S + + +   D G P ++    + I + D NDN P F    +   I ED+ V   + Q +A+D D G  G+I Y L D    +  FVI+ ++G I     LDRE   +      A D G   L ++V+V I + D+ND+PP   S KI L V EN P+G+++G +   D D+G NA V            YS +  D++  F  SL+ R
Sbjct:  713 AYDSDEGANAEITYSISERDDN-FPLAVDPRTGWVQTIKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYE---ITTGNTRGRFAITSQNGRGLITIAQSLDYK--QEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVV-----------HYSIIGGDDSNAF--SLVTR 1166          

HSP 4 Score: 28.8758 bits (63), Expect = 2.312e-38
Identity = 12/27 (44.44%), Postives = 17/27 (62.96%), Query Frame = 3
Query:  459 QINFEIIDENDNPPKFNQFKFNINVLE 539
            Q+   +ID NDN P+F   +F  +VLE
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLE 700          

HSP 5 Score: 144.821 bits (364), Expect = 2.218e-34
Identity = 146/537 (27.19%), Postives = 236/537 (43.95%), Query Frame = 2
Query:  722 FHLQLTAFD-RGGQFE----TMSLFITTIDRNDNKPIFTDILYRKTVKENT---TYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK--VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIST----GYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLK-SPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYS---YLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            +HL +TA D    Q E    T S+ +  +D NDN P F++  Y   V E+    T    +  ++A D D+G N  I Y    +       +FS++ ++G++ L++ LDYE  S +     I A D GSP  S + ++ ++  D NDN+PR    +   S+ EN  +   I+ +  +D D   N          +DNF L         +   +  D E        +   D G+PP +   S+ I + D NDN P F    +   + ED      +   +ATD D  +  ++ Y +   GN      I++    G I +  SLD + ++     V ATD GG   +  V I + D N+  P  + +P   +V E+ P+GT +  V   D D G NA++T   NE   N L       +      I   + +DRE  S   L +   D G P L+    + I + D+NDN P  + P        ++ I  +    + ++ + A D D   NG+I++ + D       F ++ TSG I
Sbjct:  544 YHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY---AIIGGNTQSQFSIDSMSGDVSLVKPLDYE--SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEIT-TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL------YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTI 1065          

HSP 6 Score: 132.494 bits (332), Expect = 1.050e-31
Identity = 119/426 (27.93%), Postives = 198/426 (46.48%), Query Frame = 2
Query:  626 NHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEIN-----DKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIE-ILKNVSIPENKRIATPIMSIYVHDDD-SVHNKVKCNKNSND----NFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL---DDAGNKEFVINIST--GYIYLYNSLDRE-VKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKIL--TVLENEPIGTLIGNVEVFDLD 1846
            N +  F ++ + G   + I  +L+++   E++F L + A D GG+ +T ++ I   D N+  PIF +  Y  +V E+      +L V A D D G N +I+Y   +L  + IN     D FS+N  TG I     LD E  S  L+  T+ A D G+P LS +  +EI  TD+NDN+P  +  L   SI E+  + T ++ +   D D  ++ ++K   +  D    +F +  +   S TI   +  D E+ ++  +     D G PP+++   + I + D ND+ P F   +    + E+S V   + +  A D D G    + Y +   DD+     V    +    +     LD E  ++  E  V A     L     + I V D+NDN P L+  +++     ++ P G  IG +  FD D
Sbjct:  835 NTRGRFAITSQNGRGLITIAQSLDYKQ--EKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITY---SLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLL--TVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPT---SGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS-PPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGE-IGRIPAFDAD 1248          

HSP 7 Score: 25.409 bits (54), Expect = 1.050e-31
Identity = 11/22 (50.00%), Postives = 13/22 (59.09%), Query Frame = 3
Query:  480 DENDNPPKFNQFKFNINVLEEQ 545
            D NDN P FN   +  NV E+Q
Sbjct:  786 DVNDNDPAFNPKYYEANVGEDQ 807          

HSP 8 Score: 119.013 bits (297), Expect = 1.483e-26
Identity = 108/391 (27.62%), Postives = 175/391 (44.76%), Query Frame = 2
Query:  767 TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLT-------PQEINDKFSLNKLTGEIKLLQKLDYEIY-SDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIAT---PIMSIYVHDDDSVHNK----VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDA-GNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI--LTVLENEPIGTLIGNVEVFDLDDGENARVTIE 1876
            T +L +  +D ND+ P F    +  +++E  T    ++ ++A D D G+N +I Y  + +T        QE+   F ++  +G I     LD E   S  L+    +     S + + +  +++   D NDN P+  E    V +PE++   T    +  I   D D  +N          N+   F + S    S  + + +  DYE+   +++ I   D G P  +    L + +ID NDN P F  +Q    + E+  V   + +  A D D G   +ITY + +   N    ++  TG++     LDRE +    F V A DGG     AS  V ITV D+NDN P   +PK     V E++P GT +  V   D D  E++R+  E
Sbjct:  447 TTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEM-PIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSM---SGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF-NPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYE 830          

HSP 9 Score: 69.707 bits (169), Expect = 1.665e-11
Identity = 67/251 (26.69%), Postives = 103/251 (41.04%), Query Frame = 2
Query: 1328 TFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL----DDAGNKE------FVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLE-----ASVKVSITVMDINDNPPRLKSPK-ILTVLENEPIGT---LIGNVEVFDLDDGENARVT---IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRP 2014
            + D E   +H   +   D   PP +   +L + ++D ND+ P F   Q    I E + V   +    ATD D G   +I Y +    D AG  +      F I+  +G I   +SLDRE  +     V A D    +     A+  V + V+D NDN P+       + V E++  GT    + ++   D D G NA +    I    Q     +S   +  +   +K L D E V    L ++  D G P
Sbjct:  421 SLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ---FSIDSMSGDVSLVKPL-DYESVRSYRLVIRAQDGGSP 667          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Zebrafish
Match: pcdh2ab6 (protocadherin 2 alpha b 6 [Source:ZFIN;Acc:ZDB-GENE-041118-5])

HSP 1 Score: 206.453 bits (524), Expect = 1.615e-58
Identity = 166/516 (32.17%), Postives = 259/516 (50.19%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI--LKNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFV-----INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSP--KILTV-LENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R SLP+A D D  +N V +Y LS +  + F L ++ G       EL++  AL+ E   +    L LTA D G   +  T+++ +  ID NDN P+FT  LY+  + EN      ++ V AKD D GENG+I Y F      +  + F++NK TGEI +L KLD+E  S+  IE  ++A D+GS      CK+ +   D+NDN P I +  L NV + E     T +  I V DDDS  N  VK     +  F L ++ +N  ++ ++   D E +S + + I   D G PP+++   + + + D NDN P F        + E+S++   L   SA D D G+  +ITY L ++     V     IN  TG ++   S + E  +  EF V ATD G   L ++V V++ V+D NDN P + +P  ++ +V  EN P     G  +  +   D D G NA ++   +E + N LF   +   + +I  K  +    +    L + + D+G P L++
Sbjct:  148 RYSLPSADDADVGVNSVKSYKLSAS--EHFSLDVQSGGEQSVSAELVLQKALDREK--QPVIRLTLTAVDGGKPQRSGTVNIIVNVIDVNDNIPVFTKSLYKARILENAPAGFSVITVNAKDADAGENGEIEYSFIKHGNNKNIESFAINKETGEITVLGKLDHE--SNNAIEIRVQARDKGSTPRVAHCKVLVEIMDVNDNIPEISVTSLINV-VKEGSPKGTMVGLITVKDDDSGENGSVKLKILDSLPFVLQNTYKNKYSLVVDGPLDRERASEYNVTISAADEGSPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYHISEPKGNNLF--RIGTSSGEIRTKRRMSDNDLKTHPLVILVCDNGEPSLSA 654          

HSP 2 Score: 41.5874 bits (96), Expect = 1.615e-58
Identity = 49/170 (28.82%), Postives = 73/170 (42.94%), Query Frame = 3
Query:   63 SDYSKTKSEIQMVLFHVIFCIS---LADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHI--IVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQKIIE 557
            S   + K  I ++L +++  IS   +A +++EE S            T VGNI K LN  L    +    IVG +       +F +     I   K  D+ +REEICG         C  +  AI+N     P   ++    ++D NDNPP F     ++NV E   I E
Sbjct:    4 SARERNKLWIYIILLNILPRISSGQIAFSVSEEAS----------PGTTVGNIVKELNLNLQELEHRGFQIVGPN-----KRYFDVNMKTGIFQIK--DKLDREEICG-----QSLKCALELEAIVN----SPLNMYRFEVNVLDINDNPPTFPSSSLHLNVSEAAFIGE 147          

HSP 3 Score: 129.798 bits (325), Expect = 5.724e-30
Identity = 126/459 (27.45%), Postives = 218/459 (47.49%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNKVKCNK-NSNDNFRL--HSSQENSLT--IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGN----KEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLE--ASVKVSITVMDINDNPPRLKSPKILTVL-ENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNK--IFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDCNG---SRYFQVNETSGAIYSTWS 2287
            F +N  TG  ++  KLD E    Q ++  +E     +  L+   + E++  DINDN P       ++++ E   I          D D   N VK  K +++++F L   S  E S++  + +++  D E   + ++ +   D G P  +   ++ + +ID NDN P+FT++ +  +I E++     +   +A D D+G  G+I Y     GN    + F IN  TG I +   LD E    +E  V A D G     A  KV + +MD+NDN P +    ++ V+ E  P GT++G + V D D GEN  V ++     ++L +       NK  + +   +DRE+ S+  + +   D G P L+S   I + + D+NDN P    P    V+N    +YV  N+Q  + + T+ A D D  +N +I + +++       +    +N  +G ++S  S
Sbjct:   72 FDVNMKTGIFQIKDKLDREEICGQSLKCALELEAIVNSPLN-MYRFEVNVLDINDNPPTFPSSSLHLNVSEAAFIGERYSLPSADDADVGVNSVKSYKLSASEHFSLDVQSGGEQSVSAELVLQKALDREKQPVIRLTLTAVDGGKPQRSGTVNIIVNVIDVNDNIPVFTKSLYKARILENAPAGFSVITVNAKDADAGENGEIEYSFIKHGNNKNIESFAINKETGEITVLGKLDHESNNAIEIRVQARDKGSTPRVAHCKVLVEIMDVNDNIPEISVTSLINVVKEGSPKGTMVGLITVKDDDSGENGSVKLK---ILDSLPFVLQNTYKNKYSLVVDGPLDRERASEYNVTISAADEGSPPLSSTSVIAVHVSDVNDNAPRFPEP----VIN----VYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQS 518          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Zebrafish
Match: pcdh17 (protocadherin 17 [Source:ZFIN;Acc:ZDB-GENE-090608-3])

HSP 1 Score: 220.705 bits (561), Expect = 2.301e-58
Identity = 163/520 (31.35%), Postives = 262/520 (50.38%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIE-KG----YPELLILSALNFENVNERKFH-LQLTAFDRGGQFE---TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI--LKNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINI------STGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI------LTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDN--NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  L  AYD D+  NG+  Y ++ +    F L ++ +G    +PEL++  +L+ E   ER  H L +TA D GG++    TM + +   D NDN P+F    Y   + EN      I+ + A D DEG NG+++Y F    P  I + FS++  TG IK+  K+D+E   + +IE  ++A D+G   + G CK+ +   D NDN P I    ++  ++ E     T I  + V D DS  N +++C    N  F+L  + +N  T+  +R  D E    + I I   D+G PP+ + KS  + I+DENDN P FT+  ++ Q+ E++   E+L    A D D G  G ++Y L  +   E  I        + G IY   S + E  +  +F V A D G   LE++  V ++V+D+NDN P +  P +      + V  N  +G +I  V   D D GE+ R+T E ++  E  LF    ++D+   ++     +  E    + L +K+ DHG+P L++
Sbjct:  140 RFPLAAAYDPDTKENGLKTYQITRDDYSIFSLDVKSRGDGTKFPELVVQRSLDRE---ERSHHTLIITATD-GGEYPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENAPLGTVIIDLNATDSDEGINGQVTYSFSCYVPDRIKELFSIDPRTGVIKIQGKIDFE--ENPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFVAVRQGAVSEAATPGTVIALVRVTDKDSGRNGQLQCRILGNVPFKLEENYDNFYTVVTDRPLDREVKDEYNITIVAKDNGNPPLNSTKSFTVKILDENDNAPRFTKMVYLLQVPENNIPGEYLGSVLAHDPDLGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRSFNYEQTKYFDFKVQAKDSGNPHLESNTTVRVSVLDVNDNIPVIVLPLLQNDTAEIHVPRNVGVGHIITTVRAVDNDFGESGRLTYEISDGNEEHLF----EIDSVTGEVRTAQPLWEEVTPVVELIIKVTDHGKPSLSA 649          

HSP 2 Score: 120.553 bits (301), Expect = 4.547e-27
Identity = 144/518 (27.80%), Postives = 238/518 (45.95%), Query Frame = 2
Query:  794 DRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFD----TLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNV-SIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNS--NDNFR-LHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFP-IFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVI--NISTGYIYLYN-SLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE----NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYST 2281
            D NDN P F        + EN           A D D  ENG  +Y+      ++   ++  +    K   E+ + + LD E  S   +   I A D G    SG+ +I +  TD NDNSP  E    V  IPEN  + T I+ +   D D+ ++ +V  + +    D  + L S    +  I ++   D+E + I +ID++  D G  P+  +  + + ++D NDN+P I   A     +SE +     +     TD DSG  G++  R+   GN  F +  N    Y  + +  LDREVK+     + A D G   L ++   ++ ++D NDN PR  K   +L V EN   G  +G+V   D D G+N  V+      N  +E+   Y  +K  +  I+     + E+      +++  D G P L S  T+ +S++D+NDN P++  P    + N  + I+V  N      I T+ A D+DF E+G++ + I D  N    F+++  +G + + 
Sbjct:  114 DINDNAPSFPSEQIDIDISENAAPGTRFPLAAAYDPDTKENGLKTYQITRDDYSIFSLDVKSRGDGTKFP-ELVVQRSLDREERSHHTL--IITATDGGEYPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENAPLGTVIIDLNATDSDEGINGQVTYSFSCYVPDRIKELFSIDPRTGVIKIQGKIDFEENPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFVAVRQGAVSEAATPGTVIALVRVTDKDSGRNGQLQCRI--LGNVPFKLEENYDNFYTVVTDRPLDREVKDEYNITIVAKDNGNPPLNSTKSFTVKILDENDNAPRFTKMVYLLQVPENNIPGEYLGSVLAHDPDLGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRSFNYEQTKYFDFKVQAKDSGNPHLESNTTVRVSVLDVNDNIPVIVLPL---LQNDTAEIHVPRNVGVGHIITTVRAVDNDFGESGRLTYEISDG-NEEHLFEIDSVTGEVRTA 622          

HSP 3 Score: 110.153 bits (274), Expect = 7.365e-24
Identity = 133/517 (25.73%), Postives = 231/517 (44.68%), Query Frame = 2
Query:  851 ENTTYTIPILQVQ------AKD--LDEGENGKIS-YR-FDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQ--LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLT-------IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYR----LDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLK--SPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV-----NTQFNSFILTLLARDSDFDENGKIRFRIM----DDCNGSRYFQVNETSGAIYSTWS 2287
            +N  Y+IP  ++Q      AKD  L+ GE GK S +R  +   P  I+    ++  +G +   Q++D E    Q    + ++E            C I++   DINDN+P     + ++ I EN    T       +D D+  N +K  + + D++ + S    S         + ++R+ D E  S H + I   D G  P +    + + + D NDN P+F +  ++ +I E++ +   +   +ATD D G  G++TY     + D   + F I+  TG I +   +D E   ++E  V A D G   +    KV++ V+D NDN P +   + +   V E    GT+I  V V D D G N +  ++  +  N  F      DN   +     +DRE   +  + +   D+G P L S ++ T+ I+D NDN P               ++Y+     N     ++ ++LA D D  +NG + + ++     + + + Y  +  T GAIY+  S
Sbjct:   19 KNLNYSIPEEKIQGVIGNIAKDAELELGEQGKKSNFRVLENSAPHLID----VDPESGLLYTKQRIDRETLCRQNSKCQLSMEVFANDKE----ICMIKVEIQDINDNAPSFPSEQIDIDISENAAPGTRFPLAAAYDPDTKENGLKTYQITRDDYSIFSLDVKSRGDGTKFPELVVQRSLDREERSHHTLIITATDGGEYPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENAPLGTVIIDLNATDSDEGINGQVTYSFSCYVPDRIKELFSIDPRTGVIKIQGKIDFEENPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFVAVRQGAVSEAATPGTVIALVRVTDKDSGRNGQ--LQCRILGNVPFKLEENYDNFYTVVTDRPLDREVKDEYNITIVAKDNGNPPLNSTKSFTVKILDENDNAPRF-----------TKMVYLLQVPENNIPGEYLGSVLAHDPDLGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRS 514          

HSP 4 Score: 69.3218 bits (168), Expect = 2.524e-11
Identity = 87/339 (25.66%), Postives = 152/339 (44.84%), Query Frame = 2
Query: 1421 IAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIST-------GYIYLYNSLDREVKEMLEFFVYATDGGGLEAS--VKVSITVMDINDNPPRLKSPK-ILTVLENEPIGTLIGNVEVFDLDDGENARVT------IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKS 2389
            + I D NDN P F   Q    ISE++         +A D D+   G  TY++       F +++ +         + +  SLDRE +      + ATDGG    S  +++++ V D NDN P  + P  ++ + EN P+GT+I ++   D D+G N +VT      + + ++E  LF   +      I I+  ID E+   I + ++  D G   +     +T+ ++D ND      +PS G V   +  +       + I  +   D D   NG+++ RI+    G+  F++ E     Y+  + R    +   +   Y + I  KD+ +  + STKS
Sbjct:  110 VEIQDINDNAPSFPSEQIDIDISENAAPGTRFPLAAAYDPDTKENGLKTYQITRDDYSIFSLDVKSRGDGTKFPELVVQRSLDREERSHHTLIITATDGGEYPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENAPLGTVIIDLNATDSDEGINGQVTYSFSCYVPDRIKE--LF--SIDPRTGVIKIQGKIDFEENPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRND-----NWPSIGFVAVRQGAVSEAATPGTVIALVRVTDKDSGRNGQLQCRIL----GNVPFKLEENYDNFYTVVTDRP---LDREVKDEYNITIVAKDNGNPPLNSTKS 432          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Zebrafish
Match: pcdh2aa15 (protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GENE-041118-15])

HSP 1 Score: 218.779 bits (556), Expect = 2.573e-58
Identity = 158/481 (32.85%), Postives = 250/481 (51.98%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGY-----PELLILSALNFENVNERKFHLQLTAFDRGGQFET--MSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK----FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNSNDNFRLH-SSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE-----FV-INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSP--------KILTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALF 1903
            R  L  A D DS  N V  Y LS  H ++F++ I+  Y     P L++   L+ E    +   LQLTA D G   ++  M++ I  +D NDN P+F   +Y  T+ ENT     IL+V A DLDEG+NG + Y        ++NDK    F++N +TGEI +   LD+E+    + E  I+A D+G   L+    + I   D+NDN P+IE+   + +IPE+ +  T +  I V D D  ++ +V C+ + N  F+L  SSQEN+ ++      D E  + + I +E  D+G PP+++ KS+ + I D NDN P F+ + + + + E++   + LF  SA+D D+G    ++Y++   G  E     F+ IN   G IY   S D E  +  +F + ATD G   L ++V V++ ++D NDN P +  P         +  +  N   G L+  V  +D D G N  +     EV +++LF
Sbjct:  153 RFQLQAARDPDSGSNSVQTYKLS--HTEYFRIEIKDRYEDGKVPVLILQKPLDREVT--KSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLG----HDVNDKLRKLFNVNPVTGEIVVTGLLDFEV--KDIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSSTIPEDSKPGTTVALISVSDLDSGINGRVTCSLSENIPFQLMPSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSSSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKSFDFETSKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLF 623          

HSP 2 Score: 115.546 bits (288), Expect = 1.441e-25
Identity = 127/462 (27.49%), Postives = 213/462 (46.10%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHST-----DINDNSPRI-EILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSN-DNFRLHSSQE----NSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL----DDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKIL-TVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNN--KIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDCNG----SRYFQVNETSGAIYS 2278
            FS+N+  G + +  KLD E   ++     I        +++    +EIH       D+ND++P   E  K + I E              D DS  N V+  K S+ + FR+             + +++  D E +   ++ +   D G PP +   ++ I ++D NDN P+F +  +   ++E++ V   + + +ATDLD G  G + Y L    +D   K F +N  TG I +   LD EVK++ E  + A+D G   L     V+I + D+NDN P+++   +  T+ E+   GT +  + V DLD G N RVT    + EN  F        N   +   S +DRE ++   + L+  D G+P L+S +++T+ I D+NDN P  E+ S      S    YV  N      + ++ A D D   N  + ++I  D       + +  +N  +G IY+
Sbjct:   77 FSVNQNDGVLYVKGKLDRENVCERSTPCLINL------KIALENPLEIHYVTVDVIDVNDHAPMFPEQEKRLEISETVLPGARFQLQAARDPDSGSNSVQTYKLSHTEYFRIEIKDRYEDGKVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNVNPVTGEIVVTGLLDFEVKDIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSSTIPEDSKPGTTVALISVSDLDSGINGRVTCS--LSENIPFQLMPSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSP--EFSS------SPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYA 522          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Zebrafish
Match: pcdh2aa15 (protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GENE-041118-15])

HSP 1 Score: 218.779 bits (556), Expect = 2.950e-58
Identity = 158/481 (32.85%), Postives = 250/481 (51.98%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGY-----PELLILSALNFENVNERKFHLQLTAFDRGGQFET--MSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK----FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNSNDNFRLH-SSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE-----FV-INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSP--------KILTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALF 1903
            R  L  A D DS  N V  Y LS  H ++F++ I+  Y     P L++   L+ E    +   LQLTA D G   ++  M++ I  +D NDN P+F   +Y  T+ ENT     IL+V A DLDEG+NG + Y        ++NDK    F++N +TGEI +   LD+E+    + E  I+A D+G   L+    + I   D+NDN P+IE+   + +IPE+ +  T +  I V D D  ++ +V C+ + N  F+L  SSQEN+ ++      D E  + + I +E  D+G PP+++ KS+ + I D NDN P F+ + + + + E++   + LF  SA+D D+G    ++Y++   G  E     F+ IN   G IY   S D E  +  +F + ATD G   L ++V V++ ++D NDN P +  P         +  +  N   G L+  V  +D D G N  +     EV +++LF
Sbjct:  153 RFQLQAARDPDSGSNSVQTYKLS--HTEYFRIEIKDRYEDGKVPVLILQKPLDREVT--KSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLG----HDVNDKLRKLFNVNPVTGEIVVTGLLDFEV--KDIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSSTIPEDSKPGTTVALISVSDLDSGINGRVTCSLSENIPFQLMPSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSSSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKSFDFETSKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLF 623          

HSP 2 Score: 115.546 bits (288), Expect = 1.381e-25
Identity = 127/462 (27.49%), Postives = 213/462 (46.10%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHST-----DINDNSPRI-EILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSN-DNFRLHSSQE----NSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL----DDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKIL-TVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNN--KIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDCNG----SRYFQVNETSGAIYS 2278
            FS+N+  G + +  KLD E   ++     I        +++    +EIH       D+ND++P   E  K + I E              D DS  N V+  K S+ + FR+             + +++  D E +   ++ +   D G PP +   ++ I ++D NDN P+F +  +   ++E++ V   + + +ATDLD G  G + Y L    +D   K F +N  TG I +   LD EVK++ E  + A+D G   L     V+I + D+NDN P+++   +  T+ E+   GT +  + V DLD G N RVT    + EN  F        N   +   S +DRE ++   + L+  D G+P L+S +++T+ I D+NDN P  E+ S      S    YV  N      + ++ A D D   N  + ++I  D       + +  +N  +G IY+
Sbjct:   77 FSVNQNDGVLYVKGKLDRENVCERSTPCLINL------KIALENPLEIHYVTVDVIDVNDHAPMFPEQEKRLEISETVLPGARFQLQAARDPDSGSNSVQTYKLSHTEYFRIEIKDRYEDGKVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNVNPVTGEIVVTGLLDFEVKDIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSSTIPEDSKPGTTVALISVSDLDSGINGRVTCS--LSENIPFQLMPSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSP--EFSS------SPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYA 522          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Zebrafish
Match: pcdh2aa1 (protocadherin 2 alpha a 1 [Source:ZFIN;Acc:ZDB-GENE-041118-13])

HSP 1 Score: 193.741 bits (491), Expect = 5.597e-58
Identity = 152/476 (31.93%), Postives = 238/476 (50.00%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIE-----KGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI--DRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQE-NSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLD----DAGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSP--------KILTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALF 1903
            R  + TA+D D   N + +Y LS+NH  +F+L  E        P L++   L+ E     + +L LTA D G   ++ +  IT +  D NDN P+     Y  TVKE+      +L+V A D DEG NG+I Y       +  +D F L+ +TGE+K+   L++E    Q+ E  I A D+G+  LS  C + ++  D+NDN P I++    S IPE+    T +  I V D DS  N K+ C+   N  F L  S + N  ++  +   D E  S + I I   D G P +++ +S+ + + D NDN P F ++ + + ++E++K    +F  SA+DLD G   +++Y +D    D     F+ IN + G +Y   S D E  +   FFV A D G   L ++V V++ ++D NDN P +  P         +  +  N   G L+  V  +D D G N  +     EV E++LF
Sbjct:  150 RFQVETAHDPDIGSNDLQSYKLSQNH--YFRLETEDMGDEGKIPVLILQKPLDREK--SARHNLILTATDGGKPHKSAAANITIVVSDVNDNTPVCDKQKYTVTVKEDAPEGTFLLRVNASDSDEGVNGEIEYSLRNKFRKGASDVFDLDNITGELKIKGGLNFE--ERQVYELKILAADKGAVSLSTQCNVLVNVEDVNDNRPEIDVTSLSSHIPEDAAPGTVVALIGVTDLDSGMNGKIICSLPKNIPFDLKPSPDGNFYSLVTKENIDKEAKSSYDITITAKDLGSPSLSSTRSIHVEVTDVNDNSPKFAQSPYTFYVTENNKPGIAVFSLSASDLDEGENARVSYTIDRINSDQSMTSFLSINEANGTVYSLKSFDFESLKTFHFFVVAKDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSEHSLF 619          

HSP 2 Score: 52.373 bits (124), Expect = 5.597e-58
Identity = 44/148 (29.73%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  114 IFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLN---YQLFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQST--KPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            + C+ L ++  +   IN  L +      NVGNI K L      L N N+ I+VGT       E F++  + G +  ++ IDR   EE+C  ++ C           ++N ++    P    QI+ +IID NDNPP F    + + +LE
Sbjct:   16 LMCL-LFNSGGKAAQINYSLQEESKIGVNVGNIAKDLGIDPTSLENRNFRIVVGTK-----QELFRVNHEDGALFVSQRIDR---EELCAKINPC-----------LINLKAVIENPLEMHQISVDIIDVNDNPPSFLDENYKLEILE 143          

HSP 3 Score: 108.612 bits (270), Expect = 1.814e-23
Identity = 122/449 (27.17%), Postives = 200/449 (44.54%), Query Frame = 2
Query:  761 FETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQ-AKDLDEGENGKISYRFDT-----LTPQEINDKFSLNKLTGEIKLLQK-LDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDD---------SVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIST-GYIY---LYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLD--NNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
             E   + +  ID NDN P F D  Y+  + E +  T    QV+ A D D G N   SY+        L  +++ D+  +  L     +LQK LD E  +   +  T  A D G P  S +  I I  +D+NDN+P  +  K  V++ E+    T ++ +   D D         S+ NK +  K ++D F L +    +  + ++   ++E   ++++ I   D G   ++T  ++ + + D NDN P          I ED+     +     TDLDSG  GKI   L    N  F +  S  G  Y      ++D+E K   +  + A D G   L ++  + + V D+NDN P+  +SP    V EN   G  + ++   DLD+GENARV+   + +  +    S+L ++  N  ++     D E +      +   D G P L+S
Sbjct:  113 LEMHQISVDIIDVNDNPPSFLDENYKLEILE-SAMTGARFQVETAHDPDIGSNDLQSYKLSQNHYFRLETEDMGDEGKIPVL-----ILQKPLDREKSARHNLILT--ATDGGKPHKSAAANITIVVSDVNDNTPVCDKQKYTVTVKEDAPEGTFLLRVNASDSDEGVNGEIEYSLRNKFR--KGASDVFDLDNI---TGELKIKGGLNFEERQVYELKILAADKGAVSLSTQCNVLVNVEDVNDNRPEIDVTSLSSHIPEDAAPGTVVALIGVTDLDSGMNGKIICSL--PKNIPFDLKPSPDGNFYSLVTKENIDKEAKSSYDITITAKDLGSPSLSSTRSIHVEVTDVNDNSPKFAQSPYTFYVTENNKPGIAVFSLSASDLDEGENARVSYTIDRINSDQSMTSFLSINEANGTVYSLKSFDFESLKTFHFFVVAKDSGSPSLSS 546          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Xenopus
Match: abhd8 (Xenopus tropicalis protocadherin gamma subfamily A, 3 (pcdhga3), mRNA. [Source:RefSeq mRNA;Acc:NM_001170512])

HSP 1 Score: 225.328 bits (573), Expect = 3.029e-61
Identity = 163/516 (31.59%), Postives = 257/516 (49.81%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNV-SIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGN-----KEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPP-------RLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  L +A+DLD+  NG+  YSL+ N   +F LS++K       PELL+   L+ E + E   HL LTA D G   +  T  + +  +D NDN P F    ++ T+ EN      +LQ+ A D DEG NG+I Y FD  TP  I   F++N+ TG I  +  +DYE  S    E  ++A D+G P+L G C + +   D+NDNSP I I   + ++PE+  + T +    V D DS  N +V+     N  F+  S  ++  ++  +RT D E  S + I++   D G PP+ T   + + I D NDN P FT A     + E+++  + LFQ SA D D G    + Y + +          FV I+  +G IY   S D E  ++L+  V A D G   + ++  + I ++D NDNPP        L+ P    + ++ P G L+  V   D D G N+ ++    +  +++LF  ++     +I            + +L + + DHG+P L++
Sbjct:  151 RYPLESAHDLDAGANGIKQYSLNPN--LYFSLSVKKRSDGTLIPELLLEKTLDREEIGEH--HLILTAVDGGSPPRSGTSQIHVVVLDLNDNAPKFEKNSFKCTIHENVPLNTILLQLNATDRDEGANGEIEYSFDDHTPASIQRLFAINQKTGVISTIGPIDYEESSS--FEIPVKARDKGVPELEGHCTVYVEVEDVNDNSPEILITSLMKAVPEDTVVGTVVGLFNVKDQDSGQNGQVRLELPPNIPFKFKSF-DDHYSLVTDRTLDREKVSQYIIELSASDLGDPPLHTQHKIILNISDVNDNCPTFTHATVSASVQENNEPGQLLFQVSAFDPDEGENANLVYSIAENAATSTPISSFVYIDSKSGNIYAQRSFDYEHVQVLQIPVKAEDSGVPKMFSNTTIYIFILDTNDNPPAIFHPDLSLEDPVERKIPKSSPAGYLVTKVTAVDADSGYNSWLSYNIIDATDSSLF--HVSAQTGEIRTTRAFQETDTPEQYLTVSVSDHGKPPLSA 657          

HSP 2 Score: 32.7278 bits (73), Expect = 3.029e-61
Identity = 29/117 (24.79%), Postives = 53/117 (45.30%), Query Frame = 3
Query:  192 STNVGNIFKMLNYQLFN-ENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
             T VGN+ + L  ++ +     + +G+    K+  F   +++G +   + IDR   E +CG     S  IC      ++      P    ++  E++D NDN P F+  +  I +LE
Sbjct:   41 GTFVGNVAQDLGLKISDVSRRKLRMGSEGSRKY--FSVNWENGALTVNEKIDR---ESLCG-----SSTICSLPVEVVIE----DPLQLHRLVVEVLDINDNSPVFSTAQRTIKILE 143          

HSP 3 Score: 130.568 bits (327), Expect = 4.142e-30
Identity = 115/371 (31.00%), Postives = 171/371 (46.09%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYE--IYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSP-------RIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVK-CNKNSNDNFRLHSSQENSLT----IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD----AGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKIL-TVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKL 2020
            FS+N   G + + +K+D E    S  +    +E V E   QL    ++ +   DINDNSP        I+IL+ ++ P  +    P+ S   HD D+  N +K  + N N  F L   + +  T    + +E+T D E    H + +   D G PP +    + + ++D NDN P F +      I E+  +N  L Q +ATD D G  G+I Y  DD    +  + F IN  TG I     +D E     E  V A D G   LE    V + V D+NDN P +    ++  V E+  +GT++G   V D D G+N +V +  E+  N  F      D+  +     +DREKVSQ  + L   D G P L
Sbjct:   74 FSVNWENGALTVNEKIDRESLCGSSTICSLPVEVVIEDPLQLH---RLVVEVLDINDNSPVFSTAQRTIKILELLANPGTRY---PLES--AHDLDAGANGIKQYSLNPNLYFSLSVKKRSDGTLIPELLLEKTLDREEIGEHHLILTAVDGGSPPRSGTSQIHVVVLDLNDNAPKFEKNSFKCTIHENVPLNTILLQLNATDRDEGANGEIEYSFDDHTPASIQRLFAINQKTGVISTIGPIDYEESSSFEIPVKARDKGVPELEGHCTVYVEVEDVNDNSPEILITSLMKAVPEDTVVGTVVGLFNVKDQDSGQNGQVRL--ELPPNIPFKFKSFDDHYSLVTDRTLDREKVSQYIIELSASDLGDPPL 434          

HSP 4 Score: 118.627 bits (296), Expect = 1.823e-26
Identity = 148/539 (27.46%), Postives = 239/539 (44.34%), Query Frame = 2
Query:  776 LFITTIDRNDNKPIFTDILYRKTVK-----ENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLN-------KLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKN---VSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNSNDNF---RLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYN--SLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALF------YSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEX-------XXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYST 2281
            L +  +D NDN P+F+    ++T+K      N     P+    A DLD G NG   Y   +L P   N  FSL+        L  E+ L + LD E   +  +  T  AVD GSP  SG+ +I +   D+NDN+P+ E  KN    +I EN  + T ++ +   D D+  + +++ + + +      RL +  + +  I      DYE SS  +I ++  D G+P +  + ++++ + D NDN P       +  + ED+ V   +   +  D DSG  G++  RL+   N  F       +  L    +LDRE        + A+D G   L    K+ + + D+NDN P      +  +V EN   G L+  V  FD D+GENA +     + ENA        + Y+   +  I+ +   D E V  + + +K  D G PK+ S  T          +   I   D  LE P E  +  S    Y+ T+       + A D+D   N  + + I+D  + S  F V+  +G I +T
Sbjct:  118 LVVEVLDINDNSPVFSTA--QRTIKILELLANPGTRYPL--ESAHDLDAGANGIKQY---SLNP---NLYFSLSVKKRSDGTLIPELLLEKTLDREEIGEHHLILT--AVDGGSPPRSGTSQIHVVVLDLNDNAPKFE--KNSFKCTIHENVPLNTILLQLNATDRDEGANGEIEYSFDDHTPASIQRLFAINQKTGVISTIGPIDYEESSSFEIPVKARDKGVPELEGHCTVYVEVEDVNDNSPEILITSLMKAVPEDTVVGTVVGLFNVKDQDSGQNGQV--RLELPPNIPFKFKSFDDHYSLVTDRTLDREKVSQYIIELSASDLGDPPLHTQHKIILNISDVNDNCPTFTHATVSASVQENNEPGQLLFQVSAFDPDEGENANLVY--SIAENAATSTPISSFVYIDSKSGNIYAQRSFDYEHVQVLQIPVKAEDSGVPKMFSNTTIYIFILDTNDNPPAIFHPDLSLEDPVERKIPKSSPAGYLVTK-------VTAVDADSGYNSWLSYNIIDATDSS-LFHVSAQTGEIRTT 630          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Xenopus
Match: atp5pd (ATP synthase peripheral stalk subunit d [Source:Xenbase;Acc:XB-GENE-993879])

HSP 1 Score: 223.402 bits (568), Expect = 9.515e-61
Identity = 165/522 (31.61%), Postives = 265/522 (50.77%), Query Frame = 2
Query:  539 RTKNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSI-----EKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFE---TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG------NKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKILT---VLENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R    R+ L  A D D   N V  Y LS N   +F L +     E    +L++   L+ E +     ++ L AFD GG+ +   T  L IT  D NDN P+F + +YR ++ EN      +++V A DLDEGEN K++Y F+ L PQ +   FS+ + TG I+++ ++D+E     L E  + A+D G   + G CK+ ++  D+NDN P + I   N+ + E+ ++ T +  I VHD DS  N KVKC  ++N  F++ S+     ++ ++   D+E+ S +  DI   D G P ++  KS+ I I D NDN P F +      I E++     ++  +A+D D+G    ITY L D+       +    IN   G IY   S D E     +  + ATD G   L +++ + I + DINDN P   +P   T   V E  P    +G L+  ++  D D G NA ++ +  ++  N+ F S  + +   I  +SL+D +   ++F+  +  DHG P +T+
Sbjct:  145 RQSGSRLPLEGAVDADIGTNSVTGYELSLN--DYFSLDVQSYTHESKSVQLVLRKPLDREQIPLH--NITLIAFD-GGKPKLSGTTQLLITVQDINDNAPVFNEEIYRASLLENALKGTIVIKVNATDLDEGENSKLTYAFNRLVPQHVRTIFSIEENTGIIRVVGEVDFE--KKNLYEIEVNAIDRGHRAMVGHCKVLVNVLDVNDNPPEMSITSLNLPVSEDSKVGTVVAIINVHDKDSGQNGKVKCQISTNVPFKIASTLREYYSLIVDGPLDHESISEYNFDIIAIDEGFPSLSVTKSIKIQISDVNDNRPSFHQGAETIFIKENNPPGSHVYTVTASDADTGQNSFITYSLSDSSIDGIPMSSYISINPENGKIYALMSFDHEQIIYFQCQIIATDAGLPHLSSNLTLHIFIEDINDNAPSALAPFYSTEPAVTEMVPRSSKVGQLVTKIKAVDPDSGYNAWISYKLKDLPRNSPF-SIGRQNGEIIITRSLMDSDDEFRLFVVAE--DHGEPAMTA 656          

HSP 2 Score: 32.7278 bits (73), Expect = 9.515e-61
Identity = 27/87 (31.03%), Postives = 44/87 (50.57%), Query Frame = 3
Query:  291 EFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK 548
            E+F++  ++G I   + IDR   E +C  +S     IC  Q   IL+    KP     ++ EI D NDN P F+  +F + + E ++
Sbjct:   72 EYFQVNLQNGIIFVNRVIDR---EMLCPEIS-----ICIVQLEVILD----KPVQIHHVDVEIEDINDNFPIFSSTEFKLQISEMRQ 146          

HSP 3 Score: 111.694 bits (278), Expect = 2.523e-24
Identity = 119/433 (27.48%), Postives = 192/433 (44.34%), Query Frame = 2
Query:  794 DRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLN--KLTGEIKLLQ-----KLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHDDDSVHNK---VKCNKNSNDNFR-LHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIY---LYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKL--DNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            D NDN PIF+   ++  + E       +    A D D G N    Y         +ND FSL+    T E K +Q      LD E     L   T+ A D G P+LSG+ ++ I   DINDN+P   E +   S+ EN    T ++ +   D D   N       N+    + R + S +EN+  I +    D+E  ++++I++   D G   M  +  + + ++D NDN P  +       +SEDSKV   +   +  D DSG  GK+  ++  + N  F I  +    Y   +   LD E      F + A D G   L  +  + I + D+NDN P   +  + + + EN P G+ +  V   D D G+N+ +T  + +   +     SY+ +  +N KI+     D E++     ++   D G P L+S
Sbjct:  124 DINDNFPIFSSTEFKLQISEMRQSGSRLPLEGAVDADIGTNSVTGYEL------SLNDYFSLDVQSYTHESKSVQLVLRKPLDRE--QIPLHNITLIAFDGGKPKLSGTTQLLITVQDINDNAPVFNEEIYRASLLENALKGTIVIKVNATDLDEGENSKLTYAFNRLVPQHVRTIFSIEENTGIIRVVGEVDFEKKNLYEIEVNAIDRGHRAMVGHCKVLVNVLDVNDNPPEMSITSLNLPVSEDSKVGTVVAIINVHDKDSGQNGKVKCQI--STNVPFKIASTLREYYSLIVDGPLDHESISEYNFDIIAIDEGFPSLSVTKSIKIQISDVNDNRPSFHQGAETIFIKENNPPGSHVYTVTASDADTGQNSFITYSLSDSSIDGIPMSSYISINPENGKIYALMSFDHEQIIYFQCQIIATDAGLPHLSS 546          

HSP 4 Score: 65.0846 bits (157), Expect = 5.528e-10
Identity = 54/160 (33.75%), Postives = 77/160 (48.12%), Query Frame = 2
Query: 1421 IAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIS-------TGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVT 1870
            + I D NDNFPIF+  +   QISE  +    L    A D D G      Y L  + N  F +++        +  + L   LDRE   +    + A DGG   L  + ++ ITV DINDN P         ++LEN   GT++  V   DLD+GEN+++T
Sbjct:  120 VEIEDINDNFPIFSSTEFKLQISEMRQSGSRLPLEGAVDADIGTNSVTGYEL--SLNDYFSLDVQSYTHESKSVQLVLRKPLDREQIPLHNITLIAFDGGKPKLSGTTQLLITVQDINDNAPVFNEEIYRASLLENALKGTIVIKVNATDLDEGENSKLT 277          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Xenopus
Match: PCDH17 (protocadherin 17 [Source:NCBI gene;Acc:100485388])

HSP 1 Score: 223.402 bits (568), Expect = 3.757e-59
Identity = 168/518 (32.43%), Postives = 267/518 (51.54%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIE-KG----YPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEIL--KNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY-----RLDDAGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI------LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEV-QENALFYSYLKLDNNKIFIKSLIDR-EKVSQIF-LRLKLVDHGRPKLTS 2026
            R  L +A+D D+  NG+  Y ++ +    F L ++ +G    +PEL+I   L+ E  +  K  L LTA D G   +  T+ + +  ID NDN P+F  + Y   + EN+     ++ + A D DEG NG++ Y F    P  I + FS++  TG I++   LDYE   + LIE  ++A D+G   +   CK+ +   D NDN+P I  +  +  +I E     T I  + V D DS  N ++ C    N  F+L  + +N  T+  +R  D E    + + I   D+G PP+ + KS  + I+DENDN P FT+A ++ Q+SE++   E+L    A D D G+ G ++Y      + D     FV +N + G IY   S + E  +  EF V A D G   LE++  V ++V+D+NDN P +  P +      + V  N  +G LI  V   D D GE+ R+T E     E+ LF    ++D+    IK+L    ++VS +  L +K+ D+G+P L++
Sbjct:  141 RFPLTSAHDPDAGENGLKTYVITRDDFGLFSLDVKSRGDGTKFPELVIQKELDREEQSHHK--LILTALDGGDPPRSATIQINVKVIDSNDNSPVFEALSYMVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAPDRIRELFSIDSKTGIIQVKGNLDYE--ENGLIEIDVQARDQGPNPIPKHCKVTVKVIDKNDNAPSISFVSVRQGAISEAAPPGTVIALVRVTDKDSGKNGQLICRVLGNVPFKLEENYDNLYTVVTDRPLDREIQDEYNVTIIARDNGSPPLNSTKSFSVKILDENDNPPHFTKAMYVLQVSENNIPGEYLGSVLAQDPDLGHNGTVSYSILPSHVGDVSIYTFVSVNPTNGAIYALRSFNYEQTKYFEFKVLAKDSGSPHLESNATVRVSVLDVNDNAPVICLPTLQNDTAEIHVPRNVGVGYLITTVRAMDNDFGESGRLTYEIVYGNEDHLF----EIDSVTGEIKTLTPYWDEVSPVVELVIKVTDNGKPSLSA 650          

HSP 2 Score: 124.405 bits (311), Expect = 4.440e-28
Identity = 157/586 (26.79%), Postives = 260/586 (44.37%), Query Frame = 2
Query:  608 NYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLT----------GEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK---VKCNKNSNDNFR-LHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFP-IFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYN-----SLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVT---IENEVQENALFYSYLKLD--NNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            N+ + EN      L +++    L     ++ E++  R    QL+        E   + +  +D NDN P F        + EN +         A D D GENG  +Y           D F L  L            E+ + ++LD E  S   +  T  A+D G P  S + +I +   D NDNSP  E L   V IPEN  +   ++ +   D D   N       +  + D  R L S    +  I ++   DYE + + +ID++  D G  P+  +  + + +ID+NDN P I   +     ISE +     +     TD DSG  G++  R+   GN  F   +   Y  LY       LDRE+++     + A D G   L ++   S+ ++D NDNPP   K+  +L V EN   G  +G+V   D D G N  V+   + + V + ++ Y+++ ++  N  I+     + E+      ++   D G P L S  T+ +S++D+NDN P++  P+   + N  + I+V  N      I T+ A D+DF E+G++ + I+   N    F+++  +G I
Sbjct:   54 NFRVLENSAPHL-LDVDQDSGVLYTKQRIDRESLCRRSPKCQLSLEVFANDKEICMIKVDILDINDNSPNFPSEQIDIDISENASPGTRFPLTSAHDPDAGENGLKTYVI-------TRDDFGLFSLDVKSRGDGTKFPELVIQKELDREEQSHHKLILT--ALDGGDPPRSATIQINVKVIDSNDNSPVFEALSYMVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAPDRIRELFSIDSKTGIIQVKGNLDYEENGLIEIDVQARDQGPNPIPKHCKVTVKVIDKNDNAPSISFVSVRQGAISEAAPPGTVIALVRVTDKDSGKNGQLICRV--LGNVPF--KLEENYDNLYTVVTDRPLDREIQDEYNVTIIARDNGSPPLNSTKSFSVKILDENDNPPHFTKAMYVLQVSENNIPGEYLGSVLAQDPDLGHNGTVSYSILPSHVGDVSI-YTFVSVNPTNGAIYALRSFNYEQTKYFEFKVLAKDSGSPHLESNATVRVSVLDVNDNAPVICLPT---LQNDTAEIHVPRNVGVGYLITTVRAMDNDFGESGRLTYEIVYG-NEDHLFEIDSVTGEI 620          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Xenopus
Match: PCDH17 (protocadherin 17 [Source:NCBI gene;Acc:100485388])

HSP 1 Score: 223.402 bits (568), Expect = 4.380e-59
Identity = 168/518 (32.43%), Postives = 267/518 (51.54%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIE-KG----YPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEIL--KNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY-----RLDDAGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI------LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEV-QENALFYSYLKLDNNKIFIKSLIDR-EKVSQIF-LRLKLVDHGRPKLTS 2026
            R  L +A+D D+  NG+  Y ++ +    F L ++ +G    +PEL+I   L+ E  +  K  L LTA D G   +  T+ + +  ID NDN P+F  + Y   + EN+     ++ + A D DEG NG++ Y F    P  I + FS++  TG I++   LDYE   + LIE  ++A D+G   +   CK+ +   D NDN+P I  +  +  +I E     T I  + V D DS  N ++ C    N  F+L  + +N  T+  +R  D E    + + I   D+G PP+ + KS  + I+DENDN P FT+A ++ Q+SE++   E+L    A D D G+ G ++Y      + D     FV +N + G IY   S + E  +  EF V A D G   LE++  V ++V+D+NDN P +  P +      + V  N  +G LI  V   D D GE+ R+T E     E+ LF    ++D+    IK+L    ++VS +  L +K+ D+G+P L++
Sbjct:  141 RFPLTSAHDPDAGENGLKTYVITRDDFGLFSLDVKSRGDGTKFPELVIQKELDREEQSHHK--LILTALDGGDPPRSATIQINVKVIDSNDNSPVFEALSYMVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAPDRIRELFSIDSKTGIIQVKGNLDYE--ENGLIEIDVQARDQGPNPIPKHCKVTVKVIDKNDNAPSISFVSVRQGAISEAAPPGTVIALVRVTDKDSGKNGQLICRVLGNVPFKLEENYDNLYTVVTDRPLDREIQDEYNVTIIARDNGSPPLNSTKSFSVKILDENDNPPHFTKAMYVLQVSENNIPGEYLGSVLAQDPDLGHNGTVSYSILPSHVGDVSIYTFVSVNPTNGAIYALRSFNYEQTKYFEFKVLAKDSGSPHLESNATVRVSVLDVNDNAPVICLPTLQNDTAEIHVPRNVGVGYLITTVRAMDNDFGESGRLTYEIVYGNEDHLF----EIDSVTGEIKTLTPYWDEVSPVVELVIKVTDNGKPSLSA 650          

HSP 2 Score: 124.02 bits (310), Expect = 5.362e-28
Identity = 157/586 (26.79%), Postives = 260/586 (44.37%), Query Frame = 2
Query:  608 NYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLT----------GEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK---VKCNKNSNDNFR-LHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFP-IFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYN-----SLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVT---IENEVQENALFYSYLKLD--NNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            N+ + EN      L +++    L     ++ E++  R    QL+        E   + +  +D NDN P F        + EN +         A D D GENG  +Y           D F L  L            E+ + ++LD E  S   +  T  A+D G P  S + +I +   D NDNSP  E L   V IPEN  +   ++ +   D D   N       +  + D  R L S    +  I ++   DYE + + +ID++  D G  P+  +  + + +ID+NDN P I   +     ISE +     +     TD DSG  G++  R+   GN  F   +   Y  LY       LDRE+++     + A D G   L ++   S+ ++D NDNPP   K+  +L V EN   G  +G+V   D D G N  V+   + + V + ++ Y+++ ++  N  I+     + E+      ++   D G P L S  T+ +S++D+NDN P++  P+   + N  + I+V  N      I T+ A D+DF E+G++ + I+   N    F+++  +G I
Sbjct:   54 NFRVLENSAPHL-LDVDQDSGVLYTKQRIDRESLCRRSPKCQLSLEVFANDKEICMIKVDILDINDNSPNFPSEQIDIDISENASPGTRFPLTSAHDPDAGENGLKTYVI-------TRDDFGLFSLDVKSRGDGTKFPELVIQKELDREEQSHHKLILT--ALDGGDPPRSATIQINVKVIDSNDNSPVFEALSYMVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAPDRIRELFSIDSKTGIIQVKGNLDYEENGLIEIDVQARDQGPNPIPKHCKVTVKVIDKNDNAPSISFVSVRQGAISEAAPPGTVIALVRVTDKDSGKNGQLICRV--LGNVPF--KLEENYDNLYTVVTDRPLDREIQDEYNVTIIARDNGSPPLNSTKSFSVKILDENDNPPHFTKAMYVLQVSENNIPGEYLGSVLAQDPDLGHNGTVSYSILPSHVGDVSI-YTFVSVNPTNGAIYALRSFNYEQTKYFEFKVLAKDSGSPHLESNATVRVSVLDVNDNAPVICLPT---LQNDTAEIHVPRNVGVGYLITTVRAMDNDFGESGRLTYEIVYG-NEDHLFEIDSVTGEI 620          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Xenopus
Match: gga3 (golgi-associated, gamma adaptin ear containing, ARF binding protein 3 [Source:Xenbase;Acc:XB-GENE-979350])

HSP 1 Score: 211.46 bits (537), Expect = 2.544e-57
Identity = 158/523 (30.21%), Postives = 263/523 (50.29%), Query Frame = 2
Query:  539 RTKNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEK-----GYPELLILSALNFENVNERKFHLQLTAFDRGGQFE---TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDS-VHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG------NKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPK-------ILTVLENEPIGTLIGNVEVFDLDDGENARV--TIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R    R  L  A D D   N + NY LS+N   +F L + K        +L++   L+ E ++    +L LTAFD GG+ +   +  L I   D NDN P+F  +LY+ +V EN+     + ++ A DLD+G+NG+ISY F  L P+E+   FSL+K TGE+ +  +LDYE       E  ++A D G   L+G C++ +   D+NDN+P + +    + +PE+    T +  + VHD DS V+ +V C  +    F+++ +     ++ +    D EN+S +Q+ I   D G P +++  ++ + + D NDN P+F ++ H   I E++     ++  SA+D D+     ITY L ++       +    IN   G ++   S D E     +  + ATD G   L +++ ++I +MD+NDN P   S          +T  ++   G L+  V   DLD G NA +  T +N    N+LF   +  +  +I +   I   +  +   RL +VDHG P +T+
Sbjct:  158 RLPGTRFPLEGAVDADIGTNSITNYELSDN--DYFILELPKFIHQIKSIQLVLKKPLDREKISLH--NLTLTAFD-GGKPKLSGSTQLIINVEDANDNPPVFNQLLYQSSVVENSPKGTLVARLNASDLDQGKNGEISYEFSKLVPEEVLLIFSLDKYTGELWVKGELDYE--KTNTYEIHVDAFDNGESPLTGHCQLVVTVVDLNDNAPEVSVTSLFLPVPEDATQGTIVAMVSVHDQDSGVNGRVNCYISPPTPFKINPAFTGDFSLLVNGPLDRENTSEYQVVITAKDEGSPALSSSMTINVEVSDVNDNAPLFQQSVHTIFIKENNPPGSHIYTVSASDSDTAQNSFITYSLSESFIEGIPISSYISINPENGKLFSLLSFDHEQVSYFQCHIKATDAGLPPLSSNLTLNIFIMDVNDNVPVFTSANSNSASAISVTAPKSAQPGHLVTKVNAVDLDSGYNAWMSYTFKNAAG-NSLF--AISKNTGEIRVTRPITEAEGDE--FRLFVVDHGEPAMTA 668          

HSP 2 Score: 33.4982 bits (75), Expect = 2.544e-57
Identity = 26/86 (30.23%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  291 EFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQ 545
            E+F++  ++G +     IDR   EE+C  L  C   I   Q          KP    +++ EI D NDN P F   ++ I++LE +
Sbjct:   85 EYFQVNLQNGILFVKHAIDR---EELCPDLPLC---IVSIQVVV------DKPVQIHRVDVEIEDINDNYPAFPSRQYTISILESR 158          

HSP 3 Score: 130.183 bits (326), Expect = 1.551e-32
Identity = 117/411 (28.47%), Postives = 188/411 (45.74%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSE--NHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFET--MSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLL--QKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIE-ILKNVSIPENKRIATPIMSIYVHDDDSVHNKV---KCNKNSNDNFRLHS----SQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQH------IYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDA-GNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMD 1741
            A DLD   NG  +Y  S+    +     S++K   EL +   L++E  N  + H+   AFD G    T    L +T +D NDN P  +       V E+ T    +  V   D D G NG+++      TP +IN  F     TG+  LL    LD E  S+   +  I A DEGSP LS S  I +  +D+NDN+P  +  +  + I EN    + I ++   D D+  N       +++  +   + S    + EN   ++   +FD+E  S  Q  I+  D+G+PP+++  +L I I+D NDN P+FT A             + ++    + + +A DLDSG    ++Y   +A GN  F I+ +TG I +   +     +    FV       + A  ++ I++ D
Sbjct:  278 ASDLDQGKNGEISYEFSKLVPEEVLLIFSLDKYTGELWVKGELDYEKTNTYEIHVD--AFDNGESPLTGHCQLVVTVVDLNDNAPEVSVTSLFLPVPEDATQGTIVAMVSVHDQDSGVNGRVNCYISPPTPFKINPAF-----TGDFSLLVNGPLDRENTSE--YQVVITAKDEGSPALSSSMTINVEVSDVNDNAPLFQQSVHTIFIKENNPPGSHIYTVSASDSDTAQNSFITYSLSESFIEGIPISSYISINPENG-KLFSLLSFDHEQVSYFQCHIKATDAGLPPLSSNLTLNIFIMDVNDNVPVFTSANSNSASAISVTAPKSAQPGHLVTKVNAVDLDSGYNAWMSYTFKNAAGNSLFAISKNTGEIRVTRPITEAEGDEFRLFVVDHGEPAMTALTQIIISIKD 678          

HSP 4 Score: 31.5722 bits (70), Expect = 1.551e-32
Identity = 27/108 (25.00%), Postives = 47/108 (43.52%), Query Frame = 3
Query:  216 KMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
             + NY+L + +Y I+       +  +F    KS  ++  K +DR+        +S  +  +  F         ST+  +N +      D NDNPP FNQ  +  +V+E
Sbjct:  178 SITNYELSDNDYFIL-------ELPKFIHQIKSIQLVLKKPLDREK-------ISLHNLTLTAFDGGKPKLSGSTQLIINVE------DANDNPPVFNQLLYQSSVVE 265          

HSP 5 Score: 74.3294 bits (181), Expect = 7.678e-13
Identity = 64/213 (30.05%), Postives = 93/213 (43.66%), Query Frame = 2
Query: 1421 IAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGN-----KEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKIL---TVLENEPIGTLIGNVEVFDLDDGENARVTIE--NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLT 2023
            + I D NDN+P F   Q+   I E            A D D G      Y L D         +F+  I +  + L   LDRE   +    + A DGG   L  S ++ I V D NDNPP     ++L   +V+EN P GTL+  +   DLD G+N  ++ E    V E  L    L     ++++K  +D EK +   + +   D+G   LT
Sbjct:  133 VEIEDINDNYPAFPSRQYTISILESRLPGTRFPLEGAVDADIGTNSITNYELSDNDYFILELPKFIHQIKSIQLVLKKPLDREKISLHNLTLTAFDGGKPKLSGSTQLIINVEDANDNPPVFN--QLLYQSSVVENSPKGTLVARLNASDLDQGKNGEISYEFSKLVPEEVLLIFSLDKYTGELWVKGELDYEKTNTYEIHVDAFDNGESPLT 343          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Mouse
Match: Pcdhga4 (protocadherin gamma subfamily A, 4 [Source:MGI Symbol;Acc:MGI:1935216])

HSP 1 Score: 223.016 bits (567), Expect = 2.993e-62
Identity = 177/518 (34.17%), Postives = 261/518 (50.39%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGGQFE--TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK-VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD-----AGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI---------LTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  LP A+DLD  +N +  Y LS N    F L ++ G     YPEL++ +AL+ E   E   HL LTAFD G      T ++ +T +D NDN P+FT   Y  +VKEN      +L ++A D DEG NG+++Y F  +  ++I+  F LN LTG+I +L +LDYE       +  +EA D   P L    K+ +   D+NDN+P + +     SI E     T I    VHD DS  N  V C+   N  FRL  +  N   + + RT D E  S + I I   D G PP++T   + + ++D NDN P FT A +   I E++     +   +A D DSG   ++ Y L +     A    +V IN +TG +Y   S D E  + L+  V A D G   L ++V +S++V+D NDN P +  P I         LT    +P G L+  V   D D G+NA ++    +  E  LF   L     +   ++L+DR+ + Q  L + + DHG+P L++
Sbjct:  150 RFPLPEAFDLDIGVNALQGYQLSSN--DHFSLDVQSGPDGIKYPELVLENALDREE--EAVHHLVLTAFDGGDPVRSGTATIQVTLVDTNDNAPVFTQPEYHISVKENLPVGTRLLTIKATDPDEGVNGEVTYSFRNVR-EKISQLFQLNSLTGDITVLGELDYE--DSGFYDVDVEAHD--GPGLRARSKVLVTVLDVNDNAPEVTVTSLTSSIQEASSPGTVIALFNVHDSDSGENGLVTCSIPDNLPFRLEKTYGNYHRLLIHRTLDREEVSDYNITITATDQGTPPLSTETYISLQVVDINDNPPTFTHASYSAYIPENNPRGASILSITAQDPDSGENAQVIYSLSEDTIQGAPMSSYVSINSNTGVLYALRSFDYEQFQDLKLLVTARDSGTPPLSSNVSLSLSVLDQNDNTPEILYPTIPTDGSTGVELTPRSADP-GYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRT-ARALLDRDALKQ-SLVVTVQDHGQPPLSA 655          

HSP 2 Score: 37.7354 bits (86), Expect = 2.993e-62
Identity = 42/159 (26.42%), Postives = 68/159 (42.77%), Query Frame = 3
Query:   81 KSEIQMVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQ---LFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQ 545
            KS+ + +++  IF  SL D  AE+  I   + + + + + VGN+   L  +   L      I+    T     + F L  +SG ++T   +DR   E +C     C+ ++       IL     +      I  EIID NDN P F   +  I V E +
Sbjct:    6 KSDRRGLIWICIFLGSLCDIRAEQ--IRYSVPEELERGSVVGNLAADLGLEPGKLAERGVRIVSRGKT-----QLFALNPRSGSLVTAGRVDR---EGLCDRSPKCTANL------EILLEDKVR---ILAIEVEIIDVNDNAPSFGAQQREIKVAESE 145          

HSP 3 Score: 137.887 bits (346), Expect = 1.779e-32
Identity = 134/482 (27.80%), Postives = 226/482 (46.89%), Query Frame = 2
Query:  911 ENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFT--IEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNK-NSNDNFRLH-SSQENSLT---IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNK---EFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKIL-TVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDD----CNGSRYFQVNETSGAIYSTWSCRNGQF 2305
            E GK++ R   +  +     F+LN  +G +    ++D E   D+  + T  +E + E   ++     IE+   D+NDN+P      + + + E++   T        D D   N ++  + +SND+F L   S  + +    + +E   D E  ++H + +  FD G P  +   ++ + ++D NDN P+FT+ ++   + E+  V   L    ATD D G  G++TY   +   K    F +N  TG I +   LD E     +  V A DG GL A  KV +TV+D+NDN P +    +  ++ E    GT+I    V D D GEN  VT    + +N  F       N +++ I   +DRE+VS   + +   D G P L++   I++ ++DINDN P   + S        + I  N    + IL++ A+D D  EN ++ + + +D       S Y  +N  +G +Y+  S    QF
Sbjct:   54 EPGKLAERGVRIVSRGKTQLFALNPRSGSLVTAGRVDREGLCDRSPKCTANLEILLEDKVRI---LAIEVEIIDVNDNAPSFGAQQREIKVAESENPGTRFPLPEAFDLDIGVNALQGYQLSSNDHFSLDVQSGPDGIKYPELVLENALDREEEAVHHLVLTAFDGGDPVRSGTATIQVTLVDTNDNAPVFTQPEYHISVKENLPVGTRLLTIKATDPDEGVNGEVTYSFRNVREKISQLFQLNSLTGDITVLGELDYEDSGFYDVDVEAHDGPGLRARSKVLVTVLDVNDNAPEVTVTSLTSSIQEASSPGTVIALFNVHDSDSGENGLVTC--SIPDNLPFRLEKTYGNYHRLLIHRTLDREEVSDYNITITATDQGTPPLSTETYISLQVVDINDNPPTFTHAS------YSAYIPENNPRGASILSITAQDPDSGENAQVIYSLSEDTIQGAPMSSYVSINSNTGVLYALRSFDYEQF 524          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Mouse
Match: Pcdhga7 (protocadherin gamma subfamily A, 7 [Source:MGI Symbol;Acc:MGI:1935219])

HSP 1 Score: 217.624 bits (553), Expect = 6.075e-61
Identity = 172/518 (33.20%), Postives = 256/518 (49.42%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGGQFE--TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD------AGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI---------LTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  L  A D D   N +  Y LS NH   F L ++ G     YPEL++  AL+ E   E   HL LTA+D G      T S+ +T +D ND+ P+F+  LY+ TV EN      +L V A DLDEG  G+++Y F  +TP E+   F L+ LTGE+  L+ LDYE  S    E  ++A D G+  L+   K+ I   D+NDN+P + +    S +PE+    T I   Y+ D DS  N +V C+   N  F+L  S +N   +   R  D E  S++ I ++  D GIPP++T   + I + D NDN P F+ + +   + E++     +F  +A D DS    ++TY L +        +    IN  TG +Y   S D E    L+  V A D G   L ++V + + V+D NDN P +  P +         L     EP G L+  V   D D G NA ++    +  E  LF   L     +   ++L+DR+ + Q  L + + DHG+P L++
Sbjct:  153 RFPLKEATDSDVGKNSLQRYQLSPNHH--FSLVVQSGDDGTKYPELVLEKALDREE--EGLHHLVLTAYDGGDPLRSGTASIRVTVVDVNDHTPVFSLPLYQATVPENVPVGTRLLTVNAIDLDEGIYGEVTYSFWKITP-ELLQIFHLSSLTGELSTLKGLDYEQSS--FYELEVQAQD-GAGSLT-KAKVLITVLDVNDNAPEVTVTSVSSPVPEDTPPGTVIALFYLQDKDSGKNGEVTCSLPENLPFKLERSIDNYYRLVTARNLDREKMSVYNITLKATDGGIPPLSTETRMSIHVSDTNDNPPTFSDSSYSIYVPENNPRGASIFSVTAQDPDSDKNAQVTYALAEDTIQGVPVSSYVSINSDTGILYALGSFDYEQFRDLQLRVTARDSGDPPLSSNVSLKLFVLDKNDNAPEILYPALPTDGSTGVELAPRSAEP-GYLVTKVVAVDKDSGPNAWLSYRLLKASEPGLFSVGLHTGEVRT-ARALLDRDALKQ-NLVVVVQDHGQPPLSA 658          

HSP 2 Score: 38.5058 bits (88), Expect = 6.075e-61
Identity = 38/121 (31.40%), Postives = 54/121 (44.63%), Query Frame = 3
Query:  189 KSTNVGNIFKMLNYQ---LFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            K + VGNI K L  Q   L      II    T     + F L  +SG ++T   IDR   EE+C     C   +  F  N ++  +       + I  EI+D NDN P+F   + NI ++E
Sbjct:   43 KGSFVGNITKDLGLQPRELAERGVRIITKGKT-----QLFSLNPRSGSLVTAGRIDR---EELCAQSPRC---LVSF--NILIEDKMNL----YPIEVEIMDVNDNAPRFLTEEINIKIME 146          

HSP 3 Score: 132.109 bits (331), Expect = 8.664e-31
Identity = 136/468 (29.06%), Postives = 214/468 (45.73%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI---EILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNS-NDNFRLHSSQENSLTIY----MERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY---RLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILT-VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDC-NG---SRYFQVNETSGAIYSTWSCRNGQF 2305
            FSLN  +G +    ++D E    Q    L+ F I   D+          IE+   D+NDN+PR    EI  N+ I EN             D D   N ++  + S N +F L     +  T Y    +E+  D E   +H + +  +D G P  +   S+ + ++D ND+ P+F+   +   + E+  V   L   +A DLD G +G++TY   ++     + F ++  TG +     LD E     E  V A DG G     KV ITV+D+NDN P +    + + V E+ P GT+I    + D D G+N  VT    + EN  F     +DN  ++     +DREK+S   + LK  D G P L++   ++I + D NDN P           +S   IYV  N    + I ++ A+D D D+N ++ + + +D   G   S Y  +N  +G +Y+  S    QF
Sbjct:   77 FSLNPRSGSLVTAGRIDREELCAQSPRCLVSFNILIEDK-----MNLYPIEVEIMDVNDNAPRFLTEEI--NIKIMENAAPGVRFPLKEATDSDVGKNSLQRYQLSPNHHFSLVVQSGDDGTKYPELVLEKALDREEEGLHHLVLTAYDGGDPLRSGTASIRVTVVDVNDHTPVFSLPLYQATVPENVPVGTRLLTVNAIDLDEGIYGEVTYSFWKITPELLQIFHLSSLTGELSTLKGLDYEQSSFYELEVQAQDGAGSLTKAKVLITVLDVNDNAPEVTVTSVSSPVPEDTPPGTVIALFYLQDKDSGKNGEVTC--SLPENLPFKLERSIDNYYRLVTARNLDREKMSVYNITLKATDGGIPPLSTETRMSIHVSDTNDNPPTFS--------DSSYSIYVPENNPRGASIFSVTAQDPDSDKNAQVTYALAEDTIQGVPVSSYVSINSDTGILYALGSFDYEQF 527          

HSP 4 Score: 115.546 bits (288), Expect = 1.186e-25
Identity = 123/439 (28.02%), Postives = 194/439 (44.19%), Query Frame = 2
Query:  782 ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTG-------EIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHD-DDSVHNKV-----KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIY---LYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLK-SPKILTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSL--IDREKVSQIFLRLKLVDHGRPKLTS 2026
            +  +D NDN P F        + EN    +     +A D D G+N    Y+   L+P   N  FSL   +G       E+ L + LD E   + L    + A D G P  SG+  I +   D+ND++P   + L   ++PEN  + T ++++   D D+ ++ +V     K        F L S      T+   +  DYE SS ++++++  D       T   + I ++D NDN P  T       + ED+     +      D DSG  G++T  L +  N  F +  S    Y      +LDRE   +    + ATDGG   L    ++SI V D NDNPP    S   + V EN P G  I +V   D D  +NA+VT  +  +  +     SY+ ++++   + +L   D E+   + LR+   D G P L+S
Sbjct:  123 VEIMDVNDNAPRFLTEEINIKIMENAAPGVRFPLKEATDSDVGKNSLQRYQ---LSP---NHHFSLVVQSGDDGTKYPELVLEKALDRE--EEGLHHLVLTAYDGGDPLRSGTASIRVTVVDVNDHTPVFSLPLYQATVPENVPVGTRLLTVNAIDLDEGIYGEVTYSFWKITPELLQIFHLSSLTGELSTL---KGLDYEQSSFYELEVQAQDGA--GSLTKAKVLITVLDVNDNAPEVTVTSVSSPVPEDTPPGTVIALFYLQDKDSGKNGEVTCSLPE--NLPFKLERSIDNYYRLVTARNLDREKMSVYNITLKATDGGIPPLSTETRMSIHVSDTNDNPPTFSDSSYSIYVPENNPRGASIFSVTAQDPDSDKNAQVTYALAEDTIQGVPVSSYVSINSDTGILYALGSFDYEQFRDLQLRVTARDSGDPPLSS 546          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Mouse
Match: Pcdhga7 (protocadherin gamma subfamily A, 7 [Source:MGI Symbol;Acc:MGI:1935219])

HSP 1 Score: 218.009 bits (554), Expect = 6.119e-61
Identity = 172/518 (33.20%), Postives = 256/518 (49.42%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGGQFE--TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD------AGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI---------LTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  L  A D D   N +  Y LS NH   F L ++ G     YPEL++  AL+ E   E   HL LTA+D G      T S+ +T +D ND+ P+F+  LY+ TV EN      +L V A DLDEG  G+++Y F  +TP E+   F L+ LTGE+  L+ LDYE  S    E  ++A D G+  L+   K+ I   D+NDN+P + +    S +PE+    T I   Y+ D DS  N +V C+   N  F+L  S +N   +   R  D E  S++ I ++  D GIPP++T   + I + D NDN P F+ + +   + E++     +F  +A D DS    ++TY L +        +    IN  TG +Y   S D E    L+  V A D G   L ++V + + V+D NDN P +  P +         L     EP G L+  V   D D G NA ++    +  E  LF   L     +   ++L+DR+ + Q  L + + DHG+P L++
Sbjct:  153 RFPLKEATDSDVGKNSLQRYQLSPNHH--FSLVVQSGDDGTKYPELVLEKALDREE--EGLHHLVLTAYDGGDPLRSGTASIRVTVVDVNDHTPVFSLPLYQATVPENVPVGTRLLTVNAIDLDEGIYGEVTYSFWKITP-ELLQIFHLSSLTGELSTLKGLDYEQSS--FYELEVQAQD-GAGSLT-KAKVLITVLDVNDNAPEVTVTSVSSPVPEDTPPGTVIALFYLQDKDSGKNGEVTCSLPENLPFKLERSIDNYYRLVTARNLDREKMSVYNITLKATDGGIPPLSTETRMSIHVSDTNDNPPTFSDSSYSIYVPENNPRGASIFSVTAQDPDSDKNAQVTYALAEDTIQGVPVSSYVSINSDTGILYALGSFDYEQFRDLQLRVTARDSGDPPLSSNVSLKLFVLDKNDNAPEILYPALPTDGSTGVELAPRSAEP-GYLVTKVVAVDKDSGPNAWLSYRLLKASEPGLFSVGLHTGEVRT-ARALLDRDALKQ-NLVVVVQDHGQPPLSA 658          

HSP 2 Score: 38.5058 bits (88), Expect = 6.119e-61
Identity = 38/121 (31.40%), Postives = 54/121 (44.63%), Query Frame = 3
Query:  189 KSTNVGNIFKMLNYQ---LFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            K + VGNI K L  Q   L      II    T     + F L  +SG ++T   IDR   EE+C     C   +  F  N ++  +       + I  EI+D NDN P+F   + NI ++E
Sbjct:   43 KGSFVGNITKDLGLQPRELAERGVRIITKGKT-----QLFSLNPRSGSLVTAGRIDR---EELCAQSPRC---LVSF--NILIEDKMNL----YPIEVEIMDVNDNAPRFLTEEINIKIME 146          

HSP 3 Score: 132.109 bits (331), Expect = 1.088e-30
Identity = 136/468 (29.06%), Postives = 214/468 (45.73%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI---EILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNS-NDNFRLHSSQENSLTIY----MERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY---RLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILT-VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDC-NG---SRYFQVNETSGAIYSTWSCRNGQF 2305
            FSLN  +G +    ++D E    Q    L+ F I   D+          IE+   D+NDN+PR    EI  N+ I EN             D D   N ++  + S N +F L     +  T Y    +E+  D E   +H + +  +D G P  +   S+ + ++D ND+ P+F+   +   + E+  V   L   +A DLD G +G++TY   ++     + F ++  TG +     LD E     E  V A DG G     KV ITV+D+NDN P +    + + V E+ P GT+I    + D D G+N  VT    + EN  F     +DN  ++     +DREK+S   + LK  D G P L++   ++I + D NDN P           +S   IYV  N    + I ++ A+D D D+N ++ + + +D   G   S Y  +N  +G +Y+  S    QF
Sbjct:   77 FSLNPRSGSLVTAGRIDREELCAQSPRCLVSFNILIEDK-----MNLYPIEVEIMDVNDNAPRFLTEEI--NIKIMENAAPGVRFPLKEATDSDVGKNSLQRYQLSPNHHFSLVVQSGDDGTKYPELVLEKALDREEEGLHHLVLTAYDGGDPLRSGTASIRVTVVDVNDHTPVFSLPLYQATVPENVPVGTRLLTVNAIDLDEGIYGEVTYSFWKITPELLQIFHLSSLTGELSTLKGLDYEQSSFYELEVQAQDGAGSLTKAKVLITVLDVNDNAPEVTVTSVSSPVPEDTPPGTVIALFYLQDKDSGKNGEVTC--SLPENLPFKLERSIDNYYRLVTARNLDREKMSVYNITLKATDGGIPPLSTETRMSIHVSDTNDNPPTFS--------DSSYSIYVPENNPRGASIFSVTAQDPDSDKNAQVTYALAEDTIQGVPVSSYVSINSDTGILYALGSFDYEQF 527          

HSP 4 Score: 115.931 bits (289), Expect = 1.034e-25
Identity = 123/439 (28.02%), Postives = 194/439 (44.19%), Query Frame = 2
Query:  782 ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTG-------EIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHD-DDSVHNKV-----KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIY---LYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLK-SPKILTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSL--IDREKVSQIFLRLKLVDHGRPKLTS 2026
            +  +D NDN P F        + EN    +     +A D D G+N    Y+   L+P   N  FSL   +G       E+ L + LD E   + L    + A D G P  SG+  I +   D+ND++P   + L   ++PEN  + T ++++   D D+ ++ +V     K        F L S      T+   +  DYE SS ++++++  D       T   + I ++D NDN P  T       + ED+     +      D DSG  G++T  L +  N  F +  S    Y      +LDRE   +    + ATDGG   L    ++SI V D NDNPP    S   + V EN P G  I +V   D D  +NA+VT  +  +  +     SY+ ++++   + +L   D E+   + LR+   D G P L+S
Sbjct:  123 VEIMDVNDNAPRFLTEEINIKIMENAAPGVRFPLKEATDSDVGKNSLQRYQ---LSP---NHHFSLVVQSGDDGTKYPELVLEKALDRE--EEGLHHLVLTAYDGGDPLRSGTASIRVTVVDVNDHTPVFSLPLYQATVPENVPVGTRLLTVNAIDLDEGIYGEVTYSFWKITPELLQIFHLSSLTGELSTL---KGLDYEQSSFYELEVQAQDGA--GSLTKAKVLITVLDVNDNAPEVTVTSVSSPVPEDTPPGTVIALFYLQDKDSGKNGEVTCSLPE--NLPFKLERSIDNYYRLVTARNLDREKMSVYNITLKATDGGIPPLSTETRMSIHVSDTNDNPPTFSDSSYSIYVPENNPRGASIFSVTAQDPDSDKNAQVTYALAEDTIQGVPVSSYVSINSDTGILYALGSFDYEQFRDLQLRVTARDSGDPPLSS 546          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Mouse
Match: Pcdhga10 (protocadherin gamma subfamily A, 10 [Source:MGI Symbol;Acc:MGI:1935227])

HSP 1 Score: 216.468 bits (550), Expect = 1.095e-59
Identity = 170/517 (32.88%), Postives = 257/517 (49.71%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITT--IDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL-----DDAGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKIL----TVLENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  LP A D D  +N + +Y LS N  K F L ++ G     YPEL++  AL+ E   E   HL L A D G    + ++ IT    D NDN P+FT   YR  + EN      +L+V A D DEG NG+++Y F      +++ KF L+K TGEIK+ + LDYE  S    E  I+A D G+     + K+ I   D+NDNSP + I    S + E+  + T I  + VHD DS  N +V C+ + N  F+L  S +N   +  +R  D E    + I +   D G PP++T     + + D NDN P F+   +   I E++     +F  +A D DS    +I Y L     + A    ++ IN  TG +Y   S D E    L+  V A+D G   L ++V +++ V+D NDN P +  P +     T +E  P    +G L+  V   D D G+NA ++    +  E  LF   L     +   ++L++R+ + Q  L + + DHG+P L++
Sbjct:  149 RFPLPEATDPDVGVNSLQSYQLSSN--KHFSLVVQSGAKGVKYPELVLEQALDREE--EAIHHLVLVASDGGNPPRSGTVLITVTVFDANDNAPVFTSTEYRVNIPENLPVGTQLLKVTATDKDEGANGEVTYAFRKSLDTQLS-KFQLDKHTGEIKISENLDYEEMS--FYEIEIQAEDGGA--YLATAKVLITVEDVNDNSPEVTITSLFSPVTEDSPVGTVIALLNVHDLDSGQNGEVACSISGNLPFKLEKSIDNYYRLVTQRALDREQVPAYNITVTATDGGNPPLSTKADFTLQVADINDNPPTFSHPSYFTYIPENNPRGASIFSVTALDPDSKENAQIVYSLAEDTIEGAPLSSYISINSDTGILYALWSFDYEQFRELQVQVTASDSGKPPLHSNVSLTLFVLDQNDNSPEILYPTMPTDGSTGVELAPRSAELGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFTVGLHTGEVRT-ARALMERDALKQ-SLVVAVQDHGQPPLSA 654          

HSP 2 Score: 35.4242 bits (80), Expect = 1.095e-59
Identity = 38/133 (28.57%), Postives = 54/133 (40.60%), Query Frame = 3
Query:  153 HSINMKLNDNVPKSTNVGNIFKMLNY---QLFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
              I   + + + K + VGNI K L     QL      II    +     + F L  + G ++T   IDR   EE+C   + C   +  F    IL     K    F I  E+ D NDN PKF     ++ + E
Sbjct:   27 RQIRYSVPEELEKGSFVGNIAKDLGLEPRQLAERGVRIISRGRS-----QLFSLNPRGGSLVTAGRIDR---EELCAQSAPC---LVSFN---ILVEDRVK---LFGIEIEVTDVNDNAPKFQAETLDVKINE 142          

HSP 3 Score: 151.754 bits (382), Expect = 7.710e-37
Identity = 139/470 (29.57%), Postives = 221/470 (47.02%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTI------------YMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLD---DAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILT-VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDC-NG---SRYFQVNETSGAIYSTWSCRNGQF 2305
            FSLN   G +    ++D E    Q    L+ F I  + E   +L G   IEI  TD+NDN+P+ +  + + +  N+ +A P M   + +            NS  +++L S++  SL +             +E+  D E  +IH + +   D G PP +    + + + D NDN P+FT  ++   I E+  V   L + +ATD D G  G++TY      D    +F ++  TG I +  +LD E     E  + A DGG   A+ KV ITV D+NDN P +    + + V E+ P+GT+I  + V DLD G+N  V     +  N  F     +DN  ++  +  +DRE+V    + +   D G P L++    T+ + DINDN P   +PS        + I  N    + I ++ A D D  EN +I + + +D   G   S Y  +N  +G +Y+ WS    QF
Sbjct:   73 FSLNPRGGSLVTAGRIDREELCAQSAPCLVSFNI--LVEDRVKLFG---IEIEVTDVNDNAPKFQA-ETLDVKINENVA-PGMRFPLPE----ATDPDVGVNSLQSYQLSSNKHFSLVVQSGAKGVKYPELVLEQALDREEEAIHHLVLVASDGGNPPRSGTVLITVTVFDANDNAPVFTSTEYRVNIPENLPVGTQLLKVTATDKDEGANGEVTYAFRKSLDTQLSKFQLDKHTGEIKISENLDYEEMSFYEIEIQAEDGGAYLATAKVLITVEDVNDNSPEVTITSLFSPVTEDSPVGTVIALLNVHDLDSGQNGEVAC--SISGNLPFKLEKSIDNYYRLVTQRALDREQVPAYNITVTATDGGNPPLSTKADFTLQVADINDNPPTFSHPS------YFTYIPENNPRGASIFSVTALDPDSKENAQIVYSLAEDTIEGAPLSSYISINSDTGILYALWSFDYEQF 523          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Mouse
Match: Pcdhga9 (protocadherin gamma subfamily A, 9 [Source:MGI Symbol;Acc:MGI:1935226])

HSP 1 Score: 210.305 bits (534), Expect = 1.595e-57
Identity = 168/521 (32.25%), Postives = 261/521 (50.10%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFI--TTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK----FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL-----DDAGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKIL----TVLENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  LP A D D  IN + +Y LS N  + F L ++ G      PEL++   L+ E   E   HL LTA+D G    + +  I  T +D NDN P+F   +YR  V EN      +L V+A D DEG NGK++Y+F     ++IN+K    F L++ TGE+ + + LDYE  S  L E  I+A D G   L G  K+ +   D+NDN P + I    S + E+    T I+    HD DS  N +V C+   N +F+L +S ++   +   +  D E +S + I +   D G P M+T   + + + D NDN P F++  +   + E++     +F  SA D D     K+TY L       A    +V IN  TG +Y   S D E  + L+  V A+D G   L ++V +S+ ++D NDN P++  P +     T +E  P     G L+  V   D D G+NA ++    +  E  LF   L+    +   ++L++R+ + Q  + + + DHG+P L++
Sbjct:  152 RYPLPEAVDPDVGINSLQSYQLSPN--RHFSLHLQTGDDGTINPELVLERTLDREE--EPTHHLVLTAYDGGNPRRSSTALIQVTVLDTNDNAPVFDQPVYRVKVLENVAPGTLLLTVRASDPDEGANGKVTYKF-----RKINEKHSLLFHLHENTGEMTVAKNLDYEECS--LYEMEIQAEDGGG--LKGRTKVVVMVEDVNDNRPEVTITSLFSPVREDAPPGTVILLFNAHDQDSGKNGQVVCSIQENPSFKLENSVDDYYRLLTAQILDREKASEYNITVTATDRGTPSMSTEVHITLYVADINDNPPAFSQTSYSVYLPENNPRGTSIFSVSAHDPDDEENAKVTYSLVENTIQGAPLSSYVSINSDTGVLYALQSFDYEQFQNLQMQVKASDNGHPPLSSNVSLSVFLLDQNDNAPKILYPSLPTDGSTGVELAPRSAEAGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFTVGLRSGEIRT-ARALLERDALKQSLV-VAVQDHGQPPLSA 657          

HSP 2 Score: 34.6538 bits (78), Expect = 1.595e-57
Identity = 40/140 (28.57%), Postives = 62/140 (44.29%), Query Frame = 3
Query:  111 VIFCISLADAIAEEHSINMKLNDNVPKSTN----VGNIFKMLN---YQLFNENYHIIVGTSTFTKFHEFFKLF-KSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKF 506
            V+ C +L   + E  +  ++ +  VP+ T     VGNI K L     +L      II    T     + F L  +SG ++T   IDR   EE+C   + C   +  F+   +L     K    + +  E++D NDN PKF
Sbjct:   15 VVLC-ALLGMLWEARAGQIRYS--VPEETEKGYIVGNISKDLGLEPRELAERGVRIISKGKT-----QLFSLSPRSGSLVTAGRIDR---EELCAQSATC---LLNFK---VLVEDRVK---LYGVEVEVVDINDNAPKF 134          

HSP 3 Score: 136.346 bits (342), Expect = 5.030e-32
Identity = 124/470 (26.38%), Postives = 215/470 (45.74%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATP----IMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTI----YMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE---FVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILT-VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNN-----KIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDC-NG---SRYFQVNETSGAIYSTWSCRNGQF 2305
            FSL+  +G +    ++D E    Q    L+ F +   D    +L G   +E+   DINDN+P+ E  +N+ + +   IA P     +   V  D  +++      + N +F LH    +  TI     +ERT D E    H + +  +D G P  ++   + + ++D NDN P+F +  +  ++ E+      L    A+D D G  GK+TY+      K    F ++ +TG + +  +LD E   + E  + A DGGGL+   KV + V D+NDN P +    + + V E+ P GT+I      D D G+N +V     +QEN  F    KL+N+     ++    ++DREK S+  + +   D G P +++       +        I + P      +    +  N    + I ++ A D D +EN K+ + ++++   G   S Y  +N  +G +Y+  S    QF
Sbjct:   76 FSLSPRSGSLVTAGRIDREELCAQSATCLLNFKVLVEDRV--KLYG---VEVEVVDINDNAPKFEA-ENLFV-KISEIAAPGARYPLPEAVDPDVGINSLQSYQLSPNRHFSLHLQTGDDGTINPELVLERTLDREEEPTHHLVLTAYDGGNPRRSSTALIQVTVLDTNDNAPVFDQPVYRVKVLENVAPGTLLLTVRASDPDEGANGKVTYKFRKINEKHSLLFHLHENTGEMTVAKNLDYEECSLYEMEIQAEDGGGLKGRTKVVVMVEDVNDNRPEVTITSLFSPVREDAPPGTVILLFNAHDQDSGKNGQVVC--SIQENPSF----KLENSVDDYYRLLTAQILDREKASEYNITVTATDRGTPSMST------EVHITLYVADINDNPPAFSQTSYSVYLPENNPRGTSIFSVSAHDPDDEENAKVTYSLVENTIQGAPLSSYVSINSDTGVLYALQSFDYEQF 526          
BLAST of Protocadherin-1 isoform 2 vs. UniProt/SwissProt
Match: sp|Q5DRB3|PCDG7_PANTR (Protocadherin gamma-A7 OS=Pan troglodytes OX=9598 GN=PCDHGA7 PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.332e-61
Identity = 171/518 (33.01%), Postives = 260/518 (50.19%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD-----AGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI---------LTVLENEPIGTLIGNVEVFDLDDGENARVT-IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  L  A D D   N + +Y LS N  + F L+++ G     YPEL++   L+ E   ER  HL LTA D G   +  T  + +T +D ND+ P+F+   Y+ TV EN      +L V A DLDEG NG+++Y F  +TP+ +   F LN LTGEI  L+ LDYE       E  ++A D   P      K+ I   D+NDN+P + +   + SIPE+  + T I   Y+ D DS  N +V C    N  F+L  S +N   +   +  D E  S++ I ++  D G PP++    +F+ + D NDN P F  + +   I+E++     +F  +A D DS +  +ITY L +     A    +V IN  TG +Y   S D E    L+  V A D G   L +++ +S+ V+D NDNPP +  P +         L     EP G L+  V   D D G+NA ++ +  +  E  LF   L     +   ++L+DR+ + Q  + + + DHG+P L++
Sbjct:  151 RFPLSEAGDPDVGTNSLQSYQLSPN--RHFSLAVQSGDDGTKYPELVLERVLDREE--ERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPK-LPQMFHLNSLTGEISTLEGLDYE--ETAFYEMEVQAQD--GPGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIPENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYSVYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQSFDYEQLRELQLRVTAHDSGDPPLSSNMSLSLFVLDQNDNPPEILYPALPTDGSTGMELAPRSAEP-GYLVTKVVAVDKDSGQNAWLSYLLLKASEPGLFAVGLYTGEVRT-ARALLDRDALKQSLV-VAVQDHGQPPLSA 656          

HSP 2 Score: 36.1946 bits (82), Expect = 1.332e-61
Identity = 37/124 (29.84%), Postives = 55/124 (44.35%), Query Frame = 3
Query:  189 KSTNVGNIFKMLNYQ---LFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKD---ICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            K + VG+I K L  +   L      II    T     + F L  +SG ++T   IDR   EEIC   + C  +   + E + N             + I+ EIID NDN P+F   + N+ ++E
Sbjct:   41 KGSFVGDIAKDLGLEPRELAERGVRIISRGRT-----QLFALNQRSGSLVTAGRIDR---EEICAQSARCLVNFNILMEDKMNL------------YPIDVEIIDINDNVPRFLTEEINVKIME 144          

HSP 3 Score: 132.109 bits (331), Expect = 7.568e-30
Identity = 134/462 (29.00%), Postives = 208/462 (45.02%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI---EILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNS-NDNFRLHSSQENSLTIY----MERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY---RLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDC-NG---SRYFQVNETSGAIYSTWS 2287
            F+LN+ +G +    ++D E    Q    L+ F I   D+          I++   DINDN PR    EI  NV I EN             D D   N ++  + S N +F L     +  T Y    +ER  D E   +H + +   D G PP ++   + + ++D ND+ P+F+  Q+   + E+  V   L    A DLD G  G++TY   ++     + F +N  TG I     LD E     E  V A DG G     KV ITV+D+NDN P +    +  ++ E+ P+GT+I    + D D G+N  VT    + EN  F     +DN  ++     +DRE +S   + LK  D G P L+    I + + D NDN P   + S          +Y+  N    + I  + A+D D ++N +I + + +D   G   S Y  +N  +G +Y+  S
Sbjct:   75 FALNQRSGSLVTAGRIDREEICAQSARCLVNFNILMEDK-----MNLYPIDVEIIDINDNVPRFLTEEI--NVKIMENTAPGVRFPLSEAGDPDVGTNSLQSYQLSPNRHFSLAVQSGDDGTKYPELVLERVLDREEERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPKLPQMFHLNSLTGEISTLEGLDYEETAFYEMEVQAQDGPGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTC--TIPENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYS--------VYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQS 519          

HSP 4 Score: 120.939 bits (302), Expect = 2.290e-26
Identity = 124/441 (28.12%), Postives = 201/441 (45.58%), Query Frame = 2
Query:  782 ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTG-------EIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHD-DDSVHNKV-----KCNKNSNDNFRLHSSQENSLT--IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIY---LYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLK-SPKILTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSL--IDREKVSQIFLRLKLVDHGRPKLTS 2026
            +  ID NDN P F        + ENT   +     +A D D G N   SY+   L+P   N  FSL   +G       E+ L + LD E   +++    + A D G P  S +  I++   D+ND++P   + +  V++PEN  + T +++++  D D+ V+ +V     K        F L     NSLT  I      DYE ++ ++++++  D   P   T   + I ++D NDN P  T       I ED+ +   +      D DSG  G++T  + +  N  F +  S    Y      +LDRE   +    + ATDGG   L     + + V D NDNPP    S   + + EN P G  I  V   D D  +NA++T  +  +  + A   SY+ ++++   + +L   D E++ ++ LR+   D G P L+S
Sbjct:  121 VEIIDINDNVPRFLTEEINVKIMENTAPGVRFPLSEAGDPDVGTNSLQSYQ---LSP---NRHFSLAVQSGDDGTKYPELVLERVLDRE--EERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPKLPQMFHL-----NSLTGEISTLEGLDYEETAFYEMEVQAQDG--PGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIPE--NLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYSVYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQSFDYEQLRELQLRVTAHDSGDPPLSS 544          
BLAST of Protocadherin-1 isoform 2 vs. UniProt/SwissProt
Match: sp|Q9Y5G6|PCDG7_HUMAN (Protocadherin gamma-A7 OS=Homo sapiens OX=9606 GN=PCDHGA7 PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.612e-61
Identity = 172/518 (33.20%), Postives = 260/518 (50.19%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD-----AGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI---------LTVLENEPIGTLIGNVEVFDLDDGENARVT-IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  L  A D D   N + +Y LS N  + F L+++ G     YPEL++   L+ E   ER  HL LTA D G   +  T  + +T +D ND+ P+F+   Y+ TV EN      +L V A DLDEG NG+++Y F  +TP+ +   F LN LTGEI  L+ LDYE       E  ++A D   P      K+ I   D+NDN+P + +   + SIPE+  + T I   Y+ D DS  N +V C    N  F+L  S +N   +   +  D E  S++ I ++  D G PP++    +F+ + D NDN P F  + +   I+E++     +F  +A D DS +  +ITY L +     A    +V IN  TG +Y   S D E    L+  V A D G   L +++ +S+ V+D NDNPP +  P +         L     EP G L+  V   D D G+NA ++ +  +  E  LF   L     +   ++L+DR+ + Q  L + + DHG+P L++
Sbjct:  151 RFPLSEAGDPDVGTNSLQSYQLSPN--RHFSLAVQSGDDETKYPELVLERVLDREE--ERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPK-LPKMFHLNSLTGEISTLEGLDYE--ETAFYEMEVQAQD--GPGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIPENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYSVYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQSFDYEQLRELQLRVTAHDSGDPPLSSNMSLSLFVLDQNDNPPEILYPALPTDGSTGMELAPRSAEP-GYLVTKVVAVDKDSGQNAWLSYLLLKASEPGLFAVGLYTGEVRT-ARALLDRDALKQ-SLVVAVQDHGQPPLSA 656          

HSP 2 Score: 36.1946 bits (82), Expect = 1.612e-61
Identity = 37/124 (29.84%), Postives = 55/124 (44.35%), Query Frame = 3
Query:  189 KSTNVGNIFKMLNYQ---LFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKD---ICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            K + VG+I K L  +   L      II    T     + F L  +SG ++T   IDR   EEIC   + C  +   + E + N             + I+ EIID NDN P+F   + N+ ++E
Sbjct:   41 KGSFVGDIAKDLGLEPRELAERGVRIISRGRT-----QLFALNQRSGSLVTAGRIDR---EEICAQSARCLVNFNILMEDKMNL------------YPIDVEIIDINDNVPRFLTEEINVKIME 144          

HSP 3 Score: 133.265 bits (334), Expect = 3.116e-30
Identity = 134/462 (29.00%), Postives = 207/462 (44.81%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI---EILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNS-NDNFRLHSSQENSLTIY----MERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY---RLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDD----CNGSRYFQVNETSGAIYSTWS 2287
            F+LN+ +G +    ++D E    Q    L+ F I   D+          I++   DINDN PR    EI  NV I EN             D D   N ++  + S N +F L     +  T Y    +ER  D E   +H + +   D G PP ++   + + ++D ND+ P+F+  Q+   + E+  V   L    A DLD G  G++TY   ++     K F +N  TG I     LD E     E  V A DG G     KV ITV+D+NDN P +    +  ++ E+ P+GT+I    + D D G+N  VT    + EN  F     +DN  ++     +DRE +S   + LK  D G P L+    I + + D NDN P   + S          +Y+  N    + I  + A+D D ++N +I + + +D       S Y  +N  +G +Y+  S
Sbjct:   75 FALNQRSGSLVTAGRIDREEICAQSARCLVNFNILMEDK-----MNLYPIDVEIIDINDNVPRFLTEEI--NVKIMENTAPGVRFPLSEAGDPDVGTNSLQSYQLSPNRHFSLAVQSGDDETKYPELVLERVLDREEERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPKLPKMFHLNSLTGEISTLEGLDYEETAFYEMEVQAQDGPGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTC--TIPENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYS--------VYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQS 519          

HSP 4 Score: 120.553 bits (301), Expect = 2.560e-26
Identity = 124/441 (28.12%), Postives = 201/441 (45.58%), Query Frame = 2
Query:  782 ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTG-------EIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHD-DDSVHNKV-----KCNKNSNDNFRLHSSQENSLT--IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIY---LYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLK-SPKILTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSL--IDREKVSQIFLRLKLVDHGRPKLTS 2026
            +  ID NDN P F        + ENT   +     +A D D G N   SY+   L+P   N  FSL   +G       E+ L + LD E   +++    + A D G P  S +  I++   D+ND++P   + +  V++PEN  + T +++++  D D+ V+ +V     K        F L     NSLT  I      DYE ++ ++++++  D   P   T   + I ++D NDN P  T       I ED+ +   +      D DSG  G++T  + +  N  F +  S    Y      +LDRE   +    + ATDGG   L     + + V D NDNPP    S   + + EN P G  I  V   D D  +NA++T  +  +  + A   SY+ ++++   + +L   D E++ ++ LR+   D G P L+S
Sbjct:  121 VEIIDINDNVPRFLTEEINVKIMENTAPGVRFPLSEAGDPDVGTNSLQSYQ---LSP---NRHFSLAVQSGDDETKYPELVLERVLDRE--EERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPKLPKMFHL-----NSLTGEISTLEGLDYEETAFYEMEVQAQDG--PGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIPE--NLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYSVYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQSFDYEQLRELQLRVTAHDSGDPPLSS 544          
BLAST of Protocadherin-1 isoform 2 vs. UniProt/SwissProt
Match: sp|Q91XY4|PCDG4_MOUSE (Protocadherin gamma-A4 OS=Mus musculus OX=10090 GN=Pcdhga4 PE=1 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.826e-61
Identity = 177/518 (34.17%), Postives = 261/518 (50.39%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGGQFE--TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK-VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD-----AGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI---------LTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  LP A+DLD  +N +  Y LS N    F L ++ G     YPEL++ +AL+ E   E   HL LTAFD G      T ++ +T +D NDN P+FT   Y  +VKEN      +L ++A D DEG NG+++Y F  +  ++I+  F LN LTG+I +L +LDYE       +  +EA D   P L    K+ +   D+NDN+P + +     SI E     T I    VHD DS  N  V C+   N  FRL  +  N   + + RT D E  S + I I   D G PP++T   + + ++D NDN P FT A +   I E++     +   +A D DSG   ++ Y L +     A    +V IN +TG +Y   S D E  + L+  V A D G   L ++V +S++V+D NDN P +  P I         LT    +P G L+  V   D D G+NA ++    +  E  LF   L     +   ++L+DR+ + Q  L + + DHG+P L++
Sbjct:  150 RFPLPEAFDLDIGVNALQGYQLSSN--DHFSLDVQSGPDGIKYPELVLENALDREE--EAVHHLVLTAFDGGDPVRSGTATIQVTLVDTNDNAPVFTQPEYHISVKENLPVGTRLLTIKATDPDEGVNGEVTYSFRNVR-EKISQLFQLNSLTGDITVLGELDYE--DSGFYDVDVEAHD--GPGLRARSKVLVTVLDVNDNAPEVTVTSLTSSIQEASSPGTVIALFNVHDSDSGENGLVTCSIPDNLPFRLEKTYGNYHRLLIHRTLDREEVSDYNITITATDQGTPPLSTETYISLQVVDINDNPPTFTHASYSAYIPENNPRGASILSITAQDPDSGENAQVIYSLSEDTIQGAPMSSYVSINSNTGVLYALRSFDYEQFQDLKLLVTARDSGTPPLSSNVSLSLSVLDQNDNTPEILYPTIPTDGSTGVELTPRSADP-GYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRT-ARALLDRDALKQ-SLVVTVQDHGQPPLSA 655          

HSP 2 Score: 37.7354 bits (86), Expect = 1.826e-61
Identity = 42/159 (26.42%), Postives = 68/159 (42.77%), Query Frame = 3
Query:   81 KSEIQMVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQ---LFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQ 545
            KS+ + +++  IF  SL D  AE+  I   + + + + + VGN+   L  +   L      I+    T     + F L  +SG ++T   +DR   E +C     C+ ++       IL     +      I  EIID NDN P F   +  I V E +
Sbjct:    6 KSDRRGLIWICIFLGSLCDIRAEQ--IRYSVPEELERGSVVGNLAADLGLEPGKLAERGVRIVSRGKT-----QLFALNPRSGSLVTAGRVDR---EGLCDRSPKCTANL------EILLEDKVR---ILAIEVEIIDVNDNAPSFGAQQREIKVAESE 145          

HSP 3 Score: 137.887 bits (346), Expect = 1.245e-31
Identity = 134/482 (27.80%), Postives = 226/482 (46.89%), Query Frame = 2
Query:  911 ENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFT--IEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNK-NSNDNFRLH-SSQENSLT---IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNK---EFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKIL-TVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDD----CNGSRYFQVNETSGAIYSTWSCRNGQF 2305
            E GK++ R   +  +     F+LN  +G +    ++D E   D+  + T  +E + E   ++     IE+   D+NDN+P      + + + E++   T        D D   N ++  + +SND+F L   S  + +    + +E   D E  ++H + +  FD G P  +   ++ + ++D NDN P+FT+ ++   + E+  V   L    ATD D G  G++TY   +   K    F +N  TG I +   LD E     +  V A DG GL A  KV +TV+D+NDN P +    +  ++ E    GT+I    V D D GEN  VT    + +N  F       N +++ I   +DRE+VS   + +   D G P L++   I++ ++DINDN P   + S        + I  N    + IL++ A+D D  EN ++ + + +D       S Y  +N  +G +Y+  S    QF
Sbjct:   54 EPGKLAERGVRIVSRGKTQLFALNPRSGSLVTAGRVDREGLCDRSPKCTANLEILLEDKVRI---LAIEVEIIDVNDNAPSFGAQQREIKVAESENPGTRFPLPEAFDLDIGVNALQGYQLSSNDHFSLDVQSGPDGIKYPELVLENALDREEEAVHHLVLTAFDGGDPVRSGTATIQVTLVDTNDNAPVFTQPEYHISVKENLPVGTRLLTIKATDPDEGVNGEVTYSFRNVREKISQLFQLNSLTGDITVLGELDYEDSGFYDVDVEAHDGPGLRARSKVLVTVLDVNDNAPEVTVTSLTSSIQEASSPGTVIALFNVHDSDSGENGLVTC--SIPDNLPFRLEKTYGNYHRLLIHRTLDREEVSDYNITITATDQGTPPLSTETYISLQVVDINDNPPTFTHAS------YSAYIPENNPRGASILSITAQDPDSGENAQVIYSLSEDTIQGAPMSSYVSINSNTGVLYALRSFDYEQF 524          
BLAST of Protocadherin-1 isoform 2 vs. UniProt/SwissProt
Match: sp|Q5DRB2|PCDG8_PANTR (Protocadherin gamma-A8 OS=Pan troglodytes OX=9598 GN=PCDHGA8 PE=3 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 5.158e-60
Identity = 179/521 (34.36%), Postives = 260/521 (49.90%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK----FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYR-----LDDAGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKIL----TVLENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  LP A D D  +N + +Y LS NH   F L ++ G      PEL++  AL+ E   E   HL LTA D G   +  T+ + +T +D NDN P+F   +YR  V EN      +L V A D DEG NGK++Y+F     ++IN+K    F LN+ TGEI + + LDYE  S    E  I+A D G+  L G  K+ I   D+NDN P + I    S + EN    T I  + VHD DS  N +V C+   N  F+L  S +N   +   +  D EN SI+ I +   D G PP++T   + + + D NDN P F  A +   I E++     +F  +A D DS    ++TY      L  A    ++ IN  TG +Y   S D E    L+  V A+D G   L ++V +S+ V+D NDN P +  P +     T LE  P     G L+  V   D D G+NA ++    +  E  LF   L     +   ++L+DR+ + Q  + + + DHG+P L++
Sbjct:  151 RYPLPEAVDPDVGVNSLQSYQLSPNHH--FSLDVQTGDNGAINPELVLERALDREE--EAAHHLVLTASDGGEPRRSSTVRIHVTVLDTNDNAPVFPHPIYRVKVLENMPPGTRLLTVTASDPDEGINGKVAYKF-----RKINEKQTPLFQLNENTGEISIAKSLDYEECS--FYEMEIQAEDVGA--LLGRTKLLISVEDVNDNRPEVIITSLFSPVLENSLPGTVIAFLSVHDQDSGKNGQVVCHTRDNLPFKLEKSIDNYYRLVTRKYLDRENVSIYNITVMASDLGTPPLSTETQIALHVADINDNPPTFPHASYSAYILENNLRGASIFSLTAHDPDSQENAQVTYSVTEDTLQGAPLSSYISINSDTGVLYALQSFDYEQIRDLQLLVTASDSGDPPLSSNVSLSLFVLDQNDNAPEILYPTLPTDGSTGLELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRT-ARALLDRDALKQSLV-VAVQDHGQPPLSA 656          

HSP 2 Score: 33.4982 bits (75), Expect = 5.158e-60
Identity = 36/117 (30.77%), Postives = 50/117 (42.74%), Query Frame = 3
Query:  180 NVPKSTN----VGNIFKMLNY---QLFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKF 506
            +VP+ T+    VGNI K L     +L      I+    T     + F L  +SG ++T   IDR   EE+C          C    N ++  +       F I  EI+D NDN PKF
Sbjct:   34 SVPEETDKGSFVGNISKDLGLDPRELAKHGVRIVSRGRT-----QLFALNPRSGSLVTAGRIDR---EELC-----AQSPRCLININILVEDKGKL----FGIEIEIVDINDNNPKF 133          

HSP 3 Score: 127.872 bits (320), Expect = 1.365e-28
Identity = 130/462 (28.14%), Postives = 211/462 (45.67%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI------LKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTI----YMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE---FVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILT-VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDC-NG---SRYFQVNETSGAIYSTWS 2287
            F+LN  +G +    ++D E    Q    LI   I   D+G  +L G   IEI   DINDN+P+ ++      +  +++P   R   P     V  D  V++      + N +F L     ++  I     +ER  D E  + H + +   D G P  ++   + + ++D NDN P+F    +  ++ E+      L   +A+D D G  GK+ Y+      K+   F +N +TG I +  SLD E     E  + A D G L    K+ I+V D+NDN P +    + + VLEN   GT+I  + V D D G+N +V      ++N  F     +DN  ++  +  +DRE VS   + +   D G P L++   I + + DINDN P   + S        + I  N    + I +L A D D  EN ++ + + +D   G   S Y  +N  +G +Y+  S
Sbjct:   75 FALNPRSGSLVTAGRIDREELCAQSPRCLININILVEDKG--KLFG---IEIEIVDINDNNPKFQVEDLEVKINEIAVP-GARYPLPEA---VDPDVGVNSLQSYQLSPNHHFSLDVQTGDNGAINPELVLERALDREEEAAHHLVLTASDGGEPRRSSTVRIHVTVLDTNDNAPVFPHPIYRVKVLENMPPGTRLLTVTASDPDEGINGKVAYKFRKINEKQTPLFQLNENTGEISIAKSLDYEECSFYEMEIQAEDVGALLGRTKLLISVEDVNDNRPEVIITSLFSPVLENSLPGTVIAFLSVHDQDSGKNGQVVC--HTRDNLPFKLEKSIDNYYRLVTRKYLDRENVSIYNITVMASDLGTPPLSTETQIALHVADINDNPPTFPHAS------YSAYILENNLRGASIFSLTAHDPDSQENAQVTYSVTEDTLQGAPLSSYISINSDTGVLYALQS 519          
BLAST of Protocadherin-1 isoform 2 vs. UniProt/SwissProt
Match: sp|Q9Y5G9|PCDG4_HUMAN (Protocadherin gamma-A4 OS=Homo sapiens OX=9606 GN=PCDHGA4 PE=1 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 1.553e-59
Identity = 172/519 (33.14%), Postives = 253/519 (48.75%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG-----YPELLILSALNFENVNERKFHLQLTAFDRGGQFE--TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK-VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD-----AGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKIL----TVLENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLV--DHGRPKLTS 2026
            R  LP A+D D  +N +  Y L+ N   +F L ++ G     YPEL++  AL+ E   E   HL LTAFD G      T  + I  +D NDN P+FT   Y  +V+EN      +L V+A D DEG NG ++Y F  +   +I+  F LN L+G+I +L  LDYE       +  +EA D   P L    K+ +   D NDN+P + +     S+ E+    T I    VHD DS  N  V C+   N  F L  +  N   +   RT D E  S + I +   D G PP++T   + + ++D NDN P F  A +   I E++     +   +A D DSG+  +ITY L +     A    +V IN +TG +Y   S D E    L+  + A+D G   L ++V +S+ V+D NDN P +  P       T +E  P     G L+  V   D D G+NA ++    +  E  LF   L     +   ++L+DR+ + Q   RL +V  DHG+P L++
Sbjct:  182 RFPLPEAFDPDVGVNSLQGYQLNSN--GYFSLDVQSGADGIKYPELVLERALDREE--EAVHHLVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKATDPDEGANGDVTYSFRKVR-DKISQLFQLNSLSGDITILGGLDYE--DSGFYDIDVEAHD--GPGLRARSKVLVTVLDENDNAPEVTVTSLTSSVQESSSPGTVIALFNVHDSDSGGNGLVTCSIPDNLPFTLEKTYGNYYRLLTHRTLDREEVSEYNITVTATDQGTPPLSTETHISLQVMDINDNPPTFPHASYSAYIPENNPRGASILSMTAQDPDSGDNARITYSLAEDTFQGAPLSSYVSINSNTGILYALCSFDYEQFRDLQLLMTASDSGDPPLSSNVSLSLFVLDQNDNVPEILYPTFPTDGSTGVELAPRSADSGYLVTKVVAVDRDSGQNAWLSYSLLKSSEPGLFAVGLHTGEVRT-ARALLDRDALKQ---RLVVVVQDHGQPPLSA 687          

HSP 2 Score: 37.7354 bits (86), Expect = 1.553e-59
Identity = 37/119 (31.09%), Postives = 51/119 (42.86%), Query Frame = 3
Query:  201 VGNIFKMLNY---QLFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQ 545
            VGNI K L     +L      I+    T     + F L  +SG ++T   IDR   EE+C     C  ++       IL   + K     ++  EIID NDNPP F   +  I V E +
Sbjct:   76 VGNIAKDLGLAPRELAERGVRIVSRGRT-----QLFALNPRSGTLVTAGRIDR---EELCDRSPNCVTNL------EILLEDTVK---ILRVEVEIIDVNDNPPSFGTEQREIKVAENE 177          

HSP 3 Score: 134.035 bits (336), Expect = 1.972e-30
Identity = 131/471 (27.81%), Postives = 218/471 (46.28%), Query Frame = 2
Query:  971 FSLNKLTGEIKLLQKLDYEIYSDQ----------LIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNK-NSNDNFRLH-SSQENSLT---IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY---RLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKIL-TVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNN--KIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDC-NG---SRYFQVNETSGAIYSTWSCRNGQF 2305
            F+LN  +G +    ++D E   D+          L+E T++ +           ++E+   D+NDN P      + + + EN+            D D   N ++  + NSN  F L   S  + +    + +ER  D E  ++H + +  FD G P  +    + I ++D NDN P+FT+ ++   + E+  V   L    ATD D G  G +TY   ++ D  ++ F +N  +G I +   LD E     +  V A DG GL A  KV +TV+D NDN P +    +  +V E+   GT+I    V D D G N  VT    + +N L ++  K   N  ++     +DRE+VS+  + +   D G P L++   I++ ++DINDN P   + S        + I  N    + IL++ A+D D  +N +I + + +D   G   S Y  +N  +G +Y+  S    QF
Sbjct:  106 FALNPRSGTLVTAGRIDREELCDRSPNCVTNLEILLEDTVKIL-----------RVEVEIIDVNDNPPSFGTEQREIKVAENENPGARFPLPEAFDPDVGVNSLQGYQLNSNGYFSLDVQSGADGIKYPELVLERALDREEEAVHHLVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKATDPDEGANGDVTYSFRKVRDKISQLFQLNSLSGDITILGGLDYEDSGFYDIDVEAHDGPGLRARSKVLVTVLDENDNAPEVTVTSLTSSVQESSSPGTVIALFNVHDSDSGGNGLVTC--SIPDN-LPFTLEKTYGNYYRLLTHRTLDREEVSEYNITVTATDQGTPPLSTETHISLQVMDINDNPPTFPHAS------YSAYIPENNPRGASILSMTAQDPDSGDNARITYSLAEDTFQGAPLSSYVSINSNTGILYALCSFDYEQF 556          
BLAST of Protocadherin-1 isoform 2 vs. TrEMBL
Match: A0A0R3TU25 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11230 PE=4 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 4.237e-94
Identity = 220/669 (32.88%), Postives = 329/669 (49.18%), Query Frame = 2
Query:  542 TKNYRMSLPTAYDLDSSINGVYNYSLSENHKK--FFQLSIEK----------GY----PELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI--DRNDNKPIF-TDILYRKTVKENTTYTI-PILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSV-HNKVKCNKNSN-------DNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFI--AIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG------NKEFVINISTGYIYLYNS--LDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE----NEVQENALFYSYLKLDN------------------NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSST 2368
             K  R  LP+A DLDS  NGV  Y +  N      FQL+ EK          G+    P LL L  L++EN  +R+F L + A D G    T SL +T I  D NDN P F    +    + ENTTY+  PI +  A D D GENG I+Y    L   ++ + FS+++  G + L   LDYE+YS++     + A D G+P+ SG+  + I + DINDN P + + +N+++ E      P++  YV DDDSV   KV C             + RL     N+  ++ E  FDYE +    + I C D   P  A  + L I  A+ D ND++P F  A+   ++ E S V   + Q  ATD D G   K+TY L  +       ++   I+  TG + + NS  LDREV + +E F+ A DGGGL  SVK+ + +MDINDN P ++  + L V EN P G ++G +   DLD G NA++ +E    N +Q  + F    + +N                    +  K  +DRE V    + L   D G P+  + +T+ + ++D NDN P L +P     +     +Y N+   S +  L + D D  ENG + + +  D NGSR+FQ+ +++G + + W  +       P +G+Y V + L D   T
Sbjct:  167 AKFAREMLPSAIDLDSVGNGVVQYRIEANSPSADLFQLTYEKVLINSLNESHGWRLSPPTLLQLRELDYENPADRQFELVVLAIDGGEPSHTGSLSVTVILMDVNDNTPQFEKTTITTIELAENTTYSPDPIYKFAASDADSGENGLITYSLSPLNDPKVFENFSIDRRLGALHLNTLLDYEVYSERSFSVIVVASDNGTPKRSGTTTLTIVTKDINDNLPSLVVQENITVIEGLNYTKPVVRFYVKDDDSVSRGKVFCRPAPTTPMRIGLPSLRLQEVTTNAYFVFAEGIFDYEETHYASVGIICTDRTDPTNAPDQLLHITVAVGDSNDHYPEFAVAEFHAKLLEHSPVGTRVIQVVATDADEGIHAKLTYSLVSSATGRCSISETLQIDSLTGVVSVKNSECLDREVNDEIEAFIAAKDGGGLSTSVKLRVRLMDINDNDPIIQISESLGVSENFPPGVVVGKIRCSDLDSGSNAKILLELSENNTLQVRSAFDIIPEGENLGNLFASRANVRGMSDVTGLLITKRTLDREDVETYNINLVARDLGEPQRVTRKTVQVIVLDENDNSPTLRFPQPNTTVGYHPQVYANSPHGSKVCVLRSHDPDRGENGTVIYALQQDTNGSRFFQLEQSTGKLTTAWYNKG------PPSGVYAVRVLLYDMGRT 829          

HSP 2 Score: 77.7962 bits (190), Expect = 4.237e-94
Identity = 43/121 (35.54%), Postives = 64/121 (52.89%), Query Frame = 3
Query:  168 KLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGT-STFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPA-------VNFQINFEIIDENDNPPKF 506
            ++ D +    N+GNI   L +   N  + +IV T S F +F+E+F +FK+G II  K +DRDN  +ICGPL CC   +C  QA  +   + +          +   +   + D NDNPPKF
Sbjct:   30 QMVDEIKTGENIGNICNSL-WPNSNRVFSLIVVTYSRFQRFNEYFSIFKNGTIIAQKHVDRDNVNDICGPLDCCQSPVCTIQAKVMFIVEQSDSGTIRAHDQMMAHLQIHLTDINDNPPKF 149          

HSP 3 Score: 84.7297 bits (208), Expect = 1.054e-12
Identity = 88/328 (26.83%), Postives = 152/328 (46.34%), Query Frame = 2
Query:  929 YRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGS--CKIEIHSTDINDNSPRIEI------LKNVSIPENKRIATPIMSIYVHDDDSVHN-----KVKCNKNSNDNFRL-------------HSSQENSLTIYMERTFDYENSSIHQID--IECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQ-HIYQISEDSKVN-EFLFQCSATDLDSGNFGKITYRLDDAGNKE----FVINISTGYIYLYNSLDREVKEMLEF--FVYATDGGGLEASVKVSITVM--DINDNPPRLKSPKILTVLEN 1798
            ++  T+  Q+  D+ ++N + G +   Q     I +   + F +E  D G+ +        ++IH TDINDN P+  +      L  + I E  + A  ++   + D DSV N     +++ N  S D F+L             H  + +  T+   R  DYEN +  Q +  +   D G P      S+ + ++D NDN P F +      +++E++  + + +++ +A+D DSG  G ITY L    + +    F I+   G ++L   LD EV     F   V A+D G  + S   ++T++  DINDN P L   + +TV+E 
Sbjct:   76 FKNGTIIAQKHVDRDNVNDICGPLDCCQSPVCTIQAK--VMFIVEQSDSGTIRAHDQMMAHLQIHLTDINDNPPKFPLNSLGFPLFTIRIQEGAKFAREMLPSAI-DLDSVGNGVVQYRIEANSPSADLFQLTYEKVLINSLNESHGWRLSPPTLLQLRELDYENPADRQFELVVLAIDGGEPSHTGSLSVTVILMDVNDNTPQFEKTTITTIELAENTTYSPDPIYKFAASDADSGENGLITYSLSPLNDPKVFENFSIDRRLGALHLNTLLDYEVYSERSFSVIVVASDNGTPKRSGTTTLTIVTKDINDNLPSLVVQENITVIEG 400          
BLAST of Protocadherin-1 isoform 2 vs. TrEMBL
Match: A0A0R3WAJ9 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7587 PE=4 SV=2)

HSP 1 Score: 303.138 bits (775), Expect = 8.035e-94
Identity = 214/671 (31.89%), Postives = 336/671 (50.07%), Query Frame = 2
Query:  542 TKNYRMSLPTAYDLDSSINGVYNYSLSENHKK--FFQLSIEK----------GY----PELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI--DRNDNKPIFTDI-LYRKTVKENTTYTI-PILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSV-HNKVKCNKNSN-------DNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSG--------IPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE------FVINISTGYIYLYNS--LDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE---NEVQE--NAL------------FYSYLKLDN-----NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKD 2356
             K  R  LP+A DLDS+ NGV  Y +  N      FQL+ EK          G+    P L+ L  L++EN  +R+F L + A D G    T SL +T +  D NDN P+F    +    + ENTTY+  P+ +  A D+D  +NG I+Y    L    + +KF+++  +G + L   LDYE+YS++     + A D G+P+ SG+  + + + D+NDN P + + +N+++ E      P++  YV DDD V   KV C    N        + RL     N+  ++ E  FDYE +    ++I C D+         I P+       +AI D ND++P F   + + ++ E S   + + Q +A+D D+G   ++TY L  +          F I+ +TG + + NS  LDREV E +E +V A DGGGL  S K+ I +MDINDN P ++ P  L+V EN P G ++G V   D D G NA + +E   N  Q+  NA             F+S  K+         +  K  +DRE +    ++    D G P+  +++++ + ++D NDN P+L +P     +     +Y N+ + S +  L + D D  ENG + + +  D NGSRYFQ+++T+G + + W  R       P  G+Y V I L D
Sbjct:  158 AKFAREMLPSAVDLDSAGNGVVQYRIEANSPSTDLFQLTYEKVLINPPSESHGWRLSPPTLIQLRELDYENPADREFELVVIAIDGGEPALTGSLSVTVVLMDINDNAPVFERTNISSIELAENTTYSPDPVYKFLATDMDSADNGLITYSLSPLNEPMVFEKFAIDGRSGALYLNSILDYEVYSERRFTVIVVASDNGTPKRSGTTTLTVVTKDVNDNLPSLVVQENITVIEGLNYTKPVVRFYVKDDDYVSRGKVICRPAPNRAKGVGSASLRLQEVTTNAYFVFTEGIFDYEEARSASVEIICSDTADSFNTRERILPIT------VAIGDANDHYPEFGVTEFLAKLPEHSPKGKRVVQVTASDADAGIHARLTYSLVSSNGGRCSIQEIFNIDSATGVVTVKNSECLDREVNEEIEAYVAAEDGGGLSTSAKLRIRLMDINDNSPSIQVPDSLSVTENLPAGVVVGRVRCTDADIGSNAEIRLELSANNTQQVRNAFDTISESGSARNSFFSRGKVRGMNDITGLLVTKKPLDREDIESYTIQFVATDSGTPQRITYKSVQVLVLDENDNVPVLRFPQLDTTVGYHPQVYTNSPYGSKVCVLRSYDPDKGENGTVIYALQHDTNGSRYFQLDQTTGELTTAWHHRG------PAPGVYAVKILLYD 816          

HSP 2 Score: 73.559 bits (179), Expect = 8.035e-94
Identity = 43/124 (34.68%), Postives = 63/124 (50.81%), Query Frame = 3
Query:  156 SINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAI-LNYQSTKPAVN------FQINFEIIDENDNPPKF 506
            S   ++ D +     VGNI   L  +       I+V +S F +F+E+F + K+G II  KF+DRDN  +ICGPL CC   IC   A  + +  QS  P ++        +   + D NDN P+F
Sbjct:   17 SATFQMVDEIKPGQTVGNICHALWPKSSIAFSLIVVTSSRFQRFNEYFSITKNGSIIAQKFVDRDNINDICGPLDCCQSAICIIHARVMFIVEQSENPVMHSHDQVLAHLQIHLTDINDNSPRF 140          

HSP 3 Score: 86.2705 bits (212), Expect = 3.063e-13
Identity = 77/266 (28.95%), Postives = 129/266 (48.50%), Query Frame = 2
Query: 1106 IEIHSTDINDNSPRIEILKN------VSIPENKRIATPIMSIYVHDDDS----VHNKVKCNKNSNDNFRL-------------HSSQENSLTIYMERTFDYENSSIHQID--IECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQ-HIYQISEDSKVN-EFLFQCSATDLDSGNFGKITYRLDDAGN----KEFVINISTGYIYLYNSLDREVKEMLEF--FVYATDGGGLEASVKVSITVM--DINDNPPRLKSPKILTVLEN 1798
            ++IH TDINDNSPR  +         + I E  + A  ++   V  D +    V  +++ N  S D F+L             H  + +  T+   R  DYEN +  + +  +   D G P +    S+ + ++D NDN P+F R      +++E++  + + +++  ATD+DS + G ITY L         ++F I+  +G +YL + LD EV     F   V A+D G  + S   ++TV+  D+NDN P L   + +TV+E 
Sbjct:  126 LQIHLTDINDNSPRFPLNSQGYPHFTIRIQEGAKFAREMLPSAVDLDSAGNGVVQYRIEANSPSTDLFQLTYEKVLINPPSESHGWRLSPPTLIQLRELDYENPADREFELVVIAIDGGEPALTGSLSVTVVLMDINDNAPVFERTNISSIELAENTTYSPDPVYKFLATDMDSADNGLITYSLSPLNEPMVFEKFAIDGRSGALYLNSILDYEVYSERRFTVIVVASDNGTPKRSGTTTLTVVTKDVNDNLPSLVVQENITVIEG 391          
BLAST of Protocadherin-1 isoform 2 vs. TrEMBL
Match: A0A0R3S965 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS759 PE=4 SV=2)

HSP 1 Score: 289.271 bits (739), Expect = 4.776e-90
Identity = 218/669 (32.59%), Postives = 327/669 (48.88%), Query Frame = 2
Query:  542 TKNYRMSLPTAYDLDSSINGVYNYSLSENHKK--FFQLSIEK----------GY----PELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI--DRNDNKPIF-TDILYRKTVKENTTYTI-PILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSV-HNKVKCNKNSND-------NFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFI--AIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE------FVINISTGYIYLYNS--LDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE----NEVQENALFYSYLKLDNNK------------------IFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSST 2368
             K  R  LP+A DLDS  NGV  Y +         FQL+ EK          G+    P L+ L  L++E    R+F L + A D G    T SL +T I  D NDN P F    +    + ENTTY+  PI +  A D D G+NG I+Y    L   ++ DKFS+++  G + L   LDYE+YS++     + A D G+P+ SG+  + I + DINDN P + + +N+++ E      P++  YV DDDSV   KV C             + RL     N+  ++ E  FDYE +    ++I C D      A  ++L I  AI D ND++P F   + + ++ E S     + Q +ATD D+G   ++TY L  +G           I+  TG + + NS  LDREV + +  FV A DGGGL  SVK+ I +MDINDN P ++  + L V EN P G ++G +   D+D G NA + +E    N +   + F    + DN +                  +  K  +DRE +    + L   D G P   + +TI + I+D NDN P+L +P     +     +Y N+ F S +  L + D D  ENG + + +  D NGS+YFQ+ +++G + + W  +       P +G+Y V + L D   T
Sbjct:  167 AKFAREMLPSAIDLDSGGNGVVQYRIESKAPSADLFQLTYEKVLVNSLNESHGWRLSPPTLIQLRELDYEKPANRQFDLVVLAIDGGEPSLTGSLSVTVILMDINDNTPQFEKTTITTIELAENTTYSPDPIYKFVAADSDSGDNGLITYSLSPLNDPKVFDKFSIDRRLGTLHLNSLLDYEVYSERSFSVIVVASDNGTPKRSGTTTLTIVTKDINDNLPSLVVQENITVIEGLNYTKPVVRFYVKDDDSVSRGKVFCRPAPTGPKQVGIPSLRLQEVTTNAYFVFTEGIFDYEETQYVTVEIICTDRADSSNAPDRTLQITVAIGDSNDHYPEFGVTEFLAKLPEHSSEGTRVTQIAATDADAGIHARLTYSLVSSGTGRCSIPEILQIDSVTGVVSVKNSECLDREVSDEIVAFVVAKDGGGLSTSVKLRIRLMDINDNDPIIQISESLGVSENLPPGVVVGRIRCTDVDSGSNAEIRLELSENNTLPVRSAFGIIPEGDNLRDPFASRGIVRGMSDIIGLLVTKRTLDREDIETYNINLVARDLGAPPRVTHKTIQVIILDENDNSPVLRFPQPNTTVGYHPQVYTNSPFGSKVCVLRSHDPDRGENGTVIYSLQHDTNGSQYFQLEQSTGKLTTGWYNKG------PSSGVYAVRVLLYDMGRT 829          

HSP 2 Score: 74.7146 bits (182), Expect = 4.776e-90
Identity = 41/120 (34.17%), Postives = 62/120 (51.67%), Query Frame = 3
Query:  168 KLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPA-------VNFQINFEIIDENDNPPKF 506
            +L D V     +GNI   L  +       I+V  S F +F+E+F + K+G II+ K +DRDN  +ICGPL CC   +C  QA  +   + ++ +       +   +   + D NDNPPKF
Sbjct:   30 QLVDEVKAGETLGNICSALWPKSSLVFSLIVVTYSRFQRFNEYFSIVKNGSIISQKHVDRDNVNDICGPLDCCQSPVCTIQAKVMFIVEQSESSTIRAHDQMMAHLQIHLTDINDNPPKF 149          

HSP 3 Score: 71.2478 bits (173), Expect = 1.247e-8
Identity = 72/266 (27.07%), Postives = 122/266 (45.86%), Query Frame = 2
Query: 1106 IEIHSTDINDNSPRIEILKN------VSIPENKRIATPIMSIYVHDDDS----VHNKVKCNKNSNDNFRL-------------HSSQENSLTIYMERTFDYENSSIHQID--IECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQ-HIYQISEDSKVN-EFLFQCSATDLDSGNFGKITYRLDDAGNK----EFVINISTGYIYLYNSLDREVKEMLEF--FVYATDGGGLEASVKVSITVM--DINDNPPRLKSPKILTVLEN 1798
            ++IH TDINDN P+  +         + I E  + A  ++   +  D      V  +++    S D F+L             H  + +  T+   R  DYE  +  Q D  +   D G P +    S+ + ++D NDN P F +      +++E++  + + +++  A D DSG+ G ITY L    +     +F I+   G ++L + LD EV     F   V A+D G  + S   ++T++  DINDN P L   + +TV+E 
Sbjct:  135 LQIHLTDINDNPPKFPLNSQGFPHFTIRIQEGAKFAREMLPSAIDLDSGGNGVVQYRIESKAPSADLFQLTYEKVLVNSLNESHGWRLSPPTLIQLRELDYEKPANRQFDLVVLAIDGGEPSLTGSLSVTVILMDINDNTPQFEKTTITTIELAENTTYSPDPIYKFVAADSDSGDNGLITYSLSPLNDPKVFDKFSIDRRLGTLHLNSLLDYEVYSERSFSVIVVASDNGTPKRSGTTTLTIVTKDINDNLPSLVVQENITVIEG 400          
BLAST of Protocadherin-1 isoform 2 vs. TrEMBL
Match: A0A564Y672 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2696 PE=4 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 5.232e-90
Identity = 218/668 (32.63%), Postives = 327/668 (48.95%), Query Frame = 2
Query:  545 KNYRMSLPTAYDLDSSINGVYNYSLSENHKK--FFQLSIEK----------GY----PELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI--DRNDNKPIF-TDILYRKTVKENTTYTI-PILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSV-HNKVKCNKNSND-------NFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFI--AIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE------FVINISTGYIYLYNS--LDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE----NEVQENALFYSYLKLDNNK------------------IFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSST 2368
            K  R  LP+A DLDS  NGV  Y +         FQL+ EK          G+    P L+ L  L++E    R+F L + A D G    T SL +T I  D NDN P F    +    + ENTTY+  PI +  A D D G+NG I+Y    L   ++ DKFS+++  G + L   LDYE+YS++     + A D G+P+ SG+  + I + DINDN P + + +N+++ E      P++  YV DDDSV   KV C             + RL     N+  ++ E  FDYE +    ++I C D      A  ++L I  AI D ND++P F   + + ++ E S     + Q +ATD D+G   ++TY L  +G           I+  TG + + NS  LDREV + +  FV A DGGGL  SVK+ I +MDINDN P ++  + L V EN P G ++G +   D+D G NA + +E    N +   + F    + DN +                  +  K  +DRE +    + L   D G P   + +TI + I+D NDN P+L +P     +     +Y N+ F S +  L + D D  ENG + + +  D NGS+YFQ+ +++G + + W  +       P +G+Y V + L D   T
Sbjct:  212 KFAREMLPSAIDLDSGGNGVVQYRIESKAPSADLFQLTYEKVLVNSLNESHGWRLSPPTLIQLRELDYEKPANRQFDLVVLAIDGGEPSLTGSLSVTVILMDINDNTPQFEKTTITTIELAENTTYSPDPIYKFVAADSDSGDNGLITYSLSPLNDPKVFDKFSIDRRLGTLHLNSLLDYEVYSERSFSVIVVASDNGTPKRSGTTTLTIVTKDINDNLPSLVVQENITVIEGLNYTKPVVRFYVKDDDSVSRGKVFCRPAPTGPKQVGIPSLRLQEVTTNAYFVFTEGIFDYEETQYVTVEIICTDRADSSNAPDRTLQITVAIGDSNDHYPEFGVTEFLAKLPEHSSEGTRVTQIAATDADAGIHARLTYSLVSSGTGRCSIPEILQIDSVTGVVSVKNSECLDREVSDEIVAFVVAKDGGGLSTSVKLRIRLMDINDNDPIIQISESLGVSENLPPGVVVGRIRCTDVDSGSNAEIRLELSENNTLPVRSAFGIIPEGDNLRDPFASRGIVRGMSDIIGLLVTKRTLDREDIETYNINLVARDLGAPPRVTHKTIQVIILDENDNSPVLRFPQPNTTVGYHPQVYTNSPFGSKVCVLRSHDPDRGENGTVIYSLQHDTNGSQYFQLEQSTGKLTTGWYNKG------PSSGVYAVRVLLYDMGRT 873          

HSP 2 Score: 74.7146 bits (182), Expect = 5.232e-90
Identity = 41/120 (34.17%), Postives = 62/120 (51.67%), Query Frame = 3
Query:  168 KLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPA-------VNFQINFEIIDENDNPPKF 506
            +L D V     +GNI   L  +       I+V  S F +F+E+F + K+G II+ K +DRDN  +ICGPL CC   +C  QA  +   + ++ +       +   +   + D NDNPPKF
Sbjct:   74 QLVDEVKAGETLGNICSALWPKSSLVFSLIVVTYSRFQRFNEYFSIVKNGSIISQKHVDRDNVNDICGPLDCCQSPVCTIQAKVMFIVEQSESSTIRAHDQMMAHLQIHLTDINDNPPKF 193          

HSP 3 Score: 71.633 bits (174), Expect = 1.174e-8
Identity = 72/266 (27.07%), Postives = 122/266 (45.86%), Query Frame = 2
Query: 1106 IEIHSTDINDNSPRIEILKN------VSIPENKRIATPIMSIYVHDDDS----VHNKVKCNKNSNDNFRL-------------HSSQENSLTIYMERTFDYENSSIHQID--IECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQ-HIYQISEDSKVN-EFLFQCSATDLDSGNFGKITYRLDDAGNK----EFVINISTGYIYLYNSLDREVKEMLEF--FVYATDGGGLEASVKVSITVM--DINDNPPRLKSPKILTVLEN 1798
            ++IH TDINDN P+  +         + I E  + A  ++   +  D      V  +++    S D F+L             H  + +  T+   R  DYE  +  Q D  +   D G P +    S+ + ++D NDN P F +      +++E++  + + +++  A D DSG+ G ITY L    +     +F I+   G ++L + LD EV     F   V A+D G  + S   ++T++  DINDN P L   + +TV+E 
Sbjct:  179 LQIHLTDINDNPPKFPLNSQGFPHFTIRIQEGAKFAREMLPSAIDLDSGGNGVVQYRIESKAPSADLFQLTYEKVLVNSLNESHGWRLSPPTLIQLRELDYEKPANRQFDLVVLAIDGGEPSLTGSLSVTVILMDINDNTPQFEKTTITTIELAENTTYSPDPIYKFVAADSDSGDNGLITYSLSPLNDPKVFDKFSIDRRLGTLHLNSLLDYEVYSERSFSVIVVASDNGTPKRSGTTTLTIVTKDINDNLPSLVVQENITVIEG 444          
BLAST of Protocadherin-1 isoform 2 vs. TrEMBL
Match: A0A5K3F286 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.541e-89
Identity = 219/674 (32.49%), Postives = 331/674 (49.11%), Query Frame = 2
Query:  545 KNYRMSLPTAYDLDSSINGVYNYSLSE----NHK--KFFQLSIEK----------GY----PELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITT--IDRNDNKPIFTDI-LYRKTVKENTTYTI-PILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSV-HNKVKCNKNSN-----------DNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKS----LFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL--DDAGN----KEFVINISTGYIYLYNS--LDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE------NEVQENALFYSYLKLDNNKI----------------FIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKD 2356
            K  R +LP+A DLDS+ NG+  Y LS     NH   + F+LS EK          G+    P L+ L  L+FE   +R+F L + A D G    T SL +T   +D NDN PIF    +    + ENTT++  PI +  A DLD GENG ISY    L    + DKFS++   G + L+  LDYE+YS++       A D G+P+ SG+  + + + DINDN P + + +N+++ E      P++  YV DDD V   KV C  + +            + RL     N+  ++ E  FDYE +    ++I C D  +    T       + +AI D ND++P F  ++ + ++ E S     + + +ATD DSG   ++TY L  D+ G     +   I+  TG + + N   LDRE  E +E FV A DGGGL  SVK+ I +MD+NDN PR +     +V EN P G +IG+V   D D G N+ + +E        V+E+        L  N +                  K  +DRE+V    ++L   D G P L + +TI + ++D NDN PI  +P     +    L++ N+ + S +  L + D D  ENG + + I    NGSR F ++  +GA+ + W  +       P  G+Y + + L D
Sbjct:  187 KFARETLPSAVDLDSAENGIVQYRLSSDKNPNHSTDELFRLSYEKVLSDPLNKSQGWRLSPPMLIQLRELDFEVPTDRQFKLIVIAIDGGNPALTGSLSVTVNLMDINDNSPIFEKTNVSTIELAENTTFSPNPIHKFIATDLDSGENGLISYSLSPLNEPRVFDKFSIDNSNGALYLISALDYEVYSERHFTVIAVASDNGTPKRSGTTTLTVVTRDINDNLPTLVVQENITVIEGINYTKPVVRFYVKDDDFVSRGKVTCRPSPSRATEAGIAAGAASLRLQEVTANAYFVFTEGIFDYEETKSASVEIVCSDRALGEPLTSPDRPIRITVAIGDANDHYPEFGVSEFLTKLPEHSPEGTRIARLTATDADSGLNSRVTYSLVNDNGGRCSTLEALSIDRQTGVVSVKNGNCLDREANEEVEAFVAAEDGGGLSTSVKLKIRLMDVNDNEPRFQVTDSFSVPENRPGGFVIGSVRCTDADVGVNSGILLELSENNTQSVKESFDLLLSEGLSPNVVPGRGKVSGRGEVSAVLVTKKRLDREEVETYTIQLVATDMGEPPLRAHKTIHLVVLDENDNQPIPRFPQPFTTVGYHPLVHTNSPYGSKVCVLRSHDPDRGENGTVVYDIQPGTNGSRDFHLDRVTGALTTMWHQKG------PTPGVYAIKVLLYD 854          

HSP 2 Score: 73.559 bits (179), Expect = 1.541e-89
Identity = 40/143 (27.97%), Postives = 76/143 (53.15%), Query Frame = 3
Query:  159 INMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTST-FTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAIL-------NYQSTKPAVNFQINFEIIDENDNPPKF-----NQFKFNINVLEEQK 548
            ++ ++ D V     +GNI ++L +Q  +  + ++V TS+ F +F+E+F + K+G +I  K +DRDN +++CGPL CC   +C   A  +        +  S+   +   +   ++D NDN P+F      + +F + + E  K
Sbjct:   46 VSFEIIDEVKPGHTIGNIRQVL-WQKSSTVFSLVVVTSSNFQRFNEYFSITKNGTVIVQKLVDRDNLDDVCGPLDCCQSAVCTIDARVMFIVDQNEDSSVSSNDQLPAHLQLRLVDVNDNSPQFPLNSNGRPEFTVRIQEGGK 187          

HSP 3 Score: 72.0182 bits (175), Expect = 7.077e-9
Identity = 94/334 (28.14%), Postives = 153/334 (45.81%), Query Frame = 2
Query:  941 TLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGS----PQLSGSCKIEIHSTDINDNSPRIEILKN------VSIPENKRIATPIMSIYVHDDDSVHN-----KVKCNKNSNDN----FR----------LHSSQENSLTIYM---ERTFDYENSSIHQID--IECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQ-HIYQISEDS-----KVNEFLFQCSATDLDSGNFGKITYRLDDAGNK----EFVINISTGYIYLYNSLDREVKEMLEFFV--YATDGGGLEASVKVSITVM--DINDNPPRLKSPKILTVLEN 1798
            T+  Q++ D+ +L+ + G +   Q     I  D  + F ++  ++ S     QL    ++ +   D+NDNSP+  +  N      V I E  + A   +   V D DS  N     ++  +KN N +    FR          L+ SQ   L+  M    R  D+E  +  Q    +   D G P +    S+ + ++D NDN PIF +      +++E++      +++F+    ATDLDSG  G I+Y L          +F I+ S G +YL ++LD EV     F V   A+D G  + S   ++TV+  DINDN P L   + +TV+E 
Sbjct:   99 TVIVQKLVDRDNLDDVCGPLDCCQSAVCTI--DARVMFIVDQNEDSSVSSNDQLPAHLQLRL--VDVNDNSPQFPLNSNGRPEFTVRIQEGGKFARETLPSAV-DLDSAENGIVQYRLSSDKNPNHSTDELFRLSYEKVLSDPLNKSQGWRLSPPMLIQLRELDFEVPTDRQFKLIVIAIDGGNPALTGSLSVTVNLMDINDNSPIFEKTNVSTIELAENTTFSPNPIHKFI----ATDLDSGENGLISYSLSPLNEPRVFDKFSIDNSNGALYLISALDYEVYSERHFTVIAVASDNGTPKRSGTTTLTVVTRDINDNLPTLVVQENITVIEG 423          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Cavefish
Match: ENSAMXT00000034478.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10757013:10760663:1 gene:ENSAMXG00000031253.1 transcript:ENSAMXT00000034478.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 214.157 bits (544), Expect = 1.392e-59
Identity = 164/515 (31.84%), Postives = 254/515 (49.32%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFF----QLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDS-VHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL-DDAGNKEFV-----INISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKILTV---LENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R SLP A+D+D   + V NY LS N  ++F    Q+S E    EL++  A++ E   +    L LTA D G   +  T+ + +  +D NDN P+F+  LY+  V+EN      IL V A DLDEG NG++ Y         + + FS+N  +G+I +   +DYE   +  IE  I+A D+      G+CK+ I   D+NDN+P + + L   S+ E+ +  T    + V D DS    KV C   +   F+L SS +NS ++ +    D E  S + + I   D GIPP+++   L + + D NDN P+F        + E+S     L   +A D+D G  G+++Y L +  G    V     +N  TG +Y   S D E  + ++F V ATD G   L ++V V++ ++D NDN P + SP   T     EN P     G  +G +   D D G NA ++    E + N LF   +   + +I  K  +    +    L + + DHG P L++
Sbjct:  149 RFSLPLAHDMDVGTHAVKNYKLSAN--EYFSIDVQISGESASAELVLQKAIDREK--QALVKLTLTATDGGKPPRSGTLEILVNVLDINDNYPVFSQPLYKVKVQENAAVGTKILTVSATDLDEGINGEVVYAIVGHERSSVVNLFSINPHSGDITVKGNIDYE--ENAAIELRIQAHDKSHSPRHGNCKVLIEVLDVNDNAPEVSVTLLMSSVSEDTKPGTGFALVTVSDQDSGTSGKVDCRVTALP-FKLQSSYKNSYSLIVNEPLDRECVSQYNVTIVANDEGIPPLSSTMVLHVLVSDVNDNVPLFPALVISINVQENSPAGVLLSTITAQDVDDGENGQVSYSLINGEGTGTLVSTLMNLNSLTGELYCLQSFDYEDTKQIQFKVQATDSGTPPLSSNVTVNVFILDENDNRPVILSPYSETGSVNTENIPYSADAGYFVGKIRAIDADSGYNALLSYHITEPKGNNLF--CIGSSSGEIRTKRRMSDNDLKTHPLVITVCDHGEPSLSA 654          

HSP 2 Score: 37.7354 bits (86), Expect = 1.392e-59
Identity = 35/131 (26.72%), Postives = 60/131 (45.80%), Query Frame = 3
Query:  159 INMKLNDNVPKSTNVGNIFKMLN---YQLFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            I+  +++ V K   VGN+ K LN    +L +  + ++ G++       +F +  K+G +      DR +REE+C     CS +I     N         P   ++I   I+D NDN P F+     +N+ E
Sbjct:   29 ISYSISEEVKKGAVVGNLAKDLNIDVQELQSRMFQVVAGSN-----KRYFDVNLKTGVLFVN---DRFDREELCERKQKCSLNIEAMAQN---------PLTLYRIEVNILDINDNSPVFSLQTLLLNISE 142          

HSP 3 Score: 135.576 bits (340), Expect = 5.433e-32
Identity = 147/571 (25.74%), Postives = 266/571 (46.58%), Query Frame = 2
Query:  617 LSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETM-SLFITTIDRNDNKPIFTDILYRKTVKENT----TYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHD-DDSVHNKVK---CNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNS-LDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARV--TIENEVQENALFYSYLKLDN--NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYP-SEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            ++ ++K++F ++++ G   L +    + E + ERK    L          T+  + +  +D NDN P+F+       + EN      +++P+    A D+D G +   +Y+        I+ + S    + E+ L + +D E     L++ T+ A D G P  SG+ +I ++  DINDN P   + L  V + EN  + T I+++   D D+ ++ +V         +    L S   +S  I ++   DYE ++  ++ I+  D    P      + I ++D NDN P  +    +  +SED+K        + +D DSG  GK+  R+  A   +   +    Y  + N  LDRE        + A D G   L +++ + + V D+NDN P   +  I + V EN P G L+  +   D+DDGEN +V  ++ N      L  + + L++   +++     D E   QI  +++  D G P L+S  T+ + I+D NDN P++  P SE   +N+ ++ Y +     F+  + A D+D   N  + + I +   G+  F +  +SG I
Sbjct:   65 VAGSNKRYFDVNLKTGV--LFVNDRFDREELCERKQKCSLNIEAMAQNPLTLYRIEVNILDINDNSPVFSLQTLLLNISENVLPGDRFSLPL----AHDMDVGTHAVKNYKLSANEYFSIDVQISGESASAELVLQKAIDRE--KQALVKLTLTATDGGKPPRSGTLEILVNVLDINDNYPVFSQPLYKVKVQENAAVGTKILTVSATDLDEGINGEVVYAIVGHERSSVVNLFSINPHSGDITVKGNIDYEENAAIELRIQAHDKSHSPRHGNCKVLIEVLDVNDNAPEVSVTLLMSSVSEDTKPGTGFALVTVSDQDSGTSGKVDCRV-TALPFKLQSSYKNSYSLIVNEPLDRECVSQYNVTIVANDEGIPPLSSTMVLHVLVSDVNDNVPLFPALVISINVQENSPAGVLLSTITAQDVDDGENGQVSYSLINGEGTGTLVSTLMNLNSLTGELYCLQSFDYEDTKQIQFKVQATDSGTPPLSSNVTVNVFILDENDNRPVILSPYSETGSVNTENIPY-SADAGYFVGKIRAIDADSGYNALLSYHITEP-KGNNLFCIGSSSGEI 624          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Cavefish
Match: pcdh17 (protocadherin 17 [Source:NCBI gene;Acc:103025306])

HSP 1 Score: 223.787 bits (569), Expect = 1.707e-59
Identity = 162/518 (31.27%), Postives = 261/518 (50.39%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIE-KG----YPELLILSALNFENVNERKFH-LQLTAFDRGGQFE---TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEIL--KNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINI------STGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI------LTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R  L  AYD D+  NG+  Y ++ +    F L ++ +G    +PEL++  +L+ E   ER  H L +TA D GG++    TM + +   D NDN P+F    Y   + EN+     ++ + A D DEG NG+++Y F    P  I + F+++  TG IK+  K+DYE   + +IE  ++A D+G   + G CK+ +   D NDN P I  +  +  ++ E     T I  + V D DS  N +++C    N  FRL  + +N  T+  +R  D E    + I I   D+G PP+ + KS  + I+DENDN P FT+  ++ Q+ E++   E+L    A D D G  G ++Y L  +   E  I        + G IY   S + E  +  +F V A D G   LE++  V ++V+D+NDN P +  P +      + V  N  +G +I  V   D D GE+ R+T E ++  E+ LF   +     ++     +  E    + L +K+ DHG+P L++
Sbjct:  153 RFPLAAAYDPDTRENGLKTYQITRDDYSIFSLDVKSRGDGTKFPELVVQRSLDRE---ERSHHTLIITATD-GGEYPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENSPPGTVLIDLNATDPDEGSNGQVTYAFSCYVPDRIKELFTIDPRTGVIKIQGKIDYE--ENPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFVAVRQGAVSEAAAPGTVIALVRVTDKDSGRNGQLQCRILGNVPFRLEENSDNFYTVVTDRPLDREVKDEYNITIVAKDNGNPPLNSTKSFTVKILDENDNAPRFTKMVYLLQVPENNIPGEYLGSVLAHDPDLGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRSFNYEQTKYFDFKVQAKDSGNPHLESNTTVRVSVLDVNDNIPVIVLPLLQNDTAEIHVPRNVGVGHIITTVRAVDNDFGESGRLTYEISDGNEDHLF--EIDAVTGEVRTAQPLWEEVSPVVELIIKVTDHGKPTLSA 662          

HSP 2 Score: 119.398 bits (298), Expect = 8.096e-27
Identity = 148/552 (26.81%), Postives = 243/552 (44.02%), Query Frame = 2
Query:  692 LNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFD----TLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNV-SIPENKRIATPIMSIYVHDDDSVHNKVKCNKNS---NDNFR-LHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFP-IFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLY---NSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE----NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYST 2281
            ++ E + +R    QL+        E   + +   D NDN P F        + EN           A D D  ENG  +Y+      ++   ++  +    K   E+ + + LD E  S   +   I A D G    SG+ +I +  TD NDNSP  E    V  IPEN    T ++ +   D D   N       S    D  + L +    +  I ++   DYE + I +ID++  D G  P+  +  + + ++D NDN+P I   A     +SE +     +     TD DSG  G++  R+   GN  F +  ++   Y       LDREVK+     + A D G   L ++   ++ ++D NDN PR  K   +L V EN   G  +G+V   D D G+N  V+      N  +E+   Y  +K  +  I+     + E+      +++  D G P L S  T+ +S++D+NDN P++  P    + N  + I+V  N      I T+ A D+DF E+G++ + I D  N    F+++  +G + + 
Sbjct:   93 IDREALCKRNPRCQLSMEVFANDKEICMIKVEIQDINDNPPSFPSEQIDIDISENAAPGTRFPLAAAYDPDTRENGLKTYQITRDDYSIFSLDVKSRGDGTKFP-ELVVQRSLDREERSHHTL--IITATDGGEYPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENSPPGTVLIDLNATDPDEGSNGQVTYAFSCYVPDRIKELFTIDPRTGVIKIQGKIDYEENPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFVAVRQGAVSEAAAPGTVIALVRVTDKDSGRNGQLQCRI--LGNVPFRLEENSDNFYTVVTDRPLDREVKDEYNITIVAKDNGNPPLNSTKSFTVKILDENDNAPRFTKMVYLLQVPENNIPGEYLGSVLAHDPDLGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRSFNYEQTKYFDFKVQAKDSGNPHLESNTTVRVSVLDVNDNIPVIVLPL---LQNDTAEIHVPRNVGVGHIITTVRAVDNDFGESGRLTYEISDG-NEDHLFEIDAVTGEVRTA 635          

HSP 3 Score: 112.464 bits (280), Expect = 1.320e-24
Identity = 140/523 (26.77%), Postives = 230/523 (43.98%), Query Frame = 2
Query:  851 ENTTYTIPILQVQ------AKD--LDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGS----------CKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLT-------IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYR----LDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLK--SPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV-----NTQFNSFILTLLARDSDFDENGKIRFRIM----DDCNGSRYFQVNETSGAIYSTWS 2287
            +N  Y+IP  ++Q      AKD  L+ GE GK S  F  L     N    L  +  E  LL       Y+ Q I+   EA+ + +P+   S          C I++   DINDN P     + ++ I EN    T       +D D+  N +K  + + D++ + S    S         + ++R+ D E  S H + I   D G  P +    + + + D NDN P+F +  ++ +I E+S     L   +ATD D G+ G++TY     + D   + F I+  TG I +   +D E   ++E  V A D G   +    KV++ V+D NDN P +   + +   V E    GT+I  V V D D G N +  ++  +  N  F      DN   +     +DRE   +  + +   D+G P L S ++ T+ I+D NDN P               ++Y+     N     ++ ++LA D D  +NG + + ++     + + + Y  +  T GAIY+  S
Sbjct:   32 KNLNYSIPEEKIQGVIGNIAKDAGLELGEQGKKS-NFRVLE----NSAPHLIDVDPESGLL-------YTKQRIDR--EALCKRNPRCQLSMEVFANDKEICMIKVEIQDINDNPPSFPSEQIDIDISENAAPGTRFPLAAAYDPDTRENGLKTYQITRDDYSIFSLDVKSRGDGTKFPELVVQRSLDREERSHHTLIITATDGGEYPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENSPPGTVLIDLNATDPDEGSNGQVTYAFSCYVPDRIKELFTIDPRTGVIKIQGKIDYEENPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFVAVRQGAVSEAAAPGTVIALVRVTDKDSGRNGQ--LQCRILGNVPFRLEENSDNFYTVVTDRPLDREVKDEYNITIVAKDNGNPPLNSTKSFTVKILDENDNAPRF-----------TKMVYLLQVPENNIPGEYLGSVLAHDPDLGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRS 527          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Cavefish
Match: ENSAMXT00000016496.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:9140848:9149128:1 gene:ENSAMXG00000031669.1 transcript:ENSAMXT00000016496.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.305 bits (534), Expect = 6.040e-58
Identity = 166/521 (31.86%), Postives = 268/521 (51.44%), Query Frame = 2
Query:  542 TKNYRMSLPTAYDLDSSINGVYNYSLS-ENHKKFFQLSIEKG--YPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD------AGNKEFVINISTGYIYLYNSLDREVKEMLEFFVY--ATDGGG--LEASVKVSITVMDINDNPPRLKSP-------KILTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKI-FIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            T   R SL  A D D  IN +  Y+L+  +H    +LS   G  Y E+++   L+ E   E K  L LTAFD G   +  T+ + +  ID NDN P+F+   YR  + EN   +  ++ V A DLD+G NGK++Y F   T  E  D FS++  TGEIK+   LDYE    +  E  +EA D+G   L+ + K+ +  TD+NDN+P I ++  +  IPE+    T I  + + D DS  N +++C+ + +  FR+ SS  N  ++  ++  D E  S + I I   D G P  +T K+L + I D NDN P++    +   + E++     +F  +A D DSGN  +I+Y L+D      + +    +N  +G I    S D E  ++ EF++   A DGG   L ++V V I + D NDN P++  P           V  +  +G L+  V   D+D G+NA ++ +  +  + ALF   +   N +I  ++ + D++ V Q  L + + D+G+P  ++
Sbjct:  151 TPGARFSLDNARDPDVGINALQRYTLNPADHFNLKELSRSDGTKYVEMVLQIPLDREQQEEHK--LILTAFDGGNPQKSGTVKITVAVIDANDNPPVFSQPTYRVYLAENAQTSAVVVSVSAIDLDKGLNGKVTYSFSQSTATEAIDLFSIDSETGEIKVNGPLDYE--KSKHYELNVEARDKGG--LTDTSKVLVEITDVNDNAPVISVISFSNPIPEDSAPETVIAMLNIKDVDSGKNGQIRCSLDIDLPFRIKSSSSNFYSLVTDQFLDREKCSEYNITIRATDEGSPSFSTNKTLNLKISDVNDNAPLYQHQSYTAYVLENNTPGASIFAVTAADKDSGNNARISYFLEDVPENGVSASIYISVNAESGEILAVRSFDYE--QIKEFYILLKAQDGGNPPLSSNVSVKIVIQDQNDNAPQVLYPVQTGGSLVAEIVPRSAEVGYLVTKVVAVDVDSGQNAWLSYKLQKATDRALF--EVGSQNGEIRTVRQVTDKDSVKQ-KLTVVVEDNGQPSCSA 660          

HSP 2 Score: 35.8094 bits (81), Expect = 6.040e-58
Identity = 43/147 (29.25%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  114 IFCISLADAIAE-EHSINMKLNDNVPKSTNVGNIFKMLNY---QLFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            IF   LA A+ +  +SI  ++N    K + VGNI + L     +L +    I    S      E+  L    G +I  + IDR   EE+C  ++ CS     FQ   IL      P    +I+ EI+D ND+ P F + + +  ++E
Sbjct:   23 IFSFVLAAAVGQVRYSIPEEMN----KGSVVGNIVQDLGLDVKRLKSGRARIFTEDS-----REYIGLNVDKGTLIVRERIDR---EELCAQVTPCS---LHFQI--ILE----NPMELHRIDVEILDVNDHAPNFTRKQIDFEIIE 148          

HSP 3 Score: 70.0922 bits (170), Expect = 1.081e-11
Identity = 64/215 (29.77%), Postives = 98/215 (45.58%), Query Frame = 2
Query: 1394 PMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGN---KEFVINISTGYI--YLYNSLDREVKEMLEFFVYATDGGGLEAS--VKVSITVMDINDNPPRLKSPKILTVL-ENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHG 2008
            PM  ++ + + I+D ND+ P FTR Q  ++I E +         +A D D G      Y L+ A +   KE   +  T Y+   L   LDRE +E  +  + A DGG  + S  VK+++ V+D NDNPP    P     L EN     ++ +V   DLD G N +VT          A+    +  +  +I +   +D EK     L ++  D G
Sbjct:  117 PMELHR-IDVEILDVNDHAPNFTRKQIDFEIIESATPGARFSLDNARDPDVGINALQRYTLNPADHFNLKELSRSDGTKYVEMVLQIPLDREQQEEHKLILTAFDGGNPQKSGTVKITVAVIDANDNPPVFSQPTYRVYLAENAQTSAVVVSVSAIDLDKGLNGKVTYSFSQSTATEAIDLFSIDSETGEIKVNGPLDYEKSKHYELNVEARDKG 330          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Cavefish
Match: ENSAMXT00000050733.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10707461:10713100:1 gene:ENSAMXG00000042154.1 transcript:ENSAMXT00000050733.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 7.199e-57
Identity = 164/516 (31.78%), Postives = 254/516 (49.22%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSI----EKG-YPELLILSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI---LKNVSIPENKRIATPIMSIYVHDDDSVHNK-VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG--NKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDN-----PPRLKSPKILTVLENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            +  L +A D D   N V +Y LS N  +FF L +    E G  PEL++  AL+ E   + +  L LTA D G   +  T S+ ++ +D NDN P F   +Y+  V EN    + IL++ A D DEG NG+I Y F     + ++D+F +N  +GEI +   LDYE  S    E  +EA D+G   L+  CK+ +   D+NDN+P I++   L NVS  E  +  + I  I V D D   N  V C+ ++N  F L S+Q    ++ + +  D E + ++ + I   D GIPP+++   + + + D NDN P F        + E+S     +   SA D+D G   ++TY L      +    IN  TG IY   S + E  +  +F V ATD G   L ++V V++ ++D NDN     PP  ++  + T  EN P     G  +G +   D D G NA ++    E + N LF   +   + +I  K  +    +    L + + DHG P L++
Sbjct:  147 KFPLLSAEDPDVGSNSVASYKLSNN--QFFSLEVNTEAESGPSPELVLQKALDREK--QAEIQLILTAVDGGRPARSGTASIVVSVLDANDNAPTFAKQVYKARVPENAAVGMVILKLNATDPDEGVNGEIIYTFKE-GQKGVSDRFIINSSSGEIAIAGPLDYEDVS--AYELRVEARDKGHSPLASHCKVLVEVLDVNDNAPDIKLTSLLDNVS--EGAKKGSVIAFITVQDKDEGKNGIVHCSISNNSPFILESTQGKYYSLVLGQELDREQNELYNVSITATDEGIPPLSSTTVVTVRVYDVNDNPPRFLEQFVNVYVKENSPAGGLIALVSAQDIDIGENSQVTYSLFAKSYLSSAVSINSMTGEIYSMQSFNYEEIKHFQFQVQATDSGTPPLSSNVTVNVFILDENDNRPVTLPPYSEAGSVST--ENIPYSAEAGYFVGKIRAVDADSGYNALLSYHITEPKGNNLF--RVGSSSGEIRTKRRLSDNDLKTHPLVITVCDHGEPSLSA 649          

HSP 2 Score: 39.2762 bits (90), Expect = 7.199e-57
Identity = 42/154 (27.27%), Postives = 73/154 (47.40%), Query Frame = 3
Query:   84 SEIQMVLFHVIF-CISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEE 542
            +++ ++  +V+F C  L   ++ +  I   +++ V   T VG + K LN +L       +   ST +K H F    K+G +   K IDR   EE+C      + ++C     AI+N     P   + I+ +I+D NDN P F     +I + E+
Sbjct:    5 ADLWIIYLYVLFYC--LRHVVSRQ--IVYSVSEEVSPGTFVGPLAKDLNLKLDELESRALRIVSTSSKKH-FDVNMKTGALFVQKAIDR---EEVC-----PNSNVCTESLEAIVN----NPLNVYSIDVKILDVNDNTPTFRGKYQHIKISEQ 141          

HSP 3 Score: 147.132 bits (370), Expect = 1.378e-35
Identity = 161/597 (26.97%), Postives = 278/597 (46.57%), Query Frame = 2
Query:  566 PTAYDLDSSINGVYNYSL---SENHKKFFQLSIEKGYPELLILSALNFENV--NERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSL-------NKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHD-DDSVHNKV-----KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIY---LYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN--NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYP-SEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            P A DL+  ++ + + +L   S + KK F ++++ G   L +  A++ E V  N       L A          S+ +  +D NDN P F        + E T        + A+D D G N   SY+         N  FSL       +  + E+ L + LD E  ++  I+  + AVD G P  SG+  I +   D NDN+P   + +    +PEN  +   I+ +   D D+ V+ ++     +  K  +D F ++SS   S  I +    DYE+ S +++ +E  D G  P+A++  + + ++D NDN P       +  +SE +K    +   +  D D G  G +   + +  N  F++  + G  Y   L   LDRE  E+    + ATD G   L ++  V++ V D+NDNPPR     + + V EN P G LI  V   D+D GEN++VT    +   +   S + +++   +I+     + E++     +++  D G P L+S  T+ + I+D NDN P+   P SE   +++ ++ Y + +   F+  + A D+D   N  + + I +   G+  F+V  +SG I
Sbjct:   43 PLAKDLNLKLDELESRALRIVSTSSKKHFDVNMKTG--ALFVQKAIDREEVCPNSNVCTESLEAI-VNNPLNVYSIDVKILDVNDNTPTFRGKYQHIKISEQTMPGAKFPLLSAEDPDVGSNSVASYKLSN------NQFFSLEVNTEAESGPSPELVLQKALDREKQAE--IQLILTAVDGGRPARSGTASIVVSVLDANDNAPTFAKQVYKARVPENAAVGMVILKLNATDPDEGVNGEIIYTFKEGQKGVSDRFIINSS---SGEIAIAGPLDYEDVSAYELRVEARDKGHSPLASHCKVLVEVLDVNDNAPDIKLTSLLDNVSEGAKKGSVIAFITVQDKDEGKNGIVHCSISN--NSPFILESTQGKYYSLVLGQELDREQNELYNVSITATDEGIPPLSSTTVVTVRVYDVNDNPPRFLEQFVNVYVKENSPAGGLIALVSAQDIDIGENSQVTY--SLFAKSYLSSAVSINSMTGEIYSMQSFNYEEIKHFQFQVQATDSGTPPLSSNVTVNVFILDENDNRPVTLPPYSEAGSVSTENIPY-SAEAGYFVGKIRAVDADSGYNALLSYHITEP-KGNNLFRVGSSSGEI 619          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Cavefish
Match: ENSAMXT00000038332.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:9168938:9181660:1 gene:ENSAMXG00000037002.1 transcript:ENSAMXT00000038332.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 206.838 bits (525), Expect = 7.758e-57
Identity = 162/515 (31.46%), Postives = 265/515 (51.46%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKG---YPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD------AGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKIL---TVLENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKI-FIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            + SL +A+D D  +N +  Y+LS       +  I  G   Y EL++ S L+ EN  + +  L L A+D G   +  T+ + IT +D NDN PIF+  +Y  +++EN+     +  V A D D+G N  ++Y F   T + +N  FS++  TG+I +  +LD+E    +  + T+EA D+G   L+ SCK+ I  TD+NDN+P I ++  + ++PEN    T I  + V D D   N +VKC+ + N  F++ SS  N  ++   +  D E    + I I   D G P  +T K+L + I D NDN P+F    +   + E++     +F  +A D DSGN  +I+Y L+D      + +    +N  +G I    S D E  +     V A DGG   L ++V V I + D NDN P++  P       V E  P    +G L+  V   D+D G+NA ++ +  +  + ALF   + L N +I  ++ + D++ V Q  L + + D+G+P  ++
Sbjct:  138 KFSLDSAHDPDVGVNALQKYTLSPTDIFSLKEVIANGGLKYIELVLQSPLDREN--QEEIILNLVAYDGGSPQKSGTVKITITVMDANDNAPIFSLPVYHTSMQENSPRGTYVATVTATDRDKGTNALVTYLFSQSTGKNLN-VFSIDSETGDITVNGELDFE--KAKHFQITVEATDKGG--LTDSCKVVIEITDVNDNAPVISLISFSNAVPENSPPETVIAMVNVKDLDFGKNGQVKCSIDPNLPFKIQSSSSNFYSVVTNQVLDRETKLEYNITITATDEGSPSFSTNKTLNLKISDVNDNAPLFQHQSYSAYVLENNTPGVSIFAVTAADKDSGNNARISYFLEDVLLNGVSASTHISVNAESGEILAVRSFDYEQTKEFHIRVKAQDGGNPPLSSNVSVKIVIQDQNDNAPQVLYPVQTGGSVVAEMVPRSAEVGYLVTKVVAVDVDSGQNAWLSYKLQKASDRALF--EVGLQNGEIRTVRQVTDKDAVKQK-LTVVVEDNGQPSRSA 642          

HSP 2 Score: 35.8094 bits (81), Expect = 7.758e-57
Identity = 46/148 (31.08%), Postives = 66/148 (44.59%), Query Frame = 3
Query:  111 VIFCISLADAIAE-EHSINMKLNDNVPKSTNVGNIFKMLNY---QLFNENYHIIVGTSTFTKFHEFFKL-FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            V+F   LA A  +  +SI  ++N    K + VGNI + L     +L +    I    S      E+  L    G ++  + IDR   EE+CG ++ CS     FQ   IL      P    QI+ EIID NDN P F +      ++E
Sbjct:    5 VLFSFVLAFAHGQVRYSIPEEMN----KGSVVGNIVQDLGLDVKRLKSGRARIFTEDS-----REYIGLNVDKGTLVVRERIDR---EELCGQVTPCS---LHFQI--ILE----NPMELHQIDVEIIDINDNSPVFVRKDIGFQIIE 131          

HSP 3 Score: 115.161 bits (287), Expect = 1.141e-25
Identity = 149/579 (25.73%), Postives = 254/579 (43.87%), Query Frame = 2
Query:  617 LSENHKKFFQLSIEKGYPELLILSALNFE----NVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFT--DILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTG-------EIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDSVHNKVKC---NKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNS---LDREVKEMLEFFVYATDGGGLEASVK--VSITVMDINDNPPRLKSPKILT-VLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKL--DNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
             +E+ +++  L+++KG   L++   ++ E     V     H Q+   +     E   + +  ID NDN P+F   DI ++  + E+T          A D D G N    Y   TL+P +I   FSL ++         E+ L   LD E  + + I   + A D GSPQ SG+ KI I   D NDN+P   + + + S+ EN    T + ++   D D   N +     ++++  N  + S    +  I +    D+E +   QI +E  D G   +     + I I D NDN P+ +       + E+S     +   +  DLD G  G++   +D   N  F I  S+   Y   +   LDRE K      + ATD G    S    +++ + D+NDN P  +       VLEN   G  I  V   D D G NAR++  +E+ +       +++ +  ++ +I      D E+  +  +R+K  D G P L+S  ++ I I D NDN P + YP +        ++  + +    +  ++A D D  +N  + ++ +   +    F+V   +G I
Sbjct:   54 FTEDSREYIGLNVDKG--TLVVRERIDREELCGQVTPCSLHFQIILEN---PMELHQIDVEIIDINDNSPVFVRKDIGFQ--IIESTLTGAKFSLDSAHDPDVGVNALQKY---TLSPTDI---FSLKEVIANGGLKYIELVLQSPLDRE--NQEEIILNLVAYDGGSPQKSGTVKITITVMDANDNAPIFSLPVYHTSMQENSPRGTYVATVTATDRDKGTNALVTYLFSQSTGKNLNVFSIDSETGDITVNGELDFEKAKHFQITVEATDKG--GLTDSCKVVIEITDVNDNAPVISLISFSNAVPENSPPETVIAMVNVKDLDFGKNGQVKCSIDP--NLPFKIQSSSSNFYSVVTNQVLDRETKLEYNITITATDEGSPSFSTNKTLNLKISDVNDNAPLFQHQSYSAYVLENNTPGVSIFAVTAADKDSGNNARISYFLEDVLLNGVSASTHISVNAESGEILAVRSFDYEQTKEFHIRVKAQDGGNPPLSSNVSVKIVIQDQNDNAPQVLYPVQTGGSVVAEMVPRSAEVGYLVTKVVAVDVDSGQNAWLSYK-LQKASDRALFEVGLQNGEI 612          

HSP 4 Score: 102.449 bits (254), Expect = 1.057e-21
Identity = 116/417 (27.82%), Postives = 185/417 (44.36%), Query Frame = 2
Query: 1103 KIEIHSTDINDNSPRIEILKNVS--IPENKRIATPIMSIYVHDDDSVHNKV-KCNKNSNDNFRLHSSQENSLTIYME----RTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE---FVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKIL-TVLENEPIGTLIGNVEVFDLDDGENARV------TIENEVQENAL-FYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRF----RIMDDCNGSRYFQVNETSGAIYSTWS 2287
            +I++   DINDNSP + + K++   I E+            HD D   N + K   +  D F L     N    Y+E       D EN     +++  +D G P  +    + I ++D NDN PIF+   +   + E+S    ++   +ATD D G    +TY    +  K    F I+  TG I +   LD E  +  +  V ATD GGL  S KV I + D+NDN P +        V EN P  T+I  V V DLD G+N +V       +  ++Q ++  FYS        +    ++DRE   +  + +   D G P  ++ +T+ + I D+NDN P+ ++ S        + +  N      I  + A D D   N +I +     +++  + S +  VN  SG I +  S
Sbjct:  105 QIDVEIIDINDNSP-VFVRKDIGFQIIESTLTGAKFSLDSAHDPDVGVNALQKYTLSPTDIFSLKEVIANGGLKYIELVLQSPLDRENQEEIILNLVAYDGGSPQKSGTVKITITVMDANDNAPIFSLPVYHTSMQENSPRGTYVATVTATDRDKGTNALVTYLFSQSTGKNLNVFSIDSETGDITVNGELDFEKAKHFQITVEATDKGGLTDSCKVVIEITDVNDNAPVISLISFSNAVPENSPPETVIAMVNVKDLDFGKNGQVKCSIDPNLPFKIQSSSSNFYS--------VVTNQVLDRETKLEYNITITATDEGSPSFSTNKTLNLKISDVNDNAPLFQHQSYS------AYVLENNTPGVSIFAVTAADKDSGNNARISYFLEDVLLNGVSASTHISVNAESGEILAVRS 506          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.422 bits (472), Expect = 1.339e-48
Identity = 191/677 (28.21%), Postives = 295/677 (43.57%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLS----IEK-----------------GYPELLIL-SALNFENVNERKFHLQLTAFDRGGQFETMSLFIT--TIDRNDNKPIFTDILYRKT-VKENTTYTIPILQVQAKDLDEGENGKISYRFDT-LTPQEINDKFSLNKLTGEIKL--LQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK---------NVSIPENKRIATPIMSIYVHDDD-SVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHI------YQIS--EDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE-----FVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLE--ASVKVSITVMDINDNPPRLKSPKILT-------VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLI--DREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFIL---TLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKS 2389
            R+ LP A D D+  N + +Y +S       QL     +E                  G+  LL L   L+ E V    + L L   D G    + S+ +T   +D NDN P+F D   R   + E++     ++Q++A D D G NG I+Y F T LT         ++  TG + +   +KLD E          + A D G    S S  + +   D NDN+P  E++           V I EN    TP++ I V D D      V           L S  +    +   R  DYE +  + + +   D G P ++   +L I+++D NDN P+F     I      Y++S  E+      +    ATD DSG  G IT+ L +    E     F +N+ TG + L   LDRE +   E  V A DGG  +  A   V +TV+D NDN P        T       V E   +GT +G V   DLD+G+NARV + N V+E    +     D     +++L+  DRE   Q  L ++ VD GRP L++   ++I++ D NDN P++  P+  D        +V T   + +L   ++ A D D  +NG+  + I+   N    F +N  SGA+         + +S    GL+R+ + ++D   +  R  ++
Sbjct:  162 RVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVP--SYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVH--RLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVAL-NLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWK-----HVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGG-NPKGIFLLNADSGALSLA------RTVSSLDEGLHRLVVRVRDRGGSGSRRVRA 821          

HSP 2 Score: 85.8853 bits (211), Expect = 2.928e-17
Identity = 129/581 (22.20%), Postives = 229/581 (39.41%), Query Frame = 2
Query:  728 LQLTAFDRGGQFETMSLF---ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEIN-DKFSL----------------NKLTGEIKLLQ---KLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI--EILKNVSIPENKRIATPIMSIYVHDDD---------SVHNKVKCNKNSNDNFRLHSSQENSL-TIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIF----TRAQHI----YQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNS-LDREVKEMLEFFVYATDGGGLEAS--VKVSITVMDINDNPPRLKSPKIL---------TVLENEPIGTLIGNVEVFDLDDGENARVTI---ENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV-----NTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYST 2281
            +Q+ A  +G     + L    +   D ND+ P F       ++ E+      +   +A D D G N    YR    +   +    FSL                +   G   LL+   +LD E       E  +   D G+P+LSGS  + I   D NDN+P       + V I E+ ++ T ++ +   D D         S H K+           LH      L T+      D E   +H++ +   D G    +   ++ + + D+NDN P+F     + +++     +I E+      +   S +D D G+ G +  RL+     E        ++      LD E  +     V A D G  + S  + + I+V+DINDN P   +P  +         ++ EN P GT++ N+   D D G N  +T    E    E+      L +   ++ + + +DREK  +  L ++  D G P+  +   + ++++D ND       P+   V NS + +Y       T   +++ T+   D D  +N ++   ++ +          +T G +  T
Sbjct:  111 VQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSY--ELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLAT---QAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDEND-----NAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRT 681          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 182.57 bits (462), Expect = 1.974e-47
Identity = 140/468 (29.91%), Postives = 227/468 (48.50%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEK-----GYPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-------LKNVSIPENKRIATPIMSIYVHDDDSVHNK-VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY-----RLDDAGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSP------KILTVLENEPIGTLIGNVEVFDLDDGENARVT 1870
            R+ L  A DLD   N +  Y L EN +  F L++        Y EL++ S L+ E   E ++ LQLTA+D G   +  T  + IT +D NDN P+F       TV+E+ T    +L + A D+DEG NG++ Y F +    E+   F L+  TG++ L  +LD+E+ S+   E +I+A D G   +   CK+ +H  DINDN+P I++          V + E     + +  + V D DS  N  V C+   + +F+L   +++ + +    + D E  + + + +E  D G PP    +   + ++DENDN P F R+ +   + E++    ++   +A D D+ + G I Y      +  A    +V IN S+G IY    LD E    L F V A D G   L  +  VS+ ++D NDN P +  P       ++ +  +  +G L+  V   D D   N  ++
Sbjct:  154 RVPLEGARDLDVGGNALRAYHLDENER--FGLALRARTDGAKYAELVVKSRLDREQ--EGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSE--YEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVV-TNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELS 614          

HSP 2 Score: 112.849 bits (281), Expect = 1.283e-25
Identity = 134/541 (24.77%), Postives = 255/541 (47.13%), Query Frame = 2
Query:  755 GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSL-------NKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNS---NDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFP-------IFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEF-VINISTGYIYLYN-SLDREVKEMLEFFVY--ATDGGGLE--ASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVT---IENEVQENALFYSYLKLDNNKIFIKSL--IDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYS 2278
            G F+ +   +  +D ND+ P F        + E+      +    A+DLD G N   +Y  D       N++F L            E+ +  +LD E   +  ++ T  A D G P  SG+  + I   D NDNSP   +   NV++ E+    T ++++   D D+  + +V  + +S    +  RL      +  + ++   D+E +S ++I I+  D G   +  +  + + + D NDN P       + +R   ++ +SE +    F+   + +D+DS   G +   L   G+  F ++     Y+ + N SLDRE  +M ++F+   A+DGG     A+ + ++ ++D NDN PR  +S    ++LEN   G  +  V  +D D   N  +    +E+EV   A   +Y+ ++ +   I +L  +D E ++ +  +++  D G P L +  T+++ I+D NDN P++ +P    + N   ++ +  +      +  + ARDSD + NG++ +RI+   N    F++N   G +++
Sbjct:  115 GLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDE------NERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLT--AWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVF-VSEGAAYESFVGLVTVSDIDSAENGLVACHL--RGHPHFKLLPYRDDYVVVTNSSLDRE--QMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVA-GASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPP---LRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQG-NERNLFRINRLGGEVFT 637          

HSP 3 Score: 62.3882 bits (150), Expect = 5.493e-10
Identity = 69/270 (25.56%), Postives = 113/270 (41.85%), Query Frame = 2
Query: 1271 DNFRLHSSQENSLTIYMERTFDYEN------SSIHQIDIECFDSGIPPMATYKSLF------IAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIST-------GYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLD--NNKIFIKSLIDREKVSQIFLRLKLVDHG 2008
            D+F L   +E   T+      D E       S + + D+ C    +P     + LF      + ++D ND+ P F R++   +ISE   +   +    A DLD G      Y LD+  N+ F + +           + + + LDRE +      + A DGG      +  V ITV+D NDN P        +TV E+   GT++  +   D+D+G N  V        +A      +LD    K+ +K  +D E  S+  + ++  D G
Sbjct:   70 DDFSLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCT---LP-----RGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDE--NERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMG 329          

HSP 4 Score: 51.2174 bits (121), Expect = 1.027e-9
Identity = 51/194 (26.29%), Postives = 82/194 (42.27%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLSENHKKFFQLS----IEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQ--FETMSLFITTIDRNDNKPIFTDILYRKT-----VKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEI-KLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEI 1114
            TA+D D+  NG+  Y++ E+      +S    I      +  L  L++E +    F +Q  A D G        ++ +  +D NDN P+ T    R       +  +      +  V+A+D D   NG++SYR   +   E N  F +N+L GE+      +     S       +   D GSP LS +  IEI
Sbjct:  486 TAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQ--ARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRI--VQGNERN-LFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEI 674          

HSP 5 Score: 30.4166 bits (67), Expect = 1.027e-9
Identity = 13/36 (36.11%), Postives = 21/36 (58.33%), Query Frame = 3
Query:  435 STKPAVNF-QINFEIIDENDNPPKFNQFKFNINVLE 539
             T P V   Q    ++DENDN P+F++  +  ++LE
Sbjct:  439 GTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLE 474          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.229 bits (404), Expect = 7.114e-40
Identity = 135/442 (30.54%), Postives = 207/442 (46.83%), Query Frame = 2
Query:  752 GGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIP-ENKRIATPIMSIYVHDDDSVHN-----KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYEN--SSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLD-SGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG----LEASVKVSITVMDINDNPPRLKS-PKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSL-IDREKVSQI-FLRLKLV-----DHGRP 2014
            G  + +  + IT I+ NDN+PIF+  LY  +V EN T    ++QV A DLD G  G++SY F      + +DKFSL+  +G I +   LD+E  +      T+ A D G  + +G  ++ I+  D+NDN+P  +    V    EN    TP++ +   D+DS  N      +      +  F +  S    + + + R  DYE        + I   D G PP+ +  +  + + DENDN PIF R  +   I E+      +   +ATD D S  +G+++      G+ +F IN  +G I     LDRE        V A DGG           V+IT++D+NDN P  +  P  +T++EN P GT I  V   D D  EN   T+   +     FY  +   + KI    L +DRE ++ I F  ++ +     D G P
Sbjct:    8 GEHWGSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHF-----SDDSDKFSLDPASGLISVAAALDFE--ATPRFTVTVMARDGGGQETAG--RVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGV-VTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENG--TLVYAIDPPNPFYR-INAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSP 436          

HSP 2 Score: 152.91 bits (385), Expect = 1.156e-38
Identity = 143/508 (28.15%), Postives = 220/508 (43.31%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKN---VSIPENKRIATPIMSIYVHDDDSVHNKVKC----NKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIP--PMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYN-SLDRE------VKEMLEFFVYATDGGG----LEASVKVSITVMDINDNPPRLKS-PKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLI--DREKVSQIFLRLKLVDHGRPKLTS 2026
            A DLD+ + G  +Y  S++  KF   S++     + + +AL+FE     +F + + A D GGQ     + I  +D NDN P+F    Y  T +EN     P+++V+A D D   N +I+Y     +        +++   G + L + LDYE      I  TI A+D GSP L+ +    +   D NDNSP  +  +N   ++IPEN      ++ +   D D      +     +   +  FR+++   +   I      D E  S + + +   D G          ++ I ++D NDN P +    +   I E++     +F  SA D D    G + Y +D   N  + IN ++G I      LDRE         M    V   D G       AS  V++ + D+NDN P     P  L VLE  P  + +  V   D D+G N  VT        AL     +LD     I +L+  DRE V+   LRL   D G P L+S
Sbjct:   54 ATDLDAGVFGQVSYHFSDDSDKF---SLDPASGLISVAAALDFEATP--RFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFD--RNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGD---ITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPP-NPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYS---MTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSS 547          

HSP 3 Score: 26.1794 bits (56), Expect = 1.156e-38
Identity = 10/27 (37.04%), Postives = 19/27 (70.37%), Query Frame = 3
Query:  459 QINFEIIDENDNPPKFNQFKFNINVLE 539
            +++  +I+ENDN P F+   +N++V E
Sbjct:   15 RVHITLINENDNRPIFSLPLYNVSVWE 41          

HSP 4 Score: 119.013 bits (297), Expect = 8.582e-29
Identity = 110/407 (27.03%), Postives = 189/407 (46.44%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKF----HLQLTAFDRGG--QFETMSLFITTI--DRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKN-VSIPENKRIATPIMSIYVHDDDSVHNK----VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKS----LFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE--FVINISTGYIYL-YNSLDREVKEM--LEFFVYATDGGGLEASVKV 1723
            +A D D + NG   Y++ +    F++++   G      L  L+ E++N   F     + ++  DRG   +  T S  +T +  D NDN+P F  + Y   V E       + QV A D DEG NG ++Y      P+     F L+  TG I  L +LD E  +    +  + A D G+P LS +  + +   D+NDN+P     ++ VS+ E+    + ++S+   D DS  N          N +  F +        T+    + D E  + + + IE  D+G  P  + ++    L + ++D NDN P+F    +   + E+      + Q  ATD+D G  G++ YR+  +GN++  F++N+S+G I      LDRE   +  L+   +  D  GL + ++V
Sbjct:  371 SAADPDLNENGTLVYAI-DPPNPFYRINAASGKIRTTGLQ-LDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRP---DFQLDAATGLITTLVQLDREAVA--AYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVV---SLDRETKASYSLVIEAIDNG--PAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRI-ISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQVEAFNNDSVGLSSVIRV 764          

HSP 5 Score: 26.9498 bits (58), Expect = 8.582e-29
Identity = 21/79 (26.58%), Postives = 35/79 (44.30%), Query Frame = 3
Query:  309 KSGDIITTKFIDRDNREEICGPLSCCSKDICEFQA--NAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            +SGDI +T  +DR+            S+ I   +A      N Q T  A    +N  ++D NDN P +    + + ++E
Sbjct:  294 RSGDITSTTLLDRE----------AVSQYILIVRAVDGGDGNDQKTGIAT---VNITLLDVNDNDPAWRDLPYAVTIVE 359          

HSP 6 Score: 117.087 bits (292), Expect = 2.630e-28
Identity = 150/618 (24.27%), Postives = 253/618 (40.94%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENT-TYTIPILQVQAKDLDEG--ENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI------LKNVSIPEN--KRIATPIM----------SIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSL--------FIAIIDENDNFPIF-TRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNS------LDREVKEMLE-------FFVYATDGGGLEASVK--VSITVMDINDNPPRLKSPK--ILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEG-DVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYST 2281
            A D D  +N    YSL      +F +  ++G   + +   L+ E +   +  L +   D G +  T+ L +T +D NDN P F        V EN+      ++ V+A D D G  + G + Y   +      ND F +++ TG I  +  +DYE   + L+   + A D+  P  + SC++ +   +  D      +      L   ++P     R+A P M          +I V      H   +  +  +DN  L ++ +  +T   +   D E +  + + +   D G  P      L        ++ + DENDN P F   +  + ++ E +     L    ATD D+G+ G ++ R     +      I   YI +  +      +D    + +E       F + A DGG    S    +S+ V+D+NDN P   SP    ++V+E    GTL+ +V   D D G N +VT   E                ++   + IDRE  +   L +  VD G P L+    + + + D+ND  P    P +   V+ S S+        SF+ T+ A ++    N K  ++I     G   F V+ TSG + ST
Sbjct: 1528 ASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGG----NDTFGIDESTGLIVTVAPIDYETRPEYLL--MVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQ---KWHEDKRHKQQESDNAELIAALQGEIT--TQAALDREATDSYMLTVLSRDGG--PREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSAR----AHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSV-------GSFVATVKATENYKGHNTKYTYKIAGI--GKNAFTVHATSGLVTST 2119          

HSP 7 Score: 27.335 bits (59), Expect = 2.630e-28
Identity = 10/22 (45.45%), Postives = 14/22 (63.64%), Query Frame = 3
Query:  474 IIDENDNPPKFNQFKFNINVLE 539
            I+DENDN P F+Q  +   + E
Sbjct: 1490 ILDENDNSPVFSQVTYEAEIPE 1511          

HSP 8 Score: 118.242 bits (295), Expect = 5.932e-27
Identity = 100/381 (26.25%), Postives = 172/381 (45.14%), Query Frame = 2
Query:  782 ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQ-KLDYE----IYSDQLIEFTIEAVDEGSP--QLSGSCKIEIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNS---NDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNK--EFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGL----EASVKVSITVMDINDNPPR-LKSPKILTVLENEPIGTLIGNVEVFDLDDGENARV 1867
            IT +D NDN P + D+ Y  T+ ENT     I  V A D D  ENG + Y  D   P      + +N  +G+I+    +LD E    I    +    +   D GSP  + + S  + +   D+NDN P  + +   + + E     + +  +   D D+  +  V  +  +     +F+L ++     T+      D E  + +Q+ +   D G P +++  +L + ++D NDN P F  A+    + E    +  +   + TD DSG   ++++ +   GN+  +F +    G +    SLDRE K      + A D G        +  + + V+D+NDN P  L+    ++V EN   G +I  V+  D+D+G N RV
Sbjct:  336 ITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNP-----FYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQ---LDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFI-TGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRV 707          

HSP 9 Score: 118.242 bits (295), Expect = 6.137e-27
Identity = 147/609 (24.14%), Postives = 256/609 (42.04%), Query Frame = 2
Query:  578 DLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMS--LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKI-------SYRFDTLTPQEINDKFSL-NKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSG------SCKIEIHSTDINDNSPRIEILKN--VSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSS------QENSLTIYMERTFDY--ENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIF-TRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLY--NSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSP-KILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKS---LIDREKVSQIFLRLKLV----DHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCN-GSR---YFQVNETSGAI 2272
            DL     G   YS++      F +    G   ++ ++ +++E   E  + L + A D+   F T S  L ++  +  D K  F+   Y+  + E       +++V A  +       +        +  D    Q+ +D   L   L GEI     LD E     ++  T+ + D G  +            + ++ TD NDNSP  E      V + E+    T +  ++  D D+  N  V    +++   R+          E+ +TI      D+  + S      I   D G PP +T  +L + ++D NDN PIF +   +   + E       +    ATD D+G  G++T+R++  G  +  I  S G I +    ++DRE +      V A D G   L  S  V + V D+ND  P   +P + ++VLE+  +G+ +  V+  +   G N + T           Y    +  N   + +   L+   ++ + + R  L     DHGRP L     + + ++D+ND+ P+   P  G V+N   ++ V  +    I+ +LA D D  +NG +R+  +     GSR    F++N TSG I
Sbjct: 1639 DLGVCDAGTVRYSIASGGNDTFGIDESTGL--IVTVAPIDYETRPE--YLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYML--TVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYT-----------YKIAGIGKNAFTVHATSGLVTSTRLLKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIR----IVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGII 2226          

HSP 10 Score: 95.9005 bits (237), Expect = 3.626e-20
Identity = 105/446 (23.54%), Postives = 184/446 (41.26%), Query Frame = 2
Query:  767 TMSLFITTIDRNDNKPIFTDILYRKTVKEN-TTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEG---SPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATP---IMSIYVHDDDSVHNK----VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSG-NFGKITYRLDDA---GNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVK-----VSITVMDINDNPPRLKSPKI-LTVLENEPIGTLI----GNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLV--DHGRPKLT 2023
            T S+ I   D NDN P F    Y   + E  +T  + +  V A D DEG+N ++ Y    +        F ++  TG +  ++ LD+E+ S  L    + A D+    + +L+ +  + +H  D+ND +P    L++   P +     P   I +    D DS  N        + +  + F + S  +  L +      D E  + + + I   D G PP+ +  ++ + ++D +DN P+F        +SE + V   + +  A+D + G N   +      +   G + F  +  TG +Y+   LDRE        +   D     +  +     + +T++D NDN P          + EN P GT++    G +   D D G NA +        +A F       N  + +   +DRE +    L L ++  D GR   T
Sbjct: 1155 TTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVY---AIVSGNTAATFGIDNGTGVLTAVKALDFEV-SAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTP--WFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVI-SPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNAT 1593          

HSP 11 Score: 77.7962 bits (190), Expect = 1.445e-14
Identity = 90/363 (24.79%), Postives = 154/363 (42.42%), Query Frame = 2
Query:  596 NGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQ--FETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIP----ILQVQAKDLDEGENGKISYRFDTLTPQEINDK----FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSP-QLSGSCKIEIHSTDINDNSPRIEIL-------KNVSIPENKRIATPIMSIY-VHDDDSVHNKVK----CNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSG--IPPMA-----------TYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL 1576
            N  Y Y ++   K  F +    G     ++++       ER F+L   A D G    +    L++  +D ND++P+F  +L       N T  +P    I++V A D DEG+NG + Y F  L    +  +    F +N  +G I   + LD E  S  +    + A D+G P     +  +++   DI+DN P   +L       ++ SIPE+    T + ++    D D   N +        N  + F L  S+   L +  +   D E S  + I ++   +    P +            T + + + + D ND +P+FT  ++   ++ D+KV   L Q  A D D GN   + YR+
Sbjct: 2092 NTKYTYKIAGIGKNAFTVHATSG-----LVTSTRLLKSYER-FNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVF--VLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSF--LHAGGVGSRDWESFRINATSGIISTARALDRE--SQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNL--SRWGLLVVLSD--LDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRI 2438          

HSP 12 Score: 73.1738 bits (178), Expect = 3.072e-13
Identity = 92/395 (23.29%), Postives = 164/395 (41.52%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSE-NHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQF--ETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTI-EAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIM----SIYVHDDDSVHNKVKCNK--NSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECF-DSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDS-KVNEFLFQCSATDLDSG--NFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATD 1693
            R++   A D DS +NG   YS+ + + +  F +S   G  +L +   +  +   +  ++L + A D G      T+++ +  +D +DN P+F ++    ++ E       + +V+A D +EG N     +    +       F  +  TG + + + LD E  ++  +  T+ +  D  S     S  + +   D NDNSP   ++     IPEN    T +      IY  D D   N          +  + L      ++++ + +  D E     ++++      G    AT + L + ++D NDN P F        + E+S  V   +    A D D G  + G + Y +   GN  F I+ STG I     +D E +      V ATD
Sbjct: 1300 RIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADG--DLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVR-LGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATD 1691          

HSP 13 Score: 56.6102 bits (135), Expect = 4.118e-8
Identity = 78/314 (24.84%), Postives = 131/314 (41.72%), Query Frame = 2
Query: 1394 PMATYKSLFIAIIDENDNFPIFTRAQHIYQISED-SKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE--FVINISTGYIYLYNSLDREVKEMLEFFVY-ATD-----GGGLEASVKVSITVMDINDNPPR-LKS-PKILTVLENEPIGTLIGNVEVFDLDDGENARV--TIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLV--DHGRPKLTS-WEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDD----CNGSRYFQVNETSGAIY 2275
            P     S+ I I DENDN P F  A +   ++E  S     +   +A+D D G+  ++ Y +  +GN    F I+  TG +    +LD EV   L   V  ATD        L ++  VS+ V D+ND  P  L+S    + V E +P G  I      D D G N  +  +I +    N    S    D   + ++  ++ ++ +Q F  L ++  D G P L S        +   +++   L  P+   +  + +++ + ++          R SD +E       +       CNG R F  +  +G +Y
Sbjct: 1151 PAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAI-VSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQP-GPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGD---LRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRV---------RASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVY 1450          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.688 bits (400), Expect = 2.245e-39
Identity = 158/591 (26.73%), Postives = 274/591 (46.36%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSE-NHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQ--FETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQ----LIEFTIEAVDEGSPQ-LSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE--FVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPR-LKSPKILTVLENEPIGTLIGNVEVFDLDDGENARV--TIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIF-LRLKLVDHGRP---KLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYST 2281
            A D DS  NG   Y + E N  + F +     +P+  +      +     ++ L ++A D G +    ++++ +T +D NDNKP+F    Y     E       +  VQA D D G NG ++Y F+   PQ +N  F L+  TG I  L+  D E    Q       F++ A D G P+ L     +++   D+NDN P+  + +   S+ E+    T ++ +   D D+ V+  ++   N  +     +   ++  I +  + D E ++ + + +   DSG  P+A   ++ + ++DENDN P FT +       E ++V E L   +A+D D+G  G + Y +  AGN    F I+ STG ++L   LD E + +    V A DGG     ++  + + V D NDNPP  L      +++EN PIGT +  V   D D   N  +  +I  +    A F   +  ++ +I   + IDRE    +F + ++  D   P   + ++ + +T+ + D NDN P    P+   V   R+         S + TL A D D  EN  +R+ +    + +  F+++  +G I ++
Sbjct:  782 ATDKDSGKNGEVKYEIGEGNGGEKFGI-----FPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEK--PQ-VN--FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAI-VAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHF--TIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAA------GSVVGTLQASDPDEAENAAVRYAVT-GGDAAILFRLDRRTGIIETS 1352          

HSP 2 Score: 150.214 bits (378), Expect = 8.238e-37
Identity = 135/495 (27.27%), Postives = 226/495 (45.66%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENV----NERKFHLQLTAFDRGGQFE------TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEIND--KFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHDDDS-VHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDD--AGNKEFVINISTGYIYLYNSLDREVKEML-EFFVYATDGG-----GLEASVKVSITVMDINDNPPRLKSP-KILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSL--IDREKVSQIF 1981
            A D D+  NG   YS  E  +  F+L  E G   +  L   + E +        F   + A D GG+ +      T+ +F+   D NDN P F   +Y+ +V E+ +    +L+V A D+DEG NG + Y  +     E N+  KF+++  TG+I LL  LD E  +   +   + A D G+  L+ SC + +   D NDN PR  E L +V   E+ R+   ++++   D+D+     V+    + +     +   ++ ++++ R  D+E   ++++++   D G PP ++   L + + D NDN P F        I E+  +   +   +A D D+   G++ Y +         F I+  +G I     +DREV   L E  V ATD          A   V++ V D NDN PR  +P  IL        G+++G ++  D D+ ENA V       + A+ +   +LD     I++   +DRE     F
Sbjct:  886 ATDADAGSNGGVTYSF-EKPQVNFELDSETG--RIASLRVFDREALIRQGGAASFSFSVVATD-GGRPKPLQDRATVQVFVQ--DVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAIN-----EGNEGGKFTVDASTGQITLLGSLDREETASYTL--VVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILF---RLDRRTGIIETSTELDRESGHGAF 1364          

HSP 3 Score: 140.198 bits (352), Expect = 5.539e-35
Identity = 139/502 (27.69%), Postives = 222/502 (44.22%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYS----LSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQ--FETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDA-GNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPK-ILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSL--IDREKV------SQIFLRLKLVDHGRPK 2017
            +A D D   NG   Y+    +   +++ F+L    G  ++  L +L+ E + E  + L + A DRG      T  + +   D NDN P+F  + Y  ++ EN      +  V A D D G NG + Y+   LT  +   +F +N +TG +     LD E  +  + +  + A+D G  +      + I   D  D  P       +  + EN    T + S+     D ++  V     S D     S + +   I+     D E  + +Q+ +     G+   A   S+ + + D N++ P+F RA +   I+ED  VN   F   ATD DSG  G++ Y + +  G ++F I    G +Y+   LDRE +E     V A D G   L +SV V++TV+D+NDN P   S   +    E + +G+L+G V+  D D G N  VT   E  +        +LD+    I SL   DRE +      +     +   D GRPK
Sbjct:  469 SAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTG--KVTTLKSLDREELEE--YPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQ---LTAGDAA-RFQVNAVTGAVSTRVSLDREERA--VYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD-LNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGI-FPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQ-----VNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPK 950          

HSP 4 Score: 26.5646 bits (57), Expect = 5.539e-35
Identity = 14/51 (27.45%), Postives = 24/51 (47.06%), Query Frame = 3
Query:  402 EFQANAILNY----QSTKPAVNF-QINFEIIDENDNPPKFNQFKFNINVLE 539
            E  ++ +LN     Q  +P   +  +   ++D ND PP F Q K+    +E
Sbjct:  407 EVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVE 457          

HSP 5 Score: 140.969 bits (354), Expect = 6.438e-34
Identity = 165/615 (26.83%), Postives = 262/615 (42.60%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNV-SIPENKRIATPIMSIYVHDDDSVHNK--VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECF-------DSGIP-PMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNK--EFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKILTV--LENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSS 2362
            +A  LD + N  Y     +    F   SIE     +   +A++ E   E+ F+      + GG     S+ +   D N++ P+F    Y  ++ E+         V+A D D G+NG++ Y        E   KF +    G++ +  +LD E   +     T+ A+D G   LS S  + +   D+NDN P       V    E + + + + ++   D D+  N       +    NF L S       I   R FD E + I Q     F       D G P P+    ++ + + D NDN P F ++ +   +SE +     L + +A+D+D G  G + Y +++ GN+  +F ++ STG I L  SLDRE        V ATD G   L AS  V++ V+D NDNPPR     +L+V  LE+  +G L+  +   D D G +  V     V  N      +      +F+   +D E      L +   D GRP  +S   + + + D NDN P       GDV  S   I  N    + ++T+ ARD D D NG++ + I        +F ++  SG I     C   +       GL+ V +   D +
Sbjct:  681 SASTLDLNANVTYLIVSGDQRGSF---SIEWSGGRIFTANAIDRE---EQAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGE---KFGIFP-DGQLYVRYELDRETREE--YSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGR---IASLRVFDRE-ALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINE-GNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTE-SLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAI-VAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAF---LPGDVFAS---IMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEI-----CTAAEIDREVTGGLFEVTVRATDKA 1265          

HSP 6 Score: 130.954 bits (328), Expect = 1.876e-32
Identity = 128/501 (25.55%), Postives = 215/501 (42.91%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERK----FHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYS-DQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQE--------NSLT--IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL---DDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEAS--VKVSITVMDINDNPPRLK-SPKILTVLEN---EPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVD 2002
            A D DS   G   Y+L+ +    +       +P   +  ALN     +R+    + L+  A D GG   T  L++  +D NDN P   +      V E+      +L++ A D DEG N ++ +   +  P+    +F++    G++ + + LD E  S   L+    +       +LS + ++ +  TD+NDN+P     ++   PE+  +   + ++   D DS  N       + D                 N++T  + + R  D E    + + +   D G PP+ +  +L + + D NDN P F R ++   I+ED      + + SA D D G  G++ Y +   D  G  +F ++   G + +   LDRE     E  V A DGGG   S    V +T+ D+ND  P  + SP  +   EN    P+  LI  V   D D G + +VT       +   +S +  D +   ++SL DRE   Q  L +   D
Sbjct: 1646 AGDADSGPFGEVTYALAPSEDSDWADGAFGLHP---VTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPE---GRFAVGN-DGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTG--DFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPV--LILQVVARDDDLGSSGQVTYAAAGGNDGGAFS-VSPDGHVHLLRSL-DREAQPQHVLIITATD 2133          

HSP 7 Score: 26.9498 bits (58), Expect = 1.876e-32
Identity = 9/32 (28.12%), Postives = 21/32 (65.62%), Query Frame = 3
Query:  447 AVNFQINFEIIDENDNPPKFNQFKFNINVLEE 542
            A + +++  + D NDN P+F++  ++ +V E+
Sbjct: 1598 ATDARLSVAVRDANDNSPRFSRHAYSFDVAED 1629          

HSP 8 Score: 134.806 bits (338), Expect = 5.144e-32
Identity = 141/500 (28.20%), Postives = 222/500 (44.40%), Query Frame = 2
Query:  557 MSLPTAYDLDS-SINGVYNYSL-SENHKKFFQLSIEKGYPELLIL---SALNFENVNERKFHLQLTAFDRG---GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIP-ENKRIATPIMSIYVHDDDSVHNK-VKCNKNSN------DNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEA--SVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLV 1999
             +L T  D DS + NG  + S+   N +  F L    G P L +L   S L+ E +    ++L + A D G    +  T SL +   D ND+ P F    Y   + E       +  V A D D G N K+  R+  ++  ++   FS+++ TG +    K+D E+ S   +   I A D+G+   +    + +   D+ND  P     K V+   EN      ++S+   D D   N  V+ N + +      + FRL S      T+   ++ D E    + + ++  D G PP+ +   + + + D NDN P+F   Q+   I E+      +   +ATD D G  G + Y+L       F +N  TG +    SLDRE + + +  V A DGG L A     V+ITV D  D PP   +      V EN   GTL+G+V    LD   N    I +  Q  +     ++    +IF  + IDRE+  Q F +L++V
Sbjct:  249 AALVTVTDADSPTANGELSVSIVGGNERGHFVLHA-PGVPGLRVLKVASQLDRERIP--MYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKL--RYSIVSGNDLG-WFSVDESTGLVTTDGKVDREVASS--VVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTL---KSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSF---SIEWSGGRIFTANAIDREE--QAFYQLRVV 732          

HSP 9 Score: 133.65 bits (335), Expect = 9.569e-32
Identity = 154/612 (25.16%), Postives = 258/612 (42.16%), Query Frame = 2
Query:  563 LPTAYDLDSSINGVYNYS---LSENHKKFF---QLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEIL------KNVSIPENKRIATPIMSIYVHDDDSVHNKVK-----CNKNSNDNFRLHSSQENSLTIY-MERTFDYENSSIHQIDIECFDSGIP-PMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGN--KEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITV--MDINDNPPRLKSPK-ILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN--NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFI---------LTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWS 2287
            L TA D D   NGV +++   +S N +      +   ++ +  L     L+ E      + L + A D G   ++  + + +T  D NDN P F    YR +V E++     +     +DL     G ++  FD   P+           TG +   Q LD+E  + +    ++ A D G+P LSG     I   D+NDN P I  +      ++ S+ E+    T    + V D DS     +        N   +F LH+     L +  +    D E   ++ + I   D+G P   +   SL + + D ND+ P F  + +   +SE +    ++   +A D DSG   K+ Y +  +GN    F ++ STG +     +DREV   +   + A D G    +   S+TV  +D+ND PP     K + T +EN   G  + +V   D D GEN  V    +    A +    +LD+   K+     +DRE++ +  L ++  D G P L S   +T+ +               GD+ ++  + Y    F S +          T+ A D D   NG +R+++      +  FQVN  +GA+ +  S
Sbjct:   45 LDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREA--NPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----RDLLHRGRGPLAVPFD---PK-----------TGMVSTRQPLDFE--ARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSI-VSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVV---------------GDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLT--AGDAARFQVNAVTGAVSTRVS 615          

HSP 10 Score: 119.783 bits (299), Expect = 2.118e-27
Identity = 110/443 (24.83%), Postives = 189/443 (42.66%), Query Frame = 2
Query:  782 ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI------LKNVSIPENKRIATPIMSIYVHDDDS-----VHNKVKCNKNSN---DNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIST-GYIYLYNSLDREVKEMLEFFVYATD-----GGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARV--------TIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            I+  D NDN P+F        V+ENT     I  + A D D+G+N  ++Y    L+  E    F ++  +G ++  ++LD E  +  L+  T+ A D      +   ++ +   D NDNSPR         +   + P+ K     I ++   D DS     V   +  +++S+     F LH     +  + + R  D E+ + + +     D G   +A    L++ ++D NDN P         ++ ED+     L + SATD D G   ++ + +  +G+ E    +   G + +  +LDRE +      V  +D        L ++V+VS+ + D+NDN P   SP+     E+ P+G ++  V+  D D G N+ V                       L     ++ +   +DRE      L +  VD GRP LTS
Sbjct: 1504 ISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTY--SVLSGSE--GAFVVDAASGVLRASRRLDREERASYLL--TVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPV---TGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSIS-SGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTS 1931          

HSP 11 Score: 107.071 bits (266), Expect = 1.639e-23
Identity = 85/325 (26.15%), Postives = 147/325 (45.23%), Query Frame = 2
Query: 1082 PQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNKV---KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSK-----VNEFLFQCSATDLDSGNFGKITYRL-----DDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILT-VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGR 2011
            P +S   ++EI   D+NDN P   + +  + + EN      I ++   D D   N +        S   F + ++   S  +   R  D E  + + + +   D      AT   L +A+ D NDN P F+R  + + ++ED+          +    A D DSG FG++TY L      D  +  F ++  TG + +   LDRE +        ATDGGGL A+ ++ + V+D NDN P +++  +   V E+ P GT +  +   D D+G NA   +E  +        +   ++ ++ +   +DRE+ S   L +++ D  R
Sbjct: 1494 PPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAA---SGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAE--LEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRAR 1810          

HSP 12 Score: 60.4622 bits (145), Expect = 2.711e-9
Identity = 83/418 (19.86%), Postives = 165/418 (39.47%), Query Frame = 2
Query: 1100 CKIEIHSTDINDNSPRIE--ILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTI----YMERTF---------DYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLK------SPKILTVLENEPIGTLIGNVEVFDLD----DGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
             ++ +   D+NDN+P      +  V+  E+  +   ++      D +V   V  N  ++  +++ S  E    +      +R F         D E +  + + ++  D G P       + + + D NDN P F +  +   ++EDS V   L      DL     G +    D            TG +     LD E +      + A DGG   L       I ++D+NDN P ++      + +  +V E+   GT+   V V D D    +GE +   +    + + + ++        + + S +DRE++    L +   D+G+P   S     +  ++  +     ++     +    + +       S++  + A D+D   N K+R+ I+   N   +F V+E++G +
Sbjct:    7 TEVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLL-----DTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----RDLLHRGRGPLAVPFDP----------KTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVN-----DHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIV-SGNDLGWFSVDESTGLV 398          

HSP 13 Score: 48.9062 bits (115), Expect = 7.554e-7
Identity = 48/167 (28.74%), Postives = 74/167 (44.31%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLSENHKKF-FQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYT-IPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFT 1057
            +A+D D   NG   Y ++       F+L    G   L +   L+ E      + L + A D GG  + +T S+ +T  D ND  P F    Y    +ENT    + ILQV A+D D G +G+++Y             FS++   G + LL+ LD E     ++  T
Sbjct: 1972 SAWDPDEGANGELRYDIASGDPTGDFRLDPVLG--TLAVARPLDRERTA--SYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAG---GNDGGAFSVSP-DGHVHLLRSLDREAQPQHVLIIT 2130          

HSP 14 Score: 22.7126 bits (47), Expect = 7.554e-7
Identity = 7/22 (31.82%), Postives = 14/22 (63.64%), Query Frame = 3
Query:  480 DENDNPPKFNQFKFNINVLEEQ 545
            D NDN P+F + ++   + E++
Sbjct: 1941 DANDNAPRFPRREYEAAIAEDE 1962          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 148.673 bits (374), Expect = 1.194e-36
Identity = 153/522 (29.31%), Postives = 236/522 (45.21%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKK---FFQLSIEK-----GYPELLILSALNFENVNERK-FHLQLTAFDRGGQFETMS--LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDK-----FSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVS-------IPENKRIATPIMSIYVHDDD-SVHNKVKCN-KNSNDNFRLHS-SQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLI--DREKVSQIFLRLKLVDHGRPKLTS 2026
            R  +  A D DS  NGV  Y L  +       F+LS+ +       P L++  +L+ E   ER+ + + L A D G    + S  L I   D NDN P+F        + EN+     ++Q+ A D D G N ++ YR  T T    + +     F L++ +G + +   L+ E     +    I A D+G   +  +  + +  TD+NDNSP IEI   V+       I E   +  P+  I V D D   +  V C   N    F+L   +  N   +    T DYE  + + + I+  D+G   ++   S+ I ++D NDN P+FT   +   + E++ + + L   SATD D     ++ Y L       F ++  TG I L   LDRE K    F + A D G   LE +  V + V+D+NDN PR    +    V EN P  + +G V V D D+GEN RV +     +N   +S   +D     I+S +  DRE+     L ++  D G P  +S
Sbjct:  171 RFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDRE---ERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNRE--ESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFS---IDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSS 684          

HSP 2 Score: 94.3597 bits (233), Expect = 8.410e-20
Identity = 144/547 (26.33%), Postives = 225/547 (41.13%), Query Frame = 2
Query:  752 GGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLN---KLTGE----IKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK---------VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFP------IFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLY---NSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSL-------IYVNTQF--NSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYS 2278
            G  F+ + + I   D NDN P F   +   +V EN           A D D   NG   Y      P  ++  F L+      GE    + + + LD E    QL E  + AVD GSP  SGS  + I+ TD NDNSP  +  + NV IPEN  + T ++ ++  D D+  N               +     RL    +NS  + +    + E S +++I I   D G  P+    ++ + + D NDN P      I      +  ISE S VN  +   + +D D G  G +T  + +      +  ++    YL     +LD E K      + A D G   L  ++ V+I ++D NDN P    P   ++V EN  IG  +  V   D D  +NA +          +F  ++  +   I +   +DREK +     +   D G P L    T+ ++++               DV ++R          YVN     +S +  +   DSD  ENG++R  I+   N  + F ++  SG I S
Sbjct:  131 GPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVS-AFELSVTETANGEKVPYLVVRKSLDRE--ERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMF--HMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVL---------------DVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDN-RQLFSIDPESGMIRS 656          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 187.963 bits (476), Expect = 2.943e-48
Identity = 158/519 (30.44%), Postives = 239/519 (46.05%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSL-SENHKKFFQLSIEK--GYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLF------ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEIL------KNVSI-PENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSL---------TIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGN--KEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGL--EASVKVSITVMDINDNPPR-LKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE---NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            TA D D+  NG  +Y++ S ++   F L          L +++    +      + L +TA DRG    T +L       IT +D ND+ P+FT   Y  ++ ENT   + IL+V A D D G NG I Y  D    Q  N  F L+  TG I+  Q LD+E+ +     F + A D G P  +    + I+  D NDNSP+++I        + +I  EN  I T I  I V D DS       N NS    ++ +  +             I +++  D E    + + +   D G+P  +T   + I + D NDN P FT   +   ISE ++   ++ Q +ATD D G+ G ++Y +   GN    F ++  +G +     LDRE    +   + A D G      S  V++T++D NDN PR +KS    T+ E   IG  +  V   D+D G+N R+T E   ++ Q N LF   L      ++ KS +DRE  S     +   DHG P+L S
Sbjct:  118 TATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRG----TPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQS-NSIFDLDSSTGVIRTKQNLDFEVKNS--YTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDS-------NTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSI-TGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLF--ELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMS 619          

HSP 2 Score: 125.946 bits (315), Expect = 1.023e-30
Identity = 129/453 (28.48%), Postives = 196/453 (43.27%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSL---SENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILY-------RKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQK-LDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHDDDSVHNK-VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL---DDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPK-ILTVLENEPIGTLIGNVEVFDLDDGENARVT 1870
            +A D DS  NG   Y++   +      F L    G   +     L+FE  N   F++  +      + +  ++ I  +D NDN P    I Y       +    EN+     I  +   D D   N +   +   +T  +    F +  L      LQK LD E+        T+   D+G P  S    + I  TD+NDNSP         +I E  +  + ++ +   D D   N  V  +    ++         S  +   +  D E  S   I I   D G  P     ++ + IID NDN P F ++ +   ISE + +   + Q SATD+DSG+ G+ITY +   D   N  F +N  TG ++  + LDRE K +  F V A D G   L +SVKV +T+ DINDN P     +   +++ENEP G L+  V   D D+G NA ++
Sbjct:  229 SAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGV--IRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQL-KITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELK---ITNGDDEGCFKVEFLGFYFIQLQKPLDRELV--PFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL-QVTATDADEGTNAVIS 672          

HSP 3 Score: 26.9498 bits (58), Expect = 1.023e-30
Identity = 12/29 (41.38%), Postives = 17/29 (58.62%), Query Frame = 3
Query:  462 INFEIIDENDNPPKFNQFKFNINVLEEQK 548
            IN  I+DEND+ P F Q  +  ++ E  K
Sbjct:  192 INITILDENDHAPVFTQNSYLGSIAENTK 220          

HSP 4 Score: 128.642 bits (322), Expect = 5.474e-30
Identity = 157/611 (25.70%), Postives = 273/611 (44.68%), Query Frame = 2
Query:  518 VQHQCA*RTKNYRMSLPTAYDLDSSINGVYNYSLSENHKK--FFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI--DRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFT--------IEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHDDDSVHNK----VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGN--KEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKS-PKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLV----DHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            V H  A +  +Y+     A D DS  NG   YS+ + +++  F      K Y    +L AL      +  + L + A D G    + S+ +T    D ND++ +F +  +R  V EN++    +  + A  LD      I Y   +L   E    F+++  +G+I    +LD E    +LI+ T         EA+   +        + +  TD+NDN+P     +  +++ E     +P+  I   D D   N        +    D F ++SS      +++ +T D E +S + + ++  D+    + +   + I + D ND  P+F  + +   I+ED+ +   +   +A+D D G  G I Y + + GN    F +  +TG + +  SLD E  ++ E  + A D G   L ++V V++ V+D+NDN P   + P  LTV EN   G  +G     D D G NA +      Q  +  +S +     +I   + ID E +       +LV    D G PKL++ ++IT+ + D NDN P    P      +S +           ++T+ A D D + NGK+ + I+   NG  YF ++ ++G +
Sbjct:  952 VTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQAL------KGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVY---SLISSE--SHFAVDVRSGQITTRVRLDRE----ELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGE---LHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISN-GNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFS-VNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN-----------VMTITAEDPDRNSNGKVTYSIISGNNG--YFNLHPSTGQL 1529          

HSP 5 Score: 123.635 bits (309), Expect = 1.933e-28
Identity = 153/522 (29.31%), Postives = 235/522 (45.02%), Query Frame = 2
Query:  968 KFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIAT--PIMSIYVHDDDSVHNK-VKCNKNSNDN---FRLHSSQ---ENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLD-DA--GNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEAS--VKVSITVMDINDNPPRLKSPKILTVL-----------ENEPIGTLIGNVEVFDLDDGENAR--VTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYS------------TWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIRE 2413
            +F  N  TG I    ++D E  +   I   +  ++  +  +S    +++   DINDN PR   L   + I E+  + T  PI +    D D+ +N  V     S DN   F L ++     ++L +  ++  D E +  +Q++I   D G P +  Y  + I I+DEND+ P+FT+  ++  I+E++K    + + SA D DSG+ G I Y +D DA   N  F ++ STG I    +LD EVK    F V A+DGG    +    V+I V+D NDN P+LK    +T L           EN  I T I  + V D D   N++  + I N   E      +L      I ++  +DRE V    L L + D G P  ++   + I + D+NDN P   + S     N   L     Q  S++L L A D D  +NG + + I    N   +FQV+  SG + +            T +       S P  G   V + + D +    R  KS +  TI E
Sbjct:   41 QFGFNSNTGVISTTARIDRETTTQ--ISLQLRTLNPSNQPIS----VQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINT--ATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLK----ITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGF--YFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSP--AFTSNAYTANISEL----AQNGSYVLQLNATDPDEGDNGTVSYSIT-GGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISE 541          

HSP 6 Score: 108.997 bits (271), Expect = 4.283e-25
Identity = 123/495 (24.85%), Postives = 213/495 (43.03%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLSENHKK---FFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQ--FETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLK-SPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFI-KSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            +A D+DS  NG   Y +S +  +    F+L+ + G   L   S L+ E   +  +   + A D G      ++ + +T  D NDN P+F  + Y  ++ EN      +LQV A D DEG N  ISY    +     N  FS++  TG I  L  LD+E+  ++     I A D G+   + +  + +   +  DN P  +  + N ++ EN    T +  +Y    D  +  +     S D   L         I +    D E  + + + +      + P++   ++ I ++D NDN P F+ +  I  I     V + ++  +A DLD+G  G + Y+L         IN ++G I L   L    +      V A+D G       ++I +    ++PP+   S  +  VL ++P+      V   D D G+N ++     +  E  LF  +      K++I KSL+   K S   + ++  D G P  ++
Sbjct:  553 SATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGV--LWTKSQLDRET--KSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPG-KLLQVTATDADEGTNAVISYD---IIGGNNNGNFSIDSSTGVISTLASLDHEV--EEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDK-NGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIF---PGGKLYIRKSLLQALKGSYDLI-VRATDGGVPSFSA 1032          

HSP 7 Score: 25.409 bits (54), Expect = 4.283e-25
Identity = 19/82 (23.17%), Postives = 35/82 (42.68%), Query Frame = 3
Query:  306 FKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQKI 551
            F+SG + T K +DR+    +   ++  ++D           + S     +  +   IID NDN P+F +  +   + E   I
Sbjct:  477 FQSGLVTTAKPLDREQVSSVT--ITITAQD-----------HGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASI 545          

HSP 8 Score: 109.383 bits (272), Expect = 4.476e-24
Identity = 113/455 (24.84%), Postives = 193/455 (42.42%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSL--SENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECF--------------DSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMD---INDNPP-------------RLKSPKILTVLENEPIGTLIGNVEVF 1837
            A D D   N  + YSL       KFF   I     EL +   L+ E  +     ++ T       + T  + IT  D ND +P+F +  Y   + E+      ++ + A D D G+NG I Y   +++   +   F +   TG + + + LD+E  + QL E TI A D G   LS +  + ++  D+NDN+P        +++ EN     P+      D D+         N++  F ++S Q  S T +   +   E ++I  ID+E                D G P ++T KS+ + + DENDN P F         +  S +N  +   +A D D  + GK+TY +    N  F ++ STG + + + +  +   + +  + A+DGG      +  ++V     I   P              ++    ++TVL   P  +L GN+E +
Sbjct: 1183 AMDADEGDNAKFFYSLVSGTGMDKFF---INSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKY---SISNGNLAAMFDVESATGRLIVAKSLDFE--TTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDT-------GTNAHIAFSMYS-QTPSKT-FSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPP---AAAAGSSLN--VMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQI-PDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYY 1614          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 177.178 bits (448), Expect = 8.903e-46
Identity = 145/501 (28.94%), Postives = 234/501 (46.71%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSL-SENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVK-CNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPK-ILTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R+   TA D D   NG   Y++ S N    FQL    G   L + S L+ E +    + L + A D G   Q  T S+ ++ +D NDN P F   L+   ++E+ +    +LQV+ +D DEG NG I+         E +D F+++  TG +     LDYE  +    + T+ A D GSP  S + +++I   ++NDN P  +   +  SIPE+  I T ++ +   D D           N+  +F++  S   S  I + +  D E ++ + + +   ++G    + Y +  I ++D NDN P+F    +   + E+  + + + + +ATD D G   K+TY L      +F +N +TG +     LDRE +      V A D G     A   +++T+ D+NDN P+    K  LTV EN   G+ I  V   D D G N RVT  I +    NA     +     +I +  ++DRE ++   L +   D G P   S
Sbjct:  807 RVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGI--LSVRSTLDRETI--PSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLS----GEGSDNFTIDS-TGFVLSKTPLDYETTA--AYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQS---SGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAF---RIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVS 1290          

HSP 2 Score: 26.5646 bits (57), Expect = 8.903e-46
Identity = 12/24 (50.00%), Postives = 15/24 (62.50%), Query Frame = 3
Query:  462 INFEIIDENDNPPKFN-QFKFNIN 530
            +N  I DENDN P F    +FNI+
Sbjct:  776 VNISIADENDNQPTFTGPSRFNIS 799          

HSP 3 Score: 173.326 bits (438), Expect = 1.211e-43
Identity = 152/505 (30.10%), Postives = 235/505 (46.53%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI--DRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHN---KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKIL-TVLENEPIGTLIGNVEVFDLDDGENARVT---IENEVQENALFYSYLKLDN--NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            R+++ TA D D   N    YS+       F ++   G   L +   +N E V    + L + A DRG    T    +T +  D NDN P+F    Y  +V+EN+  +  +L V A D D G N  + Y   +   ++   +F +N  +G I     LD+E  S   +E T  A D    + +    + I   ++ND +P         S+ EN   +T ++ +   D DS  +    +   K+S D F +    + S  I      D E  S++ I +   D+G PP++    + I I+DENDN P F  + +   I E+S  + F F+ +ATD D G   +ITY L  + N  F+I  S+G I L   LDRE K   +  + A D G     +S+ + +TV+DIND+ P + S  +  +V EN+P  T +  +   D D G NA +T   + NE        S   LDN    I  K  +DRE+ +   LR+ + D G P L+S
Sbjct: 1326 RVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGV--LTVKKEINRETV--PTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEK---RFKINSTSGVIMTTTPLDFEEKSQYGLEVT--ATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDS-DKFSI---DQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNL--SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNE------HKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSS 1806          

HSP 4 Score: 171.014 bits (432), Expect = 6.029e-43
Identity = 142/497 (28.57%), Postives = 228/497 (45.88%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFET--MSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDDSVHNKVKC----NKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNK-EFVINISTGYIYLYNSLDREVKEMLEFFVYATD--GGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSW 2029
            TA DLD  IN   +YSL      +F +  +      +I +   F+   +  + + L A D G    +   ++ I  +D NDN+P+F+   Y  +V E+      ++ V A D D G N  + Y F   T    N  F+L+ +TG + + + LD+E  S   +  ++   D GSP L+ +  + I+  DINDN P        S + EN    T + +    D DS  N          N +  F +  S   +  I + ++ DYEN + + + ++  D G+P       + I I D ND+ P+F+ + +  QI E + +   +   +ATDLDSG  G++ YRL     K  F I+ ++G I + + LDRE        V A D       +S +V+I + DINDN P  + P +  V E+   G  IG V   D DD  N  V     + +N   +S +      I +K+ +D EK +Q  + +   D G P  +S 
Sbjct:  191 TAVDLDVGINARLSYSLVSGDTSYFTVDSQG-----VIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSF---TSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSV--TDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVSAT---DRDSSTNGALVFGIIKGNDDGVFTIDGS---TGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDV--RYALSDNTDVFS-INTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSL 668          

HSP 5 Score: 159.844 bits (403), Expect = 1.766e-39
Identity = 141/493 (28.60%), Postives = 231/493 (46.86%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSL-SENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNSN-DNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYR-LDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLE--ASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPK 2017
            +A D DSS NG   + +   N    F +    G   + I  + ++EN  + ++ L + A DRG   +++T  + I   D ND+ P+F+   Y K + E+T     ++ V A DLD G  G++ YR   L    +   F+++  +G I++  +LD E      ++  +EA D GS   S S ++ I   DINDNSP  +      + E+      I  +   D DDS +  V+   + N D F +++S   +  I ++   DYE  + + + +   D G P  ++   + + + D NDN P F ++ +   + E+      +   +ATD DSG  GKI+Y  L    N  F ++  TG I     LDRE        + A DG  +   A+  V+I++ D NDN P    P    + E+ P GT +G +   D D G N  VT  I +  Q N+     L   +  + ++S +DRE +    L +K  D G P+
Sbjct:  396 SATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGI--ISIAKSPDYEN--KTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYR---LISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQ--VEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTS---TGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSF---QLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQ 873          

HSP 6 Score: 149.828 bits (377), Expect = 1.946e-36
Identity = 119/408 (29.17%), Postives = 186/408 (45.59%), Query Frame = 2
Query:  677 LILSALNFENVNERKFHLQLTAFDRGGQFETM--SLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEIND--KFSLNKLTGEIKLLQKLDYEIYSDQL-IEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHN-KVK---CNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPK-ILTVLENEPIGTLIGNVEVFDLDDGENA 1861
            LI  A   +      + L + A + G Q E++  +  I  +D NDN P+F    Y K++ EN      + +V A D DEGEN K++Y         + D  KF +N  TG +   + LD E   DQ      + A+D G P  S    I +   D+NDNSP+    K  +++ EN    + I+ +   D D+  N +V     + N  + FR+ S+      I +    D E  + + + I   DSG+PP  +   + I + DENDN PIF   +  Y I E   +   +   +ATD D G+  ++ Y +       F IN   G + +   ++RE        + A+D G   + +  ++++ V D+NDNPP   S   I +V EN    T +  V   D D G NA
Sbjct: 1050 LISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYEL------SVGDTSKFEVNPATGLVTTKRPLDRE---DQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGR---ITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANA 1445          

HSP 7 Score: 145.206 bits (365), Expect = 2.340e-36
Identity = 156/589 (26.49%), Postives = 264/589 (44.82%), Query Frame = 2
Query:  578 DLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNV-SIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRL--DDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLD---------NNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV---NTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYST 2281
            D D   NG    SLS      F +    G+  +L  + L++E      + L +TA D G   +  T  + IT I+ NDN P F       ++ E+      ++++ A D D          FD +        F +++ +G I + ++LD E  ++  +   + A + GS   S      I   D+NDN+P         S+ EN  I   +  +   D D   N KV    +  D  +   +    L +  +R  D E+ + + + +   D G P  +   ++ + I D NDN P F+++++   ++E++     + +  A+D D+G  G++TY +   + GN  F I+ +TG I +   +DRE        + A D G     ++  V+ITV D NDN P   S +    + E   IG+ +  V   D D+G NA+V           FYS ++ D         N  + +K  I+RE V    L ++  D G P +TS + +T+ + D+N      + P    V NS+S I     N+  ++ +LT+ A DSD   N  +R+ I+   N  + F++N TSG I +T
Sbjct:  920 DKDEGSNGAITLSLSGEGSDNFTID-STGF--VLSKTPLDYETT--AAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD-----GTPLTFD-IVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTL--VVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGL-VTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNA-FRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQV-----------FYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVN------DNPP---VFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSII-SGNDEKRFKINSTSGVIMTT 1472          

HSP 8 Score: 26.9498 bits (58), Expect = 2.340e-36
Identity = 10/39 (25.64%), Postives = 22/39 (56.41%), Query Frame = 3
Query:  435 STKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQKI 551
            S + ++   I+  ++D NDN P+F +  F+  + E+  +
Sbjct:  871 SPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASV 909          

HSP 9 Score: 144.436 bits (363), Expect = 7.132e-36
Identity = 164/588 (27.89%), Postives = 275/588 (46.77%), Query Frame = 2
Query:  542 TKNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK----VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE--FVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEA--SVKVSITVMDINDNPPRLKSPKILT--VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            T   ++++ TA D DS  N    YSL     KF  ++ + G  E+  ++ L+ E   +  + ++++AFD  G+  T    IT  D NDN P F   +Y+  V E+      + Q+ A DLD G N ++SY   +L   + +  F+++   G I+     D E  +    +  + A D GSP  SG   +EI   D+NDN P     +   S+ E+  I   ++++   D D+ +N        + N+N  F L +    +  + + R+ D+E  S + + +   D G PP+     L I + D NDN P+F+ + +  ++ E++       Q SATD DS   G + + +   GN +  F I+ STG I +  S D E K   +  V A D G      + +V+I + D+ND+ P   SP   +  + E+  IG+ +  V   DLD G   R+     +  N      +  ++  I + S +DRE      L+++  D G    +S   +TI++ DINDN PI + P    V  S S  +        I  + A D+D   NG +R+ + D+ +    F +N ++G I
Sbjct:   83 TPAAQVAIVTATDRDSGTNAAITYSLFSGENKFM-MNSKTG--EIRTVTPLDHET--KDSYTMRISAFD--GKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSY---SLVSGDTS-YFTVDS-QGVIRTKGAFDRETKAS--YQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAV---TGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGI-IKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF-SPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYR-LISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQ-------IGQVAATDADDSSNGDVRYALSDNTD---VFSINTSTGLI 637          

HSP 10 Score: 26.1794 bits (56), Expect = 7.132e-36
Identity = 11/21 (52.38%), Postives = 15/21 (71.43%), Query Frame = 3
Query:  471 EIIDENDNPPKF--NQFKFNI 527
            ++ DENDN P+F  N + FNI
Sbjct:   59 DVKDENDNAPEFPLNSYVFNI 79          

HSP 11 Score: 113.62 bits (283), Expect = 2.264e-25
Identity = 147/577 (25.48%), Postives = 242/577 (41.94%), Query Frame = 2
Query:  617 LSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFET--MSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQ---AKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNSNDN--FRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG-NKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKILT--VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIF----------IKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEY-PSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            +  N +  F +    G    +  +   F+  +E ++ L + A D   +       + I   D NDN P F    Y   ++ENT    P  QV    A D D G N  I+Y   +L   E  +KF +N  TGEI+ +  LD+E      +   I A D           ++    D+NDN+P   + +    + E+  + + +  +   D D  ++ ++  +  S D   F + S       I  +  FD E  + +Q+ +   D G P  +   ++ I I+D NDN P+F+ AQ+   + ED  +   +   +A+D D+GN   + Y       N  F ++  TG + +  SLD E +      +  TD G   L  +  + I V DINDNPP   SP      V EN P GT    V   D D   N            AL +  +K +++ +F          I    D E  ++  L ++  D G P    ++T  ++I   + ND    + PS     N    I  +T   S ++T+ A D D    G++ +R++   N    F ++  SG+I
Sbjct:    4 MDGNDQGMFTIDSSTGS---ITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENT----PAAQVAIVTATDRDSGTNAAITY---SLFSGE--NKFMMNSKTGEIRTVTPLDHETKDSYTMR--ISAFDGKHTTFVPLITVD----DVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQG----VIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVF-SPSAYQSRVKENTPAGT---QVSATDRDSSTNG-----------ALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVP--VKYDTAQVTIFIEDVNDHSPVFSPS-----NYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLI-SGNVKGAFNIDANSGSI 535          

HSP 12 Score: 94.3597 bits (233), Expect = 1.902e-19
Identity = 76/259 (29.34%), Postives = 123/259 (47.49%), Query Frame = 2
Query:  776 LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI--EILKNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLD 1543
            + I  +D NDN P F    Y  ++ EN+  +    ++ A D DEG N +I+Y          ND F +   +G I L Q LD E  S    +  I+A D G+P  + S  I +   DIND+ P I    L+  S+ EN+   T +M I   D D+  N ++  +  SN++  + +    +  I  +   D E  +++ + I   D G P +++   + I +IDE+DN P F   ++   ISE       + Q +A D+D
Sbjct: 1603 VTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSR------NDAFMIGASSGVITLAQPLDRENKS--TYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRG-SVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 173.711 bits (439), Expect = 1.682e-44
Identity = 147/515 (28.54%), Postives = 234/515 (45.44%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLS--ENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI---DRNDNKPIFTDILYRKTVKENTTYTIPIL---QVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLL----QKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYVHDDDSVHNK---VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILT-VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKL------DNNKIFIKSLIDREKVS-----QIFLRLKLVDHGRPKLTSW 2029
            TA D DS  N    YS++  ++H  F  ++    +  + +   L+ E VN+  ++L +TA D G      ++ I  +   DRNDN P F+   Y  +++EN+   +P+     + A D D   N  + YR +       + +F++N  TG I         LD+E  ++    F + A D+         ++ IH  D NDN+PR I      +I E   I   +  +  +D DS  N       N  S   F +  S      + +  + D E  +++ +++   D    P   Y ++ + + D NDN P FT+      +SE   V   +   +ATD D G+   ITY +   G   F IN +TG + +   LDRE K+   F V+A DGGGLE++V V++ + D NDN P+  + +  T V++  P+GT++  V   D D G N  VT           Y+ L L      D   I   S +DRE+ S        L L + DHG  + TS+
Sbjct:  137 TATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDRE-VNDF-YNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLN----GSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYT--FHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDG---VVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPG---FAINSNTGSVTITRPLDRETKQAYSFTVHARDGGGLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVT-----------YAILILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSF 626          

HSP 2 Score: 137.117 bits (344), Expect = 7.513e-33
Identity = 137/542 (25.28%), Postives = 240/542 (44.28%), Query Frame = 2
Query:  689 ALNFENVNERKFHLQLTAFDRGGQFETMS-LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYA-----TDGGGLEAS--VKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSR----SLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            +L+ E      FH+ + A   G   E+++ + I  +D NDN P F     + T+ E  +    + +V A D D G NG+I +  ++ +      KF + +  G +++   LD E  +  +    + A+D       G   + +   D+NDN+P+  +   NV + E   + + I++    D D   N       S   F ++S   N+ ++ + R  D E    +   +   D G   + +  ++ + I DENDN P F   Q+   + + + V   +   +A D D GN G +TY +       F+I   TG I   + LDRE + +     Y      TD G  + +    ++I+V D NDN P+  +S    TVLEN P+GT +  V   D D G N+++ + +    + +F   ++    +I ++  I+RE      + +   D G P L+S         D   +  +L+      V  SR    ++   N     F++ + A D+D + NG + + IM    G   F +NET+G I
Sbjct:  291 SLDHERTTNYTFHV-IAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGS----EGKFEIGRSDGVVRVSGSLDRE--AKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPGFAINS---NTGSVTITRPLDRETKQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILIL---PFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQI-MYSLTGGDGVFS--IEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSS---------DAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALG--MFTINETTGVI 803          

HSP 3 Score: 134.035 bits (336), Expect = 5.864e-32
Identity = 134/499 (26.85%), Postives = 219/499 (43.89%), Query Frame = 2
Query:  542 TKNYRMSLPTAYDLDSSINGVYNYSLSENH------KKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG-GQFE-TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKF-SLNKLT--GEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIE-IHSTDINDNSPRIEILK-NVSIPENKRIATPIM---SIYVHDDDSVHNK-VKCNKNSNDNFRLHSSQENSLT---IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDG--GGLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNN--KIFIKSLIDRE 1963
            T+   ++   A D D   NG  +YS+ + +         F L    G    +I +A N E      ++L + A D G   F  T  + I   D NDN P+F    Y  TV EN+     +L V A D D G+N  ++Y   ++T  + +  F ++ K++  G I++   LD E+  +     TI A D G P    +  I  +   D NDN P+    +   SI EN     P+    SI   D D   N  V+   N +D+ +   +    +    +    + D+E ++ +   +   D       +   + I ++D NDN P F  +     ISE + + + + + +A D DSG  G+I + ++     +F I  S G + +  SLDRE K +    V A DG     E    V++T+ D+NDN P+   P   + V E   +G++I N    D D G NA +T        ++ Y    +++N   + I   +DRE
Sbjct:   18 TRGVLIATVKATDSDDGANGDVDYSIVDGNVGDPRSNSDFTLDPNTG----MIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTY---SVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREV--NDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITY-------SMSYPGFAINSNTGSVTITRPLDRE 500          

HSP 4 Score: 126.331 bits (316), Expect = 3.651e-31
Identity = 107/405 (26.42%), Postives = 181/405 (44.69%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYE---IYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDS-VHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISE-DSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEAS--VKVSITVMDINDNPP 1759
            TA D D   N    YS+S     +   +I      + I   L+ E   ++ +   + A D GG    +++ +   D NDN P F  + Y+  V + T     +L V A+D D G NG ++Y    L        F +   TG I    KLD E   +Y+       +   D G  Q +    + I  TD NDN P+    + + ++ EN  + T +  +   D+DS +++++  +    D   + S + ++  I +++  + E    + + I   D G P +++   + + ++D NDN P+FT   +   +SE ++   EF+ Q +ATD D    G +TY +       F IN +TG I     L+RE K+     V A D G +       + + V+D NDN P
Sbjct:  461 TATDPDQGSNAAITYSMS-----YPGFAINSNTGSVTITRPLDRET--KQAYSFTVHARDGGGLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILIL-------PFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDG--VFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTP 849          

HSP 5 Score: 28.4906 bits (62), Expect = 3.651e-31
Identity = 18/64 (28.12%), Postives = 28/64 (43.75%), Query Frame = 3
Query:  348 DNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            D    + G L   +K +     +AI    S +      +   + D NDN PKF +  FN++V E
Sbjct:  387 DGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYG-TVTVTLQDVNDNTPKFTKPAFNVDVSE 449          

HSP 6 Score: 83.9593 bits (206), Expect = 2.325e-16
Identity = 68/249 (27.31%), Postives = 112/249 (44.98%), Query Frame = 2
Query:  722 FHLQLTAFDRG-GQFETMSLF-ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI--EILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPI 1456
            + L L+  D G  QF + +L  I+  D NDN+P F    Y  TV EN      +  V A+D D G N +I Y   +LT  +    FS+   TG+I+L + ++ E  + +    TI A D G+P LS   K+ +H  D+NDN P     + +      N      ++ +   D D   N        +    + +  E +  I  +   + E+   + + +   D G  P   + ++ + +ID+NDN PI
Sbjct:  609 YVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMY---SLTGGD--GVFSIEPSTGQIRLQKAINRE--AKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTPI 850          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 162.925 bits (411), Expect = 4.534e-41
Identity = 172/588 (29.25%), Postives = 275/588 (46.77%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIE--AVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQ----ENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLD-SGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG---LEASVKVSITVMDINDN-PPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSL--IDREKVSQIFLRLKLVDHGRPKL-TSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYST 2281
            + +D DS + G  ++SL  N    F L    G   L  L  +++ N + R + L + A D G   +  T  L +  +D ND  P+F +  Y   V E T     I++V A D+D GENG+ISY FD+        KF L +  G+I +  KLD E     + E+ ++  A+D G+P+ S S  +++   D+NDN+P  +       + EN+ +AT + ++   D D        N +    F    +Q    + +  I   +  D E  + +   I   D G  P      + + + D ND  P F++ ++   ++ED  V   L    ATD D  G    ITY +  AG K F +N  TG + L + LDREV       V A+D GG   LE    + I V+D+NDN P  +      TV E  PIG+++  V   D D G+N +V  +     N       K++     I +L  +D E  ++  LR+   D G+ +  TS++ +TI + D NDN P  +   +  ++   + IY N   N+ + T+ A D D   N +I + I D  +   +F++N  +G I +T
Sbjct:  830 SVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKL--IDYGN-SARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTS---KFGL-RNGGKIFIKSKLDRE----DIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDE-----GSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMI-VAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYK---IVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFD---KNPII---TWIYENVPINTNVTTIKAHDDDSGLNSRIWYTI-DSQSPRAHFKINSETGLIQTT 1390          

HSP 2 Score: 25.0238 bits (53), Expect = 4.534e-41
Identity = 12/41 (29.27%), Postives = 20/41 (48.78%), Query Frame = 3
Query:  432 QSTKPAVNF-QINFEIIDENDNPPKFNQFKFNINVLEEQKI 551
            + T P   +  +   +ID NDN P+FN     + + E+  I
Sbjct:  782 KGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPI 822          

HSP 3 Score: 150.984 bits (380), Expect = 9.857e-37
Identity = 160/612 (26.14%), Postives = 261/612 (42.65%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSL-SENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIF------------------TDILYRKTVKEN---------TTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVS-IPENKRIATPIMSIYVHDDDS--VHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNK-EFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPP--RLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVT---IENEVQENAL---FYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            TA D+DS  NG   YS+ + N    F +    G  E+     L+ E      F L +   D G   +     + +   D NDN P+F                  T ++   T KE+         +T  I IL+V A D D G N +I Y F      +I+  + ++  TG I   + +D  I  D  I+  ++A+D+G P       + I    I    P+ E+      +PEN  + T ++++ V D+ +     ++  N  +++ FR+    + S  I + +  DYE      + +   D   P       ++I + D ND  P+F ++ ++ Q SE   V   +   SA D DSG  G++ + +    +K  F I+  TG I    +LD E  +     V ATD G   +   V V+I V+D+NDNPP  R+  P  + VLEN P+ + +  +   D D G NAR++   I    Q   L   F  +L  +     I    +   V Q  L +K  D G P L+S      +I  I +     EY    + M+ +  +  N +   F+  + A D D  + G++ F   +    S   ++N T+G I
Sbjct: 2092 TATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTG--EITTAKLLDRETT--ASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQID--YKIDADTGVISARRTIDVRI-RDSFIQIPVQAMDQGVPPQRALVYVRI----IITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIG---QRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTN-----ITFDYENTAVYQYSLTIKATDAGNPPLSS------NITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPT--SNALKMNATTGII 2676          

HSP 4 Score: 144.821 bits (364), Expect = 1.480e-36
Identity = 162/635 (25.51%), Postives = 286/635 (45.04%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNK---VKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLD-REVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKILT-VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFR--------IMDDCNG----SRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIRE 2413
            A D D   N +  YS+   +  FF L   KG    L+ ++   ++  +  +  Q+ A D GG+    ++ ++  D NDN+P+F    Y     ENT     I Q++A D D  +     +  +     E+   FS++  +G I L + LD E   + L+  T++AVD G         + I   D+ND  P     + N +I E+ +  + I  ++    D   N       +K + DN  L +S   + T+Y++   D+E      + ++  D G PP+  Y ++ IA+ID NDN P F  +  + ++ ED+ +    +  S  D DSG  G++++ L       F ++ +TG + L   +D           V A DGG     ++  + + V+D+ND  P   +      VLE  P  + I  V   D+D GEN R++   + + +    S   L N  KIFIKS +DRE + +  L++  +DHG P+ +S   + + + D+NDN+P  +  S          +  N    +++  + A DSD   NG + +R        I+D   G    S+       +  ++S  +   G   S P     +V + ++D +    + +K+ + +T+ E
Sbjct:  522 AQDPDIGENSLILYSILTPNTPFF-LDPRKG----LVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEV---FSVDG-SGLITLAKLLDRETQDNYLL--TVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINS---TGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDT---SKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYA------FFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGG---SSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNE 1130          

HSP 5 Score: 27.7202 bits (60), Expect = 1.480e-36
Identity = 11/29 (37.93%), Postives = 16/29 (55.17%), Query Frame = 3
Query:  453 NFQINFEIIDENDNPPKFNQFKFNINVLE 539
            N  +   + D NDN P FNQ  +N ++ E
Sbjct:  481 NCSVIVNLTDSNDNDPYFNQSSYNASLFE 509          

HSP 6 Score: 142.51 bits (358), Expect = 3.685e-34
Identity = 140/468 (29.91%), Postives = 215/468 (45.94%), Query Frame = 2
Query:  545 KNYRMSLPTAYDLDSSINGVYNYSL-SENHKKFFQLSIEKG-----YPELLI-LSALNFENVNERKFHLQLTAFDRG--GQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLT-PQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSP-QLSGSCKIEIHSTDINDNSPRIEILKNVS----IPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNF---RLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE-----FVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARV 1867
            K++R  L  A D D   N   +Y++ S N    F+L  ++      Y +L++  S++  +      + L ++A D G       + L IT  D NDNKP F+++ Y  T+ EN      ILQV A D D G N +I Y  +T + PQ I   F ++  TG I    +LDYE     LI   ++A D+GS  QLS S  + I   D+NDN+P I +   +     + EN  I T +  + V D DS  N +V       D +   +     + S+ I + ++ D E      +   C D G PP  T KS  I + D ND  P F R  +  ++ E++ VN  +   +A D D G+  ++ Y + +          F I+ S+G I     LDRE    +   V   D G   L  +  V + + D NDN P   +S    ++ EN P G+ +  +   D D GEN+ +
Sbjct:   73 KDFRQKL-IAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAI---FGIHPTTGVIVNNVRLDYEAKRSYLI--VVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESI-IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLI 533          

HSP 7 Score: 134.42 bits (337), Expect = 5.279e-34
Identity = 122/446 (27.35%), Postives = 200/446 (44.84%), Query Frame = 2
Query:  569 TAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTI---DRNDNKPIFTDILYRKTVKENTTYTIPILQVQA--KDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI--EILKNVSIPENKRIATPIMSIYVH---DDDSVHNKVKCNKNSN---DNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKV--NEFLFQCSATDLDSGNFGKITYRL---DDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASV--KVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLD 1846
            TA D DS  NG   Y+LS +    + +    G    ++ SA  FE   +++++    A D+G Q   M++    I   D+N++ P FT   Y   +  NT+ +  +  V A   D D+  NGK++YR D    +     F +   TG ++              +    E  D GSP L G   ++I   +I D+ PR   +    VSIPEN ++ + I ++      D    ++ +  NK      D F         +++      DYE++   ++ +     G   +  Y  L I +ID NDN P F  +  + Q++ED+      F+ + +ATD+DSG  GK+TY +   ++AG   F I+ +TG I     LDRE     +  +  TD G    S   +V + V D+NDNPP       + + E+   G ++ +V   D D
Sbjct: 1773 TASDKDSGSNGNIVYTLSNDTYGVYSIDSRTG----IVYSAARFETSIKQEYNFFCIAKDQG-QDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDD--SKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAE--DHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPF------TGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAG--VFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTD 2201          

HSP 8 Score: 29.6462 bits (65), Expect = 5.279e-34
Identity = 23/76 (30.26%), Postives = 34/76 (44.74%), Query Frame = 3
Query:  312 SGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            +G++ TT  +DR+ +      LS  +KDI      A  N           I   I D+NDNPP F Q  ++  + E
Sbjct: 1699 TGELSTTTKLDRETKASY--QLSVQAKDITPPYYTAFAN-----------ITIFIEDQNDNPPVFQQSLYSSTISE 1761          

HSP 9 Score: 140.198 bits (352), Expect = 2.216e-33
Identity = 151/600 (25.17%), Postives = 251/600 (41.83%), Query Frame = 2
Query:  617 LSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIP--ILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDD-----------------SVHNKVKCNKNSNDNFRLHSS-------------QENSLTIYMERTFDYE-NSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSG-NFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVS--ITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQF 2305
            +S N  + F +    G   +    AL++E+    + HL  T          M L I  IDRNDN P F        + E+T    P  +++V A D+D G NGK++Y   T     +   F+++  TGEI   + LD E  +    +  I   D G P  S +C++++  TD+NDN P  + L  V+I E+ R    + S+   D D                 ++      +++S  N ++  S               ++  I   RT D     S  QI ++  D G+PP      + I I  E    P F    +  ++ E++ +   +     TD  +G   G+I+Y ++++    F I   +G I +   LD E K      V A D       V+V   I V D+ND  P   +S  +    E  P+GT++ NV   D D G N RV    +  ++   ++ +      I  +  +D E +    + ++  D G P + +  ++TI ++D+NDN P+   P   DV      +  N   NS +  + A D D   N ++ F ++    G   F +++ SG     W   N  F
Sbjct: 2000 ISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV---FTIDSTTGEITTAKLLDRETTAS--FDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENS--NYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFA-IDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQ-----VLENLPLNSRLYEINATDRDSGANARLSFTVIGGT-GQGLFLIDKFSG-----WLTTNITF 2576          

HSP 10 Score: 140.198 bits (352), Expect = 2.235e-33
Identity = 153/562 (27.22%), Postives = 247/562 (43.95%), Query Frame = 2
Query:  602 VYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQ--FETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHS--TDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDS----VHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKILTVL-ENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNN--KIFIKSLIDREKVSQIF-LRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRY 2242
            + N + S ++  +F +    G    +I +A + +     +  L +   DRG     +  S+ +   D NDN P F    Y  ++ EN+    P++Q+ A+D D GEN  I Y    LTP   N  F L+   G +   + LD+E+ S     F + A D G      SC   +H   TD+NDN P  +    +V   EN RI   I  +   D DS    +   +    N+++ F    S + S  I + +  D E    + + ++  D G         + I ++D ND  PIF++A++ + I E S+    +    A   D G   ++ Y +        V+  STG +YL + +D E    L   V A D G   L     V+I V+DINDN P+  S  IL  L E+ PIG     V VFD D G   RV+         LF     LD+N   + +  LID    ++ + L ++  D G P  +S   + + ++D+N      +Y       +  + +   T  +S I+ ++A D D  ENG+I +      + S++
Sbjct:  428 IANTTESRSYLHWFAIDPSSG----MITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSI--LTP---NTPFFLDPRKGLVTNSRTLDHEVQSS--YTFQVAATDGG----GRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVF----SVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLF----NLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVN------DYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKF 960          

HSP 11 Score: 128.642 bits (322), Expect = 7.635e-30
Identity = 169/569 (29.70%), Postives = 263/569 (46.22%), Query Frame = 2
Query:  635 KFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGG--QFETMSLF-ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCK-IEIHSTDINDNSPRIEILKNVSIP---ENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERT--FDYENSSIHQIDIECFDSGIPP---MATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVT--IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNS---FILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYST 2281
            K F L+   G   L ++S L+ E V  R   L + A D+GG    ET++   I  +D NDN P+F +    KTV E       +  V A D D+G+NGK+ Y+   +     +  F +N+ TG I  L+ LD+E+ +  ++   + A D G  Q   S + + I+  D NDN P  +  KN  I    EN  I T + +I  HDDDS  N        + + R H  + NS T  ++ T   D E  S + + +   D        +    +L I I D NDN P F  ++++  + ED   N  +   +A D D+G  G + YR+      +F +++ TG + L  SLD E        + ATD G   L +    ++ V+D+NDNPP   +   I TV EN+P GT +  V  +D D G NA +T  I + V+ +      +   +  I   S++DREK    FL +       P   S  ++ I+++D NDN P    P          ++ +    NS    I TL  +D D+  N K+ + IM   N    F +  ++G + +T
Sbjct: 1164 KAFSLNQVTGV--LTLVSPLDRE-VTHRHI-LHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYK---IVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLR--VSATDMGKKQQKTSYQLVTIYVEDANDNRPTFD--KNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAH-FKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFV-SRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKF---SIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISP----------VVTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIM-SGNTDGAFTIGRSTGELSTT 1705          

HSP 12 Score: 124.405 bits (311), Expect = 1.462e-28
Identity = 154/589 (26.15%), Postives = 267/589 (45.33%), Query Frame = 2
Query:  548 NYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQ-FETMSLFITTIDRNDNKPI-FTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEIN-DKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYVHDDDSVHN-KVK---CNKNSNDNFRL-HSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGE--NARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            N++++  TA D D+   G   Y +       F L ++ G   L ++ +L++E+V +  + L ++A D G     +  LF   +   ++ P  FT  L+  TV EN      +++V A D D G N +++Y      P  +  DKFS++K +G I     LD E      +  T+ A     P    S  + I+  D NDN P+ I  +  + +PEN   A  I ++ V D D  +N KV     + N++  F +  S+ E S T  ++R    E  + +Q+ ++  D   P    + ++ I I D+NDN P+F ++ +   ISE +     +   +A+D DSG+ G I Y L +     + I+  TG +Y     +  +K+   FF  A D G     A V V I + D N++ P+  K+P  + +  N     L+  V   D D  +  N +VT   +  +N+     ++ +   +   +        +  L +   DHG P L  +  + I I +I D     + P   +   +R  I  N++  S+I T+ AR S    + ++ + I+   N  R F V+  +G I
Sbjct: 1453 NFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGV--LKLIGSLDYEDVPQ--YTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSI----PSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFL--TVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSP-ARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDR----ETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQD-----DPPRFLNQTPARVSIPENSKVGSYITTVRARAS---SDAQVTYSII-SGNKGRAFYVDPFTGVI 2017          

HSP 13 Score: 101.293 bits (251), Expect = 1.567e-21
Identity = 123/461 (26.68%), Postives = 195/461 (42.30%), Query Frame = 2
Query: 1097 SCKIEIHSTDINDNSP---RIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVK----CNKNSNDNFRLHSSQENSLTIYMERTF-------DYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE--FVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG---LEASVKVSITVMDINDNPPRLKSPKILT----VLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKL-DNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRY---FQVNETSGAIYSTWSCRNGQFISCPIAGLY--RVNIELKDSSSTIVRSTKSH 2392
            S  + ++  D+NDNSP   R    K V    +K     ++++   D D   N  +     + N  + F+L S ++    +Y +          D E    + ++I   D G P    +  L I + D NDN P F+   +   I E+  V   + Q SA+D D G   +I Y ++   + +  F I+ +TG I     LD E K      V A D G    L +S  V I V+D+NDN P +     L     V EN  IGT +  V V D D G+N  V +  E  +      +  L D + I +   +DRE     FL+   +D G P  T+ ++  I++ D+ND  P        D     + ++ N   N+ +  + A D DF  N ++ + I +      Y   F ++ +SG I +       Q     +  L   R +  L D+ S IV  T S+
Sbjct:   41 SYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLIAV---DSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKF------DRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSN 492          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Nematostella
Match: EDO34814 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN96])

HSP 1 Score: 153.295 bits (386), Expect = 1.938e-40
Identity = 120/377 (31.83%), Postives = 187/377 (49.60%), Query Frame = 2
Query:  767 TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYVHDDD-SVHNKVK-CNKNSNDNFRLHSSQENSLTIYMERT--FDYENSSIHQIDIECFDSGIPPM-ATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGN--KEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLE--ASVKVSITVMDINDNPPRLK--SPKILTVLENEPIGTLIGNVEVFDLDDGENA 1861
            T  + IT  D NDN P F    Y  +V+E++T    ++QVQA D D+G  G+I +      P+ +   FS+   +G+I + + LD E+ +    E T+ A D      S S +++I  TD NDN P    I   + + E+    TP++++   D D  V+ +V+    +    F +     N++T  +      DYE+   + + I   D G P + +T   L I+++D NDN P FT+A +   +SE++     +   +AT+ DSG   KITY +  AG+    F IN  TG +     LDRE ++     V ATD G         V I V DINDN P+ +  +P  +TV E+  +GT +G V+  D D G N 
Sbjct:    2 TARVNITISDINDNAPRFLKFTYSGSVREDSTVGTEVVQVQATDDDDGLAGEIVFAITGGDPEGL---FSILNTSGKITVARSLDREMKA--TYELTVTATDRAGDPKSTSVEVDITITDANDNKPVFTNIPATILLSESTIPGTPVITVVATDQDIGVNGQVRYVGDSPKGKFAV-----NAITGVVSTVGELDYEDVQRYTVYIVAIDQGEPQLNSTTLHLNISLVDANDNNPTFTKAAYTAHVSEEATAGTNVIMVNATERDSGKDSKITYNI-SAGDPLDHFAINHLTGLVTTAAKLDRESRDDYVITVQATDNGQTPRVGYTSVVIHVTDINDNAPKFQFPAPYKMTVNEDAALGTGVGRVKAIDGDQGLNG 367          

HSP 2 Score: 109.768 bits (273), Expect = 1.317e-25
Identity = 94/328 (28.66%), Postives = 152/328 (46.34%), Query Frame = 2
Query:  647 LSIEKGYPELL---------ILSALNFENVNERKFHLQLTAFDRGGQFETMSLF--ITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQL-SGSCKIEIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFT-RAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDA 1585
             +I  G PE L         I  A + +   +  + L +TA DR G  ++ S+   IT  D NDNKP+FT+I     + E+T    P++ V A D D G NG++ Y  D  +P+    KF++N +TG +  + +LDYE    Q     I A+D+G PQL S +  + I   D NDN+P   +      + E     T ++ +   + DS  + K+  N ++ D     +    +  +      D E+   + I ++  D+G  P   Y S+ I + D NDN P F   A +   ++ED+ +   + +  A D D G  G   Y +  A
Sbjct:   56 FAITGGDPEGLFSILNTSGKITVARSLDREMKATYELTVTATDRAGDPKSTSVEVDITITDANDNKPVFTNIPATILLSESTIPGTPVITVVATDQDIGVNGQVRYVGD--SPK---GKFAVNAITGVVSTVGELDYEDV--QRYTVYIVAIDQGEPQLNSTTLHLNISLVDANDNNPTFTKAAYTAHVSEEATAGTNVIMVNATERDSGKDSKITYNISAGDPLDHFAINHLTGLVTTAAKLDRESRDDYVITVQATDNGQTPRVGYTSVVIHVTDINDNAPKFQFPAPYKMTVNEDAALGTGVGRVKAIDGDQGLNGMFEYAITHA 376          

HSP 3 Score: 87.8113 bits (216), Expect = 2.272e-18
Identity = 77/315 (24.44%), Postives = 146/315 (46.35%), Query Frame = 2
Query: 1097 SCKIEIHSTDINDNSPR-IEILKNVSIPENKRIATPIMSIYV-HDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLE---ASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGR-PKL 2020
            + ++ I  +DINDN+PR ++   + S+ E+  + T ++ +    DDD +  ++       D   L S    S  I + R+ D E  + +++ +   D    P +T   + I I D NDN P+FT       +SE +     +    ATD D G  G++ Y + D+   +F +N  TG +     LD E  +    ++ A D G  +    ++ ++I+++D NDN P   K+     V E    GT +  V   + D G+++++T  N    + L +  +      +   + +DRE      + ++  D+G+ P++
Sbjct:    2 TARVNITISDINDNAPRFLKFTYSGSVREDSTVGTEVVQVQATDDDDGLAGEIVFAITGGDPEGLFSILNTSGKITVARSLDREMKATYELTVTATDRAGDPKSTSVEVDITITDANDNKPVFTNIPATILLSESTIPGTPVITVVATDQDIGVNGQVRY-VGDSPKGKFAVNAITGVVSTVGELDYEDVQRYTVYIVAIDQGEPQLNSTTLHLNISLVDANDNNPTFTKAAYTAHVSEEATAGTNVIMVNATERDSGKDSKITY-NISAGDPLDHFAINHLTGLVTTAAKLDRESRDDYVITVQATDNGQTPRV 314          

HSP 4 Score: 78.1814 bits (191), Expect = 3.399e-15
Identity = 65/207 (31.40%), Postives = 98/207 (47.34%), Query Frame = 2
Query: 1421 IAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINI--STGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKS-PKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTS 2026
            I I D NDN P F +  +   + EDS V   + Q  ATD D G  G+I + +   G+ E + +I  ++G I +  SLDRE+K   E  V ATD  G     SV+V IT+ D NDN P   + P  + + E+   GT +  V   D D G N +V    +  +     + +      +     +D E V +  + +  +D G P+L S
Sbjct:    7 ITISDINDNAPRFLKFTYSGSVREDSTVGTEVVQVQATDDDDGLAGEIVFAIT-GGDPEGLFSILNTSGKITVARSLDREMKATYELTVTATDRAGDPKSTSVEVDITITDANDNKPVFTNIPATILLSESTIPGTPVITVVATDQDIGVNGQVRYVGDSPKGKFAVNAI---TGVVSTVGELDYEDVQRYTVYIVAIDQGEPQLNS 209          

HSP 5 Score: 56.6102 bits (135), Expect = 3.204e-8
Identity = 54/190 (28.42%), Postives = 87/190 (45.79%), Query Frame = 2
Query: 1709 ASVKVSITVMDINDNPPR-LKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDH-GRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            A+ +V+IT+ DINDN PR LK     +V E+  +GT +  V+  D DDG    +       +    +S L   + KI +   +DRE  +   L +   D  G PK TS E         ++       P+   ++ S S I       + ++T++A D D   NG++R+ + D   G   F VN  +G +
Sbjct:    1 ATARVNITISDINDNAPRFLKFTYSGSVREDSTVGTEVVQVQATDDDDGLAGEIVFAITGGDPEGLFSILNT-SGKITVARSLDREMKATYELTVTATDRAGDPKSTSVEVDITITDANDNKPVFTNIPAT--ILLSESTIP-----GTPVITVVATDQDIGVNGQVRY-VGDSPKGK--FAVNAITGVV 179          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Medaka
Match: pcdh17 (protocadherin 17 [Source:NCBI gene;Acc:101155999])

HSP 1 Score: 227.639 bits (579), Expect = 1.123e-60
Identity = 167/519 (32.18%), Postives = 264/519 (50.87%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIE-KG----YPELLILSALNFENVNERKFHLQLTAFDRGGQFE---TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEIL--KNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG------NKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKI------LTVLENEPIGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLID-REKVSQIF-LRLKLVDHGRPKLTS 2026
            R  L +A+D D+  NG+  Y ++ +    F L ++ +G    +PEL+I   L+ E   ER  H  + +   GG++    TM + +  ID NDN P+F    Y   + EN+T    ++ + A D DEG NG+I Y F    P+ I + FS++  TG IK+  ++DYE     +IE  ++A D G   + G CK+ +   D NDN P I  +  +  +I E     T I  + V D DS  N +++C    N  F+L  + +N  T+  ER  D E    + + I   D+GIPP+ + KS  + I+DENDN P FT++ +I QISE++   E+L    A D D G  G + Y + ++       N    +N + G IY   S + E  +  +F V A D G   LE++  V I+V D+NDN P +  P +      + V  N  +G ++  V   D D GE+ R+T E ++  E  LF    ++D     +++     E VS +  L +++ DHG+P LT+
Sbjct:  146 RFPLTSAHDPDAGENGLKTYQITRDDYNLFSLEVKSRGDGTKFPELVIQRPLDRE---ERSHHTLILSATDGGEYPRSGTMQINVKVIDSNDNSPVFDPPSYVVEIPENSTPGKVLIDLNATDPDEGNNGQIVYSFSGYAPERIRELFSIDSRTGVIKIQGEIDYE--ESPVIEIDVQAKDLGPNPIPGHCKVTVKVLDRNDNWPSIGFVSVRQGAISEAAPPGTVIALVRVTDKDSGRNGQLQCRVLGNVPFKLEENYDNFYTVVTERPLDREMQDEYNVTIVAKDNGIPPLNSTKSFTVKILDENDNVPRFTKSVYILQISENNIPGEYLGSVLAHDPDLGQNGTVYYSIVNSNVSGGDVNTYVNVNAANGAIYAVRSFNYEQIKYFDFKVLAKDAGSPHLESNATVRISVQDVNDNIPVIVLPLLQNDTAEIHVPRNVGVGYIVTTVRAVDNDYGESGRLTYEISDGNEEHLF----EIDPVTGEVRTAHSFWEDVSPVVELIIRVSDHGKPTLTA 655          

HSP 2 Score: 122.865 bits (307), Expect = 7.643e-28
Identity = 117/423 (27.66%), Postives = 187/423 (44.21%), Query Frame = 2
Query: 1100 CKIEIHSTDINDNSPRIEILK-NVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLT-------IYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKE----FVINISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLK--SPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDN-NKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGD-VMNSRSLIYV-----NTQFNSFILTLLARDSDFDENGKIRFRIMD-DCNGS---RYFQVNETSGAIYSTWS 2287
            C I+I   DINDNSP     + ++ I EN    T       HD D+  N +K  + + D++ L S +  S         + ++R  D E  S H + +   D G  P +    + + +ID NDN P+F    ++ +I E+S   + L   +ATD D GN G+I Y       +     F I+  TG I +   +D E   ++E  V A D G   +    KV++ V+D NDN P +   S +   + E  P GT+I  V V D D G N +  ++  V  N  F      DN   +  +  +DRE   +  + +   D+G P L S +               ++   E D V      +Y+     N     ++ ++LA D D  +NG + + I++ + +G     Y  VN  +GAIY+  S
Sbjct:  112 CMIKIDIQDINDNSPVFPSDQIDIDISENAVPGTRFPLTSAHDPDAGENGLKTYQITRDDYNLFSLEVKSRGDGTKFPELVIQRPLDREERSHHTLILSATDGGEYPRSGTMQINVKVIDSNDNSPVFDPPSYVVEIPENSTPGKVLIDLNATDPDEGNNGQIVYSFSGYAPERIRELFSIDSRTGVIKIQGEIDYEESPVIEIDVQAKDLGPNPIPGHCKVTVKVLDRNDNWPSIGFVSVRQGAISEAAPPGTVIALVRVTDKDSGRNGQ--LQCRVLGNVPFKLEENYDNFYTVVTERPLDREMQDEYNVTIVAKDNGIPPLNSTK------------SFTVKILDENDNVPRFTKSVYILQISENNIPGEYLGSVLAHDPDLGQNGTVYYSIVNSNVSGGDVNTYVNVNAANGAIYAVRS 520          

HSP 3 Score: 115.546 bits (288), Expect = 1.316e-25
Identity = 147/554 (26.53%), Postives = 244/554 (44.04%), Query Frame = 2
Query:  692 LNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFD----TLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKN-VSIPENKRIATPIMSIYVHDDDSVHNK---VKCNKNSNDNFR-LHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFP-IFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLY---NSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARV--TIENEVQENALFYSYLKLD--NNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYV--NTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWS 2287
            ++ E + +R    QL+        E   + I   D NDN P+F        + EN           A D D GENG  +Y+       L   E+  +    K   E+ + + LD E  S   +   + A D G    SG+ +I +   D NDNSP  +     V IPEN      ++ +   D D  +N       +  + +  R L S    +  I ++   DYE S + +ID++  D G  P+  +  + + ++D NDN+P I   +     ISE +     +     TD DSG  G++  R+   GN  F +  +    Y       LDRE+++     + A D G   L ++   ++ ++D NDN PR  KS  IL + EN   G  +G+V   D D G+N  V  +I N         +Y+ ++  N  I+     + E++     ++   D G P L S  T+ IS+ D+NDN P++  P    + N  + I+V  N      + T+ A D+D+ E+G++ + I D  N    F+++  +G + +  S
Sbjct:   86 IDRETLCKRNPKCQLSMEVFANDKEICMIKIDIQDINDNSPVFPSDQIDIDISENAVPGTRFPLTSAHDPDAGENGLKTYQITRDDYNLFSLEVKSRGDGTKFP-ELVIQRPLDREERSHHTL--ILSATDGGEYPRSGTMQINVKVIDSNDNSPVFDPPSYVVEIPENSTPGKVLIDLNATDPDEGNNGQIVYSFSGYAPERIRELFSIDSRTGVIKIQGEIDYEESPVIEIDVQAKDLGPNPIPGHCKVTVKVLDRNDNWPSIGFVSVRQGAISEAAPPGTVIALVRVTDKDSGRNGQLQCRV--LGNVPFKLEENYDNFYTVVTERPLDREMQDEYNVTIVAKDNGIPPLNSTKSFTVKILDENDNVPRFTKSVYILQISENNIPGEYLGSVLAHDPDLGQNGTVYYSIVNSNVSGGDVNTYVNVNAANGAIYAVRSFNYEQIKYFDFKVLAKDAGSPHLESNATVRISVQDVNDNIPVIVLPL---LQNDTAEIHVPRNVGVGYIVTTVRAVDNDYGESGRLTYEISDG-NEEHLFEIDPVTGEVRTAHS 630          

HSP 4 Score: 60.4622 bits (145), Expect = 1.132e-8
Identity = 82/335 (24.48%), Postives = 142/335 (42.39%), Query Frame = 2
Query: 1421 IAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIST-------GYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSPK-ILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNK--IFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKS 2389
            I I D NDN P+F   Q    ISE++         SA D D+G  G  TY++       F + + +         + +   LDRE +      + ATDGG      ++++++ V+D NDN P    P  ++ + EN   G ++ ++   D D+G N ++                 +D+    I I+  ID E+   I + ++  D G   +     +T+ ++D ND      +PS G V   +  I       + I  +   D D   NG+++ R++    G+  F++ E     Y+  + R    +   +   Y V I  KD+    + STKS
Sbjct:  116 IDIQDINDNSPVFPSDQIDIDISENAVPGTRFPLTSAHDPDAGENGLKTYQITRDDYNLFSLEVKSRGDGTKFPELVIQRPLDREERSHHTLILSATDGGEYPRSGTMQINVKVIDSNDNSPVFDPPSYVVEIPENSTPGKVLIDLNATDPDEGNNGQIVYSFSGYAPERIRELFSIDSRTGVIKIQGEIDYEESPVIEIDVQAKDLGPNPIPGHCKVTVKVLDRND-----NWPSIGFVSVRQGAISEAAPPGTVIALVRVTDKDSGRNGQLQCRVL----GNVPFKLEENYDNFYTVVTERP---LDREMQDEYNVTIVAKDNGIPPLNSTKS 438          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Medaka
Match: ENSORLT00000045699.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 209.149 bits (531), Expect = 2.180e-60
Identity = 169/520 (32.50%), Postives = 268/520 (51.54%), Query Frame = 2
Query:  563 LPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYP------ELLILSALNFENVNERKFHLQLTAFDRGGQFE---TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIE--AVDEGSPQLSGSCKIEIHSTDINDNSPRIEIL-KNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG------NKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKILT---VLENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKI-FIKSLIDREKVSQIFLRLKLV--DHGRPKLTS 2026
            L TA DLDS IN V  Y L   +   F L+  +  P      E+++   L+ E   E +  L LTA D GG+ +   TM + +T +D NDN P+FT   Y+ TV EN+     +  V A D D G N +I+Y   T T   + + F ++K  GE+ L+  +DYE    + I F I   A D+G   L+ SCK+ +   DINDN P I I+ K+  IPEN +++T +  I+V D DS +N KV+C  N N  F L S+  N  ++  +   D E +S + I + C D G+P +++  +L + I D NDN P+F R+ +   I E++     +F   ATD D     +++Y L+D+       +    ++  +G I+   S D E  +   F V A DGG   L ++V V I + D NDNPP++  P       V E  P    +G L+  V   D+D G+NA ++ +  +  + ALF   +   N +I  ++ + +++ + Q   RL ++  D+G+P  ++
Sbjct:  164 LATAEDLDSDINAVQRYELKPTN--IFSLT-SQNSPDVNKNVEMVLQKPLDREK--EEQISLVLTAVD-GGEPQMSGTMMIVVTVLDANDNAPVFTQQTYKATVTENSPKGTVVAAVTASDADHGSNSRITYSI-TNTVGNVGEYFDIDKEKGEVILINNIDYE----KSISFQINIGATDDGG--LTNSCKLIVDIQDINDNEPEINIMSKSNIIPENAKLSTVVTMIHVEDLDSGNNGKVQCLMNENIPFLLKSTINNFYSLQTDSELDREKASGYNITVTCSDEGVPSLSSSVTLTLQISDVNDNAPVFERSSYEAYIVENNTPGVSIFTVKATDADWKQNARVSYILEDSSVNGVPVSSYVSVSADSGVIHAVRSFDYEQIKDFRFCVKAQDGGSPPLSSNVTVKIQIQDQNDNPPQVLYPVQTAGSVVAEMVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLQKATDRALF--EVGSQNGEIRTVRQVTEKDLLKQ---RLTVIVEDNGQPSRSA 665          

HSP 2 Score: 45.4394 bits (106), Expect = 2.180e-60
Identity = 42/170 (24.71%), Postives = 78/170 (45.88%), Query Frame = 3
Query:   36 SCHLKCQQISDYSKTKSEIQMVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFH--EFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            S +  C ++      ++  Q VL  V   +SLA  + +   ++  + + +PK + VGNI + L  ++      +I G +     +  E+ +L +   ++  K  +R +RE +C   + C+     FQ   IL      P  ++ +N +I D NDN P F + K N  + E
Sbjct:    4 SVYETCWKLRGNRSDRTMNQRVLLFVCL-VSLASVLGQ---VSYSIPEEMPKGSLVGNIAQDLGLEM----KRLISGKAKIYSRNSGEYVELNRERGVLLVK--ERIDREALCAETALCA---LHFQI--ILE----NPMEHYTVNIQITDINDNAPAFKKAKMNFKISE 154          

HSP 3 Score: 98.5969 bits (244), Expect = 2.145e-20
Identity = 150/580 (25.86%), Postives = 243/580 (41.90%), Query Frame = 2
Query:  620 SENHKKFFQLSIEKGYPELLILSALNFENVNER----KFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFD-----TLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHDDD---------SVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNS---LDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVT-IENEVQENA---LFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            S N  ++ +L+ E+G   LL+   ++ E +         H Q+   +     E  ++ I   D NDN P F        + E+       +   A+DLD   N    Y        +LT Q   D   +NK   E+ L + LD E   ++ I   + AVD G PQ+SG+  I +   D NDN+P   +     ++ EN    T + ++   D D         S+ N V    N  + F +   +   + I      DYE S   QI+I   D G   +     L + I D NDN P          I E++K++  +      DLDSGN GK+   +++  N  F++  +    Y   +   LDRE        V  +D G   L +SV +++ + D+NDN P   +S     ++EN   G  I  V+  D D  +NARV+ I  +   N      Y  +  D+  I      D E++      +K  D G P L+S  T+ I I D NDN P + YP +        ++  +      +  ++A D D  +N  + +++    + +  F+V   +G I
Sbjct:   78 SRNSGEYVELNRERGV--LLVKERIDREALCAETALCALHFQIILEN---PMEHYTVNIQITDINDNAPAFKKAKMNFKISESAIIGSKFVLATAEDLDSDINAVQRYELKPTNIFSLTSQNSPD---VNKNV-EMVLQKPLDRE--KEEQISLVLTAVDGGEPQMSGTMMIVVTVLDANDNAPVFTQQTYKATVTENSPKGTVVAAVTASDADHGSNSRITYSITNTV---GNVGEYFDIDKEKGEVILI---NNIDYEKSISFQINIGATDDG--GLTNSCKLIVDIQDINDNEPEINIMSKSNIIPENAKLSTVVTMIHVEDLDSGNNGKVQCLMNE--NIPFLLKSTINNFYSLQTDSELDREKASGYNITVTCSDEGVPSLSSSVTLTLQISDVNDNAPVFERSSYEAYIVENNTPGVSIFTVKATDADWKQNARVSYILEDSSVNGVPVSSYVSVSADSGVIHAVRSFDYEQIKDFRFCVKAQDGGSPPLSSNVTVKIQIQDQNDNPPQVLYPVQTAGSVVAEMVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLQKATDRA-LFEVGSQNGEI 635          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Medaka
Match: ENSORLT00000030657.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 208.764 bits (530), Expect = 2.310e-60
Identity = 169/520 (32.50%), Postives = 268/520 (51.54%), Query Frame = 2
Query:  563 LPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYP------ELLILSALNFENVNERKFHLQLTAFDRGGQFE---TMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIE--AVDEGSPQLSGSCKIEIHSTDINDNSPRIEIL-KNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG------NKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGG--LEASVKVSITVMDINDNPPRLKSPKILT---VLENEP----IGTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKI-FIKSLIDREKVSQIFLRLKLV--DHGRPKLTS 2026
            L TA DLDS IN V  Y L   +   F L+  +  P      E+++   L+ E   E +  L LTA D GG+ +   TM + +T +D NDN P+FT   Y+ TV EN+     +  V A D D G N +I+Y   T T   + + F ++K  GE+ L+  +DYE    + I F I   A D+G   L+ SCK+ +   DINDN P I I+ K+  IPEN +++T +  I+V D DS +N KV+C  N N  F L S+  N  ++  +   D E +S + I + C D G+P +++  +L + I D NDN P+F R+ +   I E++     +F   ATD D     +++Y L+D+       +    ++  +G I+   S D E  +   F V A DGG   L ++V V I + D NDNPP++  P       V E  P    +G L+  V   D+D G+NA ++ +  +  + ALF   +   N +I  ++ + +++ + Q   RL ++  D+G+P  ++
Sbjct:  164 LATAEDLDSDINAVQRYELKPTN--IFSLT-SQNSPDVNKNVEMVLQKPLDREK--EEQISLVLTAVD-GGEPQMSGTMMIVVTVLDANDNAPVFTQQTYKATVTENSPKGTVVAAVTASDADHGSNSRITYSI-TNTVGNVGEYFDIDKEKGEVILINNIDYE----KSISFQINIGATDDGG--LTNSCKLIVDIQDINDNEPEINIMSKSNIIPENAKLSTVVTMIHVEDLDSGNNGKVQCLMNENIPFLLKSTINNFYSLQTDSELDREKASGYNITVTCSDEGVPSLSSSVTLTLQISDVNDNAPVFERSSYEAYIVENNTPGVSIFTVKATDADWKQNARVSYILEDSSVNGVPVSSYVSVSADSGVIHAVRSFDYEQIKDFRFCVKAQDGGSPPLSSNVTVKIQIQDQNDNPPQVLYPVQTAGSVVAEMVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLQKATDRALF--EVGSQNGEIRTVRQVTEKDLLKQ---RLTVIVEDNGQPSRSA 665          

HSP 2 Score: 45.4394 bits (106), Expect = 2.310e-60
Identity = 42/170 (24.71%), Postives = 78/170 (45.88%), Query Frame = 3
Query:   36 SCHLKCQQISDYSKTKSEIQMVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFH--EFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLE 539
            S +  C ++      ++  Q VL  V   +SLA  + +   ++  + + +PK + VGNI + L  ++      +I G +     +  E+ +L +   ++  K  +R +RE +C   + C+     FQ   IL      P  ++ +N +I D NDN P F + K N  + E
Sbjct:    4 SVYETCWKLRGNRSDRTMNQRVLLFVCL-VSLASVLGQ---VSYSIPEEMPKGSLVGNIAQDLGLEM----KRLISGKAKIYSRNSGEYVELNRERGVLLVK--ERIDREALCAETALCA---LHFQI--ILE----NPMEHYTVNIQITDINDNAPAFKKAKMNFKISE 154          

HSP 3 Score: 97.8265 bits (242), Expect = 3.027e-20
Identity = 150/580 (25.86%), Postives = 243/580 (41.90%), Query Frame = 2
Query:  620 SENHKKFFQLSIEKGYPELLILSALNFENVNER----KFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFD-----TLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHDDD---------SVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNS---LDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVT-IENEVQENA---LFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAI 2272
            S N  ++ +L+ E+G   LL+   ++ E +         H Q+   +     E  ++ I   D NDN P F        + E+       +   A+DLD   N    Y        +LT Q   D   +NK   E+ L + LD E   ++ I   + AVD G PQ+SG+  I +   D NDN+P   +     ++ EN    T + ++   D D         S+ N V    N  + F +   +   + I      DYE S   QI+I   D G   +     L + I D NDN P          I E++K++  +      DLDSGN GK+   +++  N  F++  +    Y   +   LDRE        V  +D G   L +SV +++ + D+NDN P   +S     ++EN   G  I  V+  D D  +NARV+ I  +   N      Y  +  D+  I      D E++      +K  D G P L+S  T+ I I D NDN P + YP +        ++  +      +  ++A D D  +N  + +++    + +  F+V   +G I
Sbjct:   78 SRNSGEYVELNRERGV--LLVKERIDREALCAETALCALHFQIILEN---PMEHYTVNIQITDINDNAPAFKKAKMNFKISESAIIGSKFVLATAEDLDSDINAVQRYELKPTNIFSLTSQNSPD---VNKNV-EMVLQKPLDRE--KEEQISLVLTAVDGGEPQMSGTMMIVVTVLDANDNAPVFTQQTYKATVTENSPKGTVVAAVTASDADHGSNSRITYSITNTV---GNVGEYFDIDKEKGEVILI---NNIDYEKSISFQINIGATDDG--GLTNSCKLIVDIQDINDNEPEINIMSKSNIIPENAKLSTVVTMIHVEDLDSGNNGKVQCLMNE--NIPFLLKSTINNFYSLQTDSELDREKASGYNITVTCSDEGVPSLSSSVTLTLQISDVNDNAPVFERSSYEAYIVENNTPGVSIFTVKATDADWKQNARVSYILEDSSVNGVPVSSYVSVSADSGVIHAVRSFDYEQIKDFRFCVKAQDGGSPPLSSNVTVKIQIQDQNDNPPQVLYPVQTAGSVVAEMVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLQKATDRA-LFEVGSQNGEI 635          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Medaka
Match: ENSORLT00000042182.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 223.402 bits (568), Expect = 2.041e-59
Identity = 170/511 (33.27%), Postives = 251/511 (49.12%), Query Frame = 2
Query:  554 RMSLPTAYDLDSSINGVYNYSLSENHK---KFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITT--IDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEIL-KNVSIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY-----RLDDAGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSP--KILTVLENEPI------GTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRP 2014
            R  L  A DLD   N V  Y+LS+N     K  +LS ++  PEL++   L+ E   +   HL L A D G   +T +  IT   +D NDN P+F    Y  TV EN      +L+V+A D D+G NG+I Y F   TPQ +   F +N+  G+I LL+ LDYE     + E  I A D+G PQ+ G C+++I   DINDN P I I  K   + E+    T +  I   D DS +N KVK    +   F L  S  N+  +      D E  S + ++I   DSG PP+++ K + +++ D NDN P+FT+  +   + E+      LF  SA+DLDSG   KI+Y     ++ D     +V +N   G IY  +S D E  ++ E  V A D G   L ++  V + ++D NDN P +  P    L  L ++ +      G L+  V   D D G NA ++    E  + +LF   + L   ++  K  +  +  S   L L++ D G P
Sbjct:  234 RFPLDPAEDLDVGSNSVKIYTLSKNECFSLKMKELSGDRQVPELVLDKPLDREK--QSVHHLLLIASDGGNPVKTGTAKITVSVMDINDNVPVFKMPFYNVTVPENGVVGSVLLRVEATDADDGVNGEIEYVFAEHTPQSLQSVFKINQEKGDISLLEPLDYE--KGAIYEIRITARDKGVPQMEGHCRVQIMVMDINDNVPEIVITSKPNPVQEDSPKGTVVALINARDQDSGNNGKVKLKITNGSPFALKPSFSNNYALITNGALDRETFSEYNVEITAIDSGSPPLSSVKMITVSVTDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSGENSKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAEATDASLF--TVSLYTGEVRTKRAVSEQDDSSQRLILEIKDDGEP 738          

HSP 2 Score: 147.132 bits (370), Expect = 2.368e-35
Identity = 173/634 (27.29%), Postives = 303/634 (47.79%), Query Frame = 2
Query:  572 AYDLDSSINGVYNYSL---SENHKKFFQLSIEKGYPELLILSALNFENVNERK----FHLQLTAFDRGGQFETMSLFITTIDRNDNKPIF-TDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLN--KLTG-----EIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNSNDNFRLHS----SQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYN-SLDREVKEMLEFFVYATDGGGLE-ASVK-VSITVMDINDNPPRLKSPKILTVL-ENEPIGTLIGNVEVFDLDDGENARVT---IENEVQENALF-YSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMN-SRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRST 2383
            A DL   ++ +++  L   SE  +++F  S++ G  ELL+   ++ E +  +       LQ+   +     +   + +   D NDN P+F T+  + K + E+T   +      A+DLD G N   S +  TL+    N+ FSL   +L+G     E+ L + LD E  S  +    + A D G+P  +G+ KI +   DINDN P  ++   NV++PEN  + + ++ +   D DD V+ +++     +    L S    +QE    I +    DYE  +I++I I   D G+P M  +  + I ++D NDN P          + EDS     +   +A D DSGN GK+  ++ +        + S  Y  + N +LDRE        + A D G    +SVK ++++V D+NDNPP          L EN   G+++ +V   DLD GEN++++   ++++VQ+ ++  Y Y+  +N  I+     D EK+    + ++  D G P L+S  T+ + I+D NDN P + YPS   + + S   +  + +    +  + A D+D   N  I +R+ +  + S  F V+  +G +      R  + +S       R+ +E+KD    +  +T
Sbjct:  132 AKDLGLGLSEIFDRKLRVASEAGEQYF--SVDAGRGELLVNDRIDREALCGQSASCVLPLQIVTEN---PLQLHRIEVEIKDINDNSPVFLTEERFLK-IAESTATGVRFPLDPAEDLDVGSN---SVKIYTLSK---NECFSLKMKELSGDRQVPELVLDKPLDREKQS--VHHLLLIASDGGNPVKTGTAKITVSVMDINDNVPVFKMPFYNVTVPENGVVGSVLLRVEATDADDGVNGEIEYVFAEHTPQSLQSVFKINQEKG-DISLLEPLDYEKGAIYEIRITARDKGVPQMEGHCRVQIMVMDINDNVPEIVITSKPNPVQEDSPKGTVVALINARDQDSGNNGKVKLKITNGSPFALKPSFSNNYALITNGALDRETFSEYNVEITAIDSGSPPLSSVKMITVSVTDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSGENSKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAEATDAS-LFTVSLYTGEV------RTKRAVSEQDDSSQRLILEIKDDGEPLQSAT 743          
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Medaka
Match: ENSORLT00000041785.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 218.779 bits (556), Expect = 5.199e-58
Identity = 164/533 (30.77%), Postives = 265/533 (49.72%), Query Frame = 2
Query:  494 PAEIQPIQVQHQCA*RTKNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIE-----KGYPELLILSALNFENVNERKFHLQLTAFDRGGQFET--MSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNV-SIPENKRIATPIMSIYVHDDDSVHN-KVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITY-----RLDDAGNKEFV-INISTGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRLKSP--KILTVLENEPI------GTLIGNVEVFDLDDGENARVTIE-NEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRP 2014
            P+  + +Q+    A  T   R  L TA DLD  +N V +Y+LS++   +F L+++     +  PEL++   L+ E +   +  L +TA D G   ++    + I  +D NDN P+F   +Y+ T+ EN+  +  +L++ AKD D+G NG++ Y F   TP  +   F +NK +GEI+L+  LD+E  S    E  + A D+G+P++ G C + I   D+NDN+P I +     S+PEN    T +  I   D DS  N KV      +  F+L +S  ++  +   R  D E  S + ++I   D G PP++  K + + I D NDN P+FT+  +   + E+      LF  SA+DLDS    KI+Y     ++ D     +V +N   G IY  +S D E  ++ E  V A D G   L ++  V + ++D NDN P +  P    L  L ++ +      G L+  V   D D G NA ++    E  + +LF   + L   ++  K  +  +  S   L L++ D G P
Sbjct:  152 PSSEKNLQIAESTAAGT---RFPLDTALDLDVGVNSVRSYTLSKD--DYFSLNVKDMAGGRKNPELVLSKTLDREKMPTHQ--LTITAVDGGNPNKSGISQINIYVLDNNDNFPVFEKNVYKVTLSENSEKSSIVLKLAAKDSDDGVNGEVEYSFGPQTPDAVLSVFGINKDSGEIRLIGNLDFETTSS--YEIDVSATDKGTPKMEGHCSVHIEVLDVNDNAPYIFLTSQPNSVPENAPSGTVVALISARDLDSGDNGKVTLQVPKSSPFKLKASFSDNYALITSRALDRETFSEYSVEITATDLGSPPLSNKKMISVTITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSSENAKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAEATDASLF--TVSLYTGEVRTKRAVSEQDDSSQRLILEIKDDGEP 673          

HSP 2 Score: 155.221 bits (391), Expect = 5.600e-38
Identity = 169/612 (27.61%), Postives = 288/612 (47.06%), Query Frame = 2
Query:  620 SENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLT---AFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLN--KLTG-----EIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI-LKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCN---KNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYN-SLDREVKEMLEFFVYATDGGGLEASVK--VSITVMDINDNPPRLKSPKILTVL-ENEPIGTLIGNVEVFDLDDGENARVT---IENEVQENALF-YSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMN-SRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRST 2383
            SE+ +++F  S++ G  ELL+   ++ E +  +     LT     D+  Q   + + I  ID NDN P+F        + E+T          A DLD G N   SY          +D FSLN   + G     E+ L + LD E       + TI AVD G+P  SG  +I I+  D NDN P  E  +  V++ EN   ++ ++ +   D DD V+ +V+ +   +  +    +    ++S  I +    D+E +S ++ID+   D G P M  + S+ I ++D NDN P          + E++     +   SA DLDSG+ GK+T ++  +   +   + S  Y  + + +LDRE        + ATD G    S K  +S+T+ D+NDNPP          L EN   G+++ +V   DLD  ENA+++   ++++VQ+ ++  Y Y+  +N  I+     D EK+    + ++  D G P L+S  T+ + I+D NDN P + YPS   + + S   +  + +    +  + A D+D   N  I +R+ +  + S  F V+  +G +      R  + +S       R+ +E+KD    +  +T
Sbjct:   86 SESGEQYF--SVDAGRGELLVNDRIDREALCRQSASCVLTLQVVIDKPLQLFKVEVEI--IDINDNSPVFPSSEKNLQIAESTAAGTRFPLDTALDLDVGVNSVRSYTLSK------DDYFSLNVKDMAGGRKNPELVLSKTLDREKMPTH--QLTITAVDGGNPNKSGISQINIYVLDNNDNFPVFEKNVYKVTLSENSEKSSIVLKLAAKDSDDGVNGEVEYSFGPQTPDAVLSVFGINKDSGEIRLIGNLDFETTSSYEIDVSATDKGTPKMEGHCSVHIEVLDVNDNAPYIFLTSQPNSVPENAPSGTVVALISARDLDSGDNGKVTLQVPKSSPFKLKASFSDNYALITSRALDRETFSEYSVEITATDLGSPPLSNKKMISVTITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSSENAKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAEATDAS-LFTVSLYTGEV------RTKRAVSEQDDSSQRLILEIKDDGEPLQSAT 678          
BLAST of Protocadherin-1 isoform 2 vs. Planmine SMEST
Match: SMESG000008875.1 (SMESG000008875.1)

HSP 1 Score: 1741.09 bits (4508), Expect = 0.000e+0
Identity = 880/880 (100.00%), Postives = 880/880 (100.00%), Query Frame = 2
Query:  545 KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLXXXXXXXXXXXXILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHEINEDIRLKTVDKNSKFMQDIPDFLKDSKFSKESYYPDYYYTRDSGHGTADENNFLICYNN 3184
            KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHEINEDIRLKTVDKNSKFMQDIPDFLKDSKFSKESYYPDYYYTRDSGHGTADENNFLICYNN
Sbjct:  151 KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHEINEDIRLKTVDKNSKFMQDIPDFLKDSKFSKESYYPDYYYTRDSGHGTADENNFLICYNN 1030          

HSP 2 Score: 313.153 bits (801), Expect = 2.270e-90
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:   96 MVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK 548
            MVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK
Sbjct:    1 MVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK 151          

HSP 3 Score: 60.8474 bits (146), Expect = 6.032e-9
Identity = 104/415 (25.06%), Postives = 175/415 (42.17%), Query Frame = 2
Query:  791 IDRNDNKPIFTDILYRKTVKE---NTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKF---SLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNS------NDNFRLHSSQENSLT--IYMERTFDYENSSIHQID--IECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIS---TGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDRE 1963
            ID NDN P F    +   V E   N   ++P     A DLD   NG  +Y        E + KF   S+ K   E+ +L  L++E  +++     + A D G    + S  + I + D NDN P   +IL   ++ EN     PI+ +   D D+  + K+    ++      ND F L     N LT  I + +  DYE  S   I+  IE  D G P ++    + I   D NDN P     +++  I E+ ++   +      D DS +  K+  + +   N  F ++ S   +  IY+  + D E   + +  +   D G   +     + I ++D NDN P   ++  I  + E+  +   +      DLD G   ++T   +   N  F   + +    I++ + +DRE
Sbjct:  128 IDENDNPPKFNQFKFNINVLEEQKNYRMSLP----TAYDLDSSINGVYNYSL-----SENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMS--LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSL-----NKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNV-SIPENKRIATPIMSIYVHDDDSVH-NKV--KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEF--VINISTGYIYLYNSLDRE 520          

HSP 4 Score: 56.9954 bits (136), Expect = 8.445e-8
Identity = 68/212 (32.08%), Postives = 101/212 (47.64%), Query Frame = 2
Query: 1427 IIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGY--IYLYNSLDREVKEMLEFFVYAT--DGGGLEASVKVSITVMDINDNPPRLKSPKIL---TVLENEPIGTLIGNVEVFDLDDGENARVTIENEV---QENALFYSYLKLDNNKIFIKSLIDREKVSQ--IFLRLKLVDHGRPKLTS 2026
            IIDENDN P F + +    + E+ K N  +   +A DLDS   G   Y L +   K F ++I  GY  + + ++L+ E     +F +  T  D GG   ++ + IT +D NDN P      IL   TV EN      I  V+  DLD+GEN +++   +    QE    +S  KL      ++ L D E  S   I   ++ VD G P+L+ 
Sbjct:  127 IIDENDNPPKFNQFKFNINVLEEQK-NYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTD--ILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKL-DYEIYSDQLIEFTIEAVDEGSPQLSG 334          
BLAST of Protocadherin-1 isoform 2 vs. Planmine SMEST
Match: SMESG000008875.1 (SMESG000008875.1)

HSP 1 Score: 1739.16 bits (4503), Expect = 0.000e+0
Identity = 880/880 (100.00%), Postives = 880/880 (100.00%), Query Frame = 2
Query:  545 KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLXXXXXXXXXXXXILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHEINEDIRLKTVDKNSKFMQDIPDFLKDSKFSKESYYPDYYYTRDSGHGTADENNFLICYNN 3184
            KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHEINEDIRLKTVDKNSKFMQDIPDFLKDSKFSKESYYPDYYYTRDSGHGTADENNFLICYNN
Sbjct:  128 KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHEINEDIRLKTVDKNSKFMQDIPDFLKDSKFSKESYYPDYYYTRDSGHGTADENNFLICYNN 1007          

HSP 2 Score: 267.314 bits (682), Expect = 2.008e-74
Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 3
Query:  165 MKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK 548
            MKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK
Sbjct:    1 MKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK 128          

HSP 3 Score: 61.2326 bits (147), Expect = 4.643e-9
Identity = 104/415 (25.06%), Postives = 175/415 (42.17%), Query Frame = 2
Query:  791 IDRNDNKPIFTDILYRKTVKE---NTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKF---SLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNS------NDNFRLHSSQENSLT--IYMERTFDYENSSIHQID--IECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIS---TGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDRE 1963
            ID NDN P F    +   V E   N   ++P     A DLD   NG  +Y        E + KF   S+ K   E+ +L  L++E  +++     + A D G    + S  + I + D NDN P   +IL   ++ EN     PI+ +   D D+  + K+    ++      ND F L     N LT  I + +  DYE  S   I+  IE  D G P ++    + I   D NDN P     +++  I E+ ++   +      D DS +  K+  + +   N  F ++ S   +  IY+  + D E   + +  +   D G   +     + I ++D NDN P   ++  I  + E+  +   +      DLD G   ++T   +   N  F   + +    I++ + +DRE
Sbjct:  105 IDENDNPPKFNQFKFNINVLEEQKNYRMSLP----TAYDLDSSINGVYNYSL-----SENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMS--LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSL-----NKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNV-SIPENKRIATPIMSIYVHDDDSVH-NKV--KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEF--VINISTGYIYLYNSLDRE 497          

HSP 4 Score: 57.3806 bits (137), Expect = 6.672e-8
Identity = 68/212 (32.08%), Postives = 101/212 (47.64%), Query Frame = 2
Query: 1427 IIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGY--IYLYNSLDREVKEMLEFFVYAT--DGGGLEASVKVSITVMDINDNPPRLKSPKIL---TVLENEPIGTLIGNVEVFDLDDGENARVTIENEV---QENALFYSYLKLDNNKIFIKSLIDREKVSQ--IFLRLKLVDHGRPKLTS 2026
            IIDENDN P F + +    + E+ K N  +   +A DLDS   G   Y L +   K F ++I  GY  + + ++L+ E     +F +  T  D GG   ++ + IT +D NDN P      IL   TV EN      I  V+  DLD+GEN +++   +    QE    +S  KL      ++ L D E  S   I   ++ VD G P+L+ 
Sbjct:  104 IIDENDNPPKFNQFKFNINVLEEQK-NYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTD--ILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKL-DYEIYSDQLIEFTIEAVDEGSPQLSG 311          
BLAST of Protocadherin-1 isoform 2 vs. Planmine SMEST
Match: SMESG000008875.1 (SMESG000008875.1)

HSP 1 Score: 1619.75 bits (4193), Expect = 0.000e+0
Identity = 820/821 (99.88%), Postives = 821/821 (100.00%), Query Frame = 2
Query:  545 KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLXXXXXXXXXXXXILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHEI 3007
            KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHE+
Sbjct:  151 KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHEV 971          

HSP 2 Score: 313.923 bits (803), Expect = 1.022e-90
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:   96 MVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK 548
            MVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK
Sbjct:    1 MVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK 151          

HSP 3 Score: 60.4622 bits (145), Expect = 8.051e-9
Identity = 104/415 (25.06%), Postives = 175/415 (42.17%), Query Frame = 2
Query:  791 IDRNDNKPIFTDILYRKTVKE---NTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKF---SLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNS------NDNFRLHSSQENSLT--IYMERTFDYENSSIHQID--IECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIS---TGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDRE 1963
            ID NDN P F    +   V E   N   ++P     A DLD   NG  +Y        E + KF   S+ K   E+ +L  L++E  +++     + A D G    + S  + I + D NDN P   +IL   ++ EN     PI+ +   D D+  + K+    ++      ND F L     N LT  I + +  DYE  S   I+  IE  D G P ++    + I   D NDN P     +++  I E+ ++   +      D DS +  K+  + +   N  F ++ S   +  IY+  + D E   + +  +   D G   +     + I ++D NDN P   ++  I  + E+  +   +      DLD G   ++T   +   N  F   + +    I++ + +DRE
Sbjct:  128 IDENDNPPKFNQFKFNINVLEEQKNYRMSLP----TAYDLDSSINGVYNYSL-----SENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMS--LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSL-----NKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNV-SIPENKRIATPIMSIYVHDDDSVH-NKV--KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEF--VINISTGYIYLYNSLDRE 520          

HSP 4 Score: 56.6102 bits (135), Expect = 1.054e-7
Identity = 68/212 (32.08%), Postives = 101/212 (47.64%), Query Frame = 2
Query: 1427 IIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGY--IYLYNSLDREVKEMLEFFVYAT--DGGGLEASVKVSITVMDINDNPPRLKSPKIL---TVLENEPIGTLIGNVEVFDLDDGENARVTIENEV---QENALFYSYLKLDNNKIFIKSLIDREKVSQ--IFLRLKLVDHGRPKLTS 2026
            IIDENDN P F + +    + E+ K N  +   +A DLDS   G   Y L +   K F ++I  GY  + + ++L+ E     +F +  T  D GG   ++ + IT +D NDN P      IL   TV EN      I  V+  DLD+GEN +++   +    QE    +S  KL      ++ L D E  S   I   ++ VD G P+L+ 
Sbjct:  127 IIDENDNPPKFNQFKFNINVLEEQK-NYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTD--ILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKL-DYEIYSDQLIEFTIEAVDEGSPQLSG 334          
BLAST of Protocadherin-1 isoform 2 vs. Planmine SMEST
Match: SMESG000008875.1 (SMESG000008875.1)

HSP 1 Score: 1618.98 bits (4191), Expect = 0.000e+0
Identity = 820/821 (99.88%), Postives = 821/821 (100.00%), Query Frame = 2
Query:  545 KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLXXXXXXXXXXXXILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHEI 3007
            KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHE+
Sbjct:  151 KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHEV 971          

HSP 2 Score: 313.923 bits (803), Expect = 9.563e-91
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:   96 MVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK 548
            MVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK
Sbjct:    1 MVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK 151          

HSP 3 Score: 60.8474 bits (146), Expect = 6.288e-9
Identity = 104/415 (25.06%), Postives = 175/415 (42.17%), Query Frame = 2
Query:  791 IDRNDNKPIFTDILYRKTVKE---NTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKF---SLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNS------NDNFRLHSSQENSLT--IYMERTFDYENSSIHQID--IECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIS---TGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDRE 1963
            ID NDN P F    +   V E   N   ++P     A DLD   NG  +Y        E + KF   S+ K   E+ +L  L++E  +++     + A D G    + S  + I + D NDN P   +IL   ++ EN     PI+ +   D D+  + K+    ++      ND F L     N LT  I + +  DYE  S   I+  IE  D G P ++    + I   D NDN P     +++  I E+ ++   +      D DS +  K+  + +   N  F ++ S   +  IY+  + D E   + +  +   D G   +     + I ++D NDN P   ++  I  + E+  +   +      DLD G   ++T   +   N  F   + +    I++ + +DRE
Sbjct:  128 IDENDNPPKFNQFKFNINVLEEQKNYRMSLP----TAYDLDSSINGVYNYSL-----SENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMS--LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSL-----NKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNV-SIPENKRIATPIMSIYVHDDDSVH-NKV--KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEF--VINISTGYIYLYNSLDRE 520          

HSP 4 Score: 56.6102 bits (135), Expect = 9.922e-8
Identity = 68/212 (32.08%), Postives = 101/212 (47.64%), Query Frame = 2
Query: 1427 IIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGY--IYLYNSLDREVKEMLEFFVYAT--DGGGLEASVKVSITVMDINDNPPRLKSPKIL---TVLENEPIGTLIGNVEVFDLDDGENARVTIENEV---QENALFYSYLKLDNNKIFIKSLIDREKVSQ--IFLRLKLVDHGRPKLTS 2026
            IIDENDN P F + +    + E+ K N  +   +A DLDS   G   Y L +   K F ++I  GY  + + ++L+ E     +F +  T  D GG   ++ + IT +D NDN P      IL   TV EN      I  V+  DLD+GEN +++   +    QE    +S  KL      ++ L D E  S   I   ++ VD G P+L+ 
Sbjct:  127 IIDENDNPPKFNQFKFNINVLEEQK-NYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTD--ILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKL-DYEIYSDQLIEFTIEAVDEGSPQLSG 334          
BLAST of Protocadherin-1 isoform 2 vs. Planmine SMEST
Match: SMESG000008875.1 (SMESG000008875.1)

HSP 1 Score: 1618.98 bits (4191), Expect = 0.000e+0
Identity = 820/821 (99.88%), Postives = 821/821 (100.00%), Query Frame = 2
Query:  545 KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWEXXXXXXXXXXXXXXXLEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLXXXXXXXXXXXXILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHEI 3007
            KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHE+
Sbjct:  128 KNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPEEMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKLPDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSYFDRTQLFGSYQPPIHEV 948          

HSP 2 Score: 267.7 bits (683), Expect = 1.024e-74
Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 3
Query:  165 MKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK 548
            MKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK
Sbjct:    1 MKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQK 128          

HSP 3 Score: 60.8474 bits (146), Expect = 5.732e-9
Identity = 104/415 (25.06%), Postives = 175/415 (42.17%), Query Frame = 2
Query:  791 IDRNDNKPIFTDILYRKTVKE---NTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKF---SLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRI-EILKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNS------NDNFRLHSSQENSLT--IYMERTFDYENSSIHQID--IECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINIS---TGYIYLYNSLDREVKEMLEFFVYATDGG--GLEASVKVSITVMDINDNPPRL-KSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDRE 1963
            ID NDN P F    +   V E   N   ++P     A DLD   NG  +Y        E + KF   S+ K   E+ +L  L++E  +++     + A D G    + S  + I + D NDN P   +IL   ++ EN     PI+ +   D D+  + K+    ++      ND F L     N LT  I + +  DYE  S   I+  IE  D G P ++    + I   D NDN P     +++  I E+ ++   +      D DS +  K+  + +   N  F ++ S   +  IY+  + D E   + +  +   D G   +     + I ++D NDN P   ++  I  + E+  +   +      DLD G   ++T   +   N  F   + +    I++ + +DRE
Sbjct:  105 IDENDNPPKFNQFKFNINVLEEQKNYRMSLP----TAYDLDSSINGVYNYSL-----SENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMS--LFITTIDRNDNKPIFTDILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSL-----NKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNV-SIPENKRIATPIMSIYVHDDDSVH-NKV--KCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEF--VINISTGYIYLYNSLDRE 497          

HSP 4 Score: 56.9954 bits (136), Expect = 8.176e-8
Identity = 68/212 (32.08%), Postives = 101/212 (47.64%), Query Frame = 2
Query: 1427 IIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGY--IYLYNSLDREVKEMLEFFVYAT--DGGGLEASVKVSITVMDINDNPPRLKSPKIL---TVLENEPIGTLIGNVEVFDLDDGENARVTIENEV---QENALFYSYLKLDNNKIFIKSLIDREKVSQ--IFLRLKLVDHGRPKLTS 2026
            IIDENDN P F + +    + E+ K N  +   +A DLDS   G   Y L +   K F ++I  GY  + + ++L+ E     +F +  T  D GG   ++ + IT +D NDN P      IL   TV EN      I  V+  DLD+GEN +++   +    QE    +S  KL      ++ L D E  S   I   ++ VD G P+L+ 
Sbjct:  104 IIDENDNPPKFNQFKFNINVLEEQK-NYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTD--ILYRKTVKENTTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKLLQKL-DYEIYSDQLIEFTIEAVDEGSPQLSG 311          
The following BLAST results are available for this feature:
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDHGA72.846e-6233.20protocadherin gamma subfamily A, 7 [Source:HGNC Sy... [more]
PCDHGA73.646e-6233.20protocadherin gamma subfamily A, 7 [Source:HGNC Sy... [more]
PCDHGA43.512e-6033.14protocadherin gamma subfamily A, 4 [Source:HGNC Sy... [more]
PCDHGA45.365e-6033.14protocadherin gamma subfamily A, 4 [Source:HGNC Sy... [more]
PCDHGA82.020e-5933.97protocadherin gamma subfamily A, 8 [Source:HGNC Sy... [more]
back to top
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-16.676e-3927.88FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-13.394e-3427.73FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-15.884e-3225.65CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-12.910e-3030.00Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-12.910e-3030.00Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds3.490e-4727.56gene:FBgn0284247 transcript:FBtr0078045[more]
ds3.490e-4727.56gene:FBgn0284247 transcript:FBtr0343249[more]
stan6.960e-4429.08gene:FBgn0024836 transcript:FBtr0304900[more]
stan7.018e-4429.08gene:FBgn0024836 transcript:FBtr0303223[more]
stan7.018e-4429.08gene:FBgn0024836 transcript:FBtr0088214[more]
back to top
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh2ab61.615e-5832.17protocadherin 2 alpha b 6 [Source:ZFIN;Acc:ZDB-GEN... [more]
pcdh172.301e-5831.35protocadherin 17 [Source:ZFIN;Acc:ZDB-GENE-090608-... [more]
pcdh2aa152.573e-5832.85protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GE... [more]
pcdh2aa152.950e-5832.85protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GE... [more]
pcdh2aa15.597e-5831.93protocadherin 2 alpha a 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd83.029e-6131.59Xenopus tropicalis protocadherin gamma subfamily A... [more]
atp5pd9.515e-6131.61ATP synthase peripheral stalk subunit d [Source:Xe... [more]
PCDH173.757e-5932.43protocadherin 17 [Source:NCBI gene;Acc:100485388][more]
PCDH174.380e-5932.43protocadherin 17 [Source:NCBI gene;Acc:100485388][more]
gga32.544e-5730.21golgi-associated, gamma adaptin ear containing, AR... [more]
back to top
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdhga42.993e-6234.17protocadherin gamma subfamily A, 4 [Source:MGI Sym... [more]
Pcdhga76.075e-6133.20protocadherin gamma subfamily A, 7 [Source:MGI Sym... [more]
Pcdhga76.119e-6133.20protocadherin gamma subfamily A, 7 [Source:MGI Sym... [more]
Pcdhga101.095e-5932.88protocadherin gamma subfamily A, 10 [Source:MGI Sy... [more]
Pcdhga91.595e-5732.25protocadherin gamma subfamily A, 9 [Source:MGI Sym... [more]
back to top
BLAST of Protocadherin-1 isoform 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5DRB3|PCDG7_PANTR1.332e-6133.01Protocadherin gamma-A7 OS=Pan troglodytes OX=9598 ... [more]
sp|Q9Y5G6|PCDG7_HUMAN1.612e-6133.20Protocadherin gamma-A7 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q91XY4|PCDG4_MOUSE1.826e-6134.17Protocadherin gamma-A4 OS=Mus musculus OX=10090 GN... [more]
sp|Q5DRB2|PCDG8_PANTR5.158e-6034.36Protocadherin gamma-A8 OS=Pan troglodytes OX=9598 ... [more]
sp|Q9Y5G9|PCDG4_HUMAN1.553e-5933.14Protocadherin gamma-A4 OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of Protocadherin-1 isoform 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TU254.237e-9432.88Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3WAJ98.035e-9431.89Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0R3S9654.776e-9032.59Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564Y6725.232e-9032.63Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A5K3F2861.541e-8932.49Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034478.11.392e-5931.84pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
pcdh171.707e-5931.27protocadherin 17 [Source:NCBI gene;Acc:103025306][more]
ENSAMXT00000016496.26.040e-5831.86pep primary_assembly:Astyanax_mexicanus-2.0:8:9140... [more]
ENSAMXT00000050733.17.199e-5731.78pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
ENSAMXT00000038332.17.758e-5731.46pep primary_assembly:Astyanax_mexicanus-2.0:8:9168... [more]
back to top
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.11.339e-4828.21pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
si:ch211-199f5.11.974e-4729.91protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000006996.17.114e-4030.54pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
ENSPMAT00000008517.12.245e-3926.73pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
pcdh111.194e-3629.31protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354122.943e-4830.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461898.903e-4628.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348151.682e-4428.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404704.534e-4129.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348141.938e-4031.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-1 isoform 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh171.123e-6032.18protocadherin 17 [Source:NCBI gene;Acc:101155999][more]
ENSORLT00000045699.12.180e-6032.50protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000030657.12.310e-6032.50protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000042182.12.041e-5933.27protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000041785.15.199e-5830.77protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Protocadherin-1 isoform 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008875.12.270e-90100.00SMESG000008875.1[more]
SMESG000008875.12.008e-74100.00SMESG000008875.1[more]
SMESG000008875.11.022e-9099.88SMESG000008875.1[more]
SMESG000008875.19.563e-9199.88SMESG000008875.1[more]
SMESG000008875.11.024e-7499.88SMESG000008875.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028833 ID=SMED30028833|Name=Protocadherin-1 isoform 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3278bp
TAAAATTCAATTTAAGAAATGACTTATAAAATCTCTCATGTCATTTGAAA
TGCCAACAAATCTCAGATTATAGCAAGACCAAATCCGAAATACAAATGGT
TCTTTTTCATGTCATTTTTTGCATATCACTGGCCGATGCGATAGCAGAGG
AGCACTCTATTAATATGAAACTCAATGACAATGTGCCAAAATCGACAAAT
GTTGGCAACATTTTCAAAATGCTCAATTATCAACTGTTTAACGAAAATTA
CCACATTATTGTCGGAACTTCGACTTTCACGAAATTCCATGAGTTTTTCA
AACTTTTTAAATCTGGTGACATTATCACGACAAAGTTTATTGATCGGGAT
AATCGGGAGGAAATTTGTGGCCCCCTCAGTTGTTGCTCGAAGGACATTTG
TGAATTTCAGGCAAATGCTATTTTAAACTATCAGTCGACAAAGCCGGCTG
TTAATTTCCAAATCAACTTTGAAATCATCGATGAAAACGATAACCCGCCG
AAATTCAACCAATTCAAGTTCAACATCAATGTGCTTGAAGAACAAAAAAT
TATCGAATGAGTCTGCCTACGGCCTATGATTTGGACAGTTCAATAAATGG
AGTCTACAACTATTCGTTATCAGAAAACCATAAAAAGTTCTTCCAATTAT
CCATAGAAAAGGGCTACCCAGAACTGTTGATTCTATCGGCTCTTAATTTT
GAAAATGTCAATGAAAGAAAATTTCATTTACAATTGACAGCTTTTGATAG
GGGTGGCCAATTTGAAACAATGAGTCTTTTTATTACGACAATTGATCGAA
ACGATAACAAACCAATTTTCACTGACATTCTCTATCGAAAAACTGTCAAA
GAAAATACAACTTACACAATTCCTATTTTGCAGGTCCAAGCAAAAGATTT
AGATGAAGGAGAAAACGGAAAAATCAGTTACCGATTTGACACTTTAACAC
CTCAAGAGATAAATGACAAATTTTCTTTGAATAAATTGACGGGAGAAATA
AAATTATTACAGAAATTGGATTATGAAATCTATTCAGATCAGTTAATAGA
ATTTACAATTGAAGCAGTCGACGAAGGAAGTCCACAGTTGAGTGGAAGCT
GTAAAATCGAGATCCATTCCACTGATATCAATGACAATTCACCAAGAATT
GAAATTCTGAAAAACGTTAGCATTCCAGAAAACAAACGGATCGCCACTCC
GATTATGAGTATTTACGTACATGATGATGATTCGGTTCACAACAAGGTGA
AATGCAACAAAAACAGCAACGATAACTTTAGGTTACATAGTTCCCAGGAA
AACTCTTTGACTATTTATATGGAAAGAACTTTTGATTACGAAAACTCTAG
TATTCATCAAATAGATATTGAATGCTTTGATTCGGGGATTCCACCAATGG
CAACATATAAATCTCTGTTTATAGCCATCATTGATGAAAATGATAACTTT
CCCATATTCACTCGTGCTCAGCACATATACCAAATATCGGAGGATTCAAA
AGTCAACGAGTTTCTTTTTCAATGTTCAGCGACAGATCTCGACAGTGGGA
ATTTCGGGAAAATAACCTATCGGTTGGATGATGCTGGAAATAAAGAATTT
GTAATAAACATTTCAACGGGCTATATTTACTTATACAACAGTTTAGATAG
GGAGGTCAAGGAAATGTTAGAATTTTTTGTCTATGCAACCGATGGAGGGG
GCCTAGAAGCGTCTGTTAAAGTCTCAATAACGGTCATGGACATAAATGAT
AATCCTCCAAGACTAAAATCTCCAAAAATACTGACGGTGTTAGAAAACGA
ACCGATAGGAACGTTAATTGGAAACGTTGAGGTATTTGATTTAGATGATG
GAGAAAATGCAAGAGTAACGATTGAGAATGAGGTACAAGAAAATGCACTA
TTTTATAGTTATTTGAAACTTGATAACAATAAAATATTCATTAAATCATT
AATTGATAGGGAGAAGGTTTCGCAGATATTCCTTAGGTTAAAGCTGGTTG
ATCATGGTCGACCAAAGTTGACATCGTGGGAGACGATTACCATTTCCATC
ATAGATATCAATGACAATGATCCAATTTTAGAATATCCATCTGAAGGAGA
CGTTATGAACTCTCGATCACTTATTTATGTCAATACCCAATTTAATTCTT
TCATTTTAACTTTATTAGCGCGTGATTCTGATTTCGATGAAAATGGAAAA
ATTAGATTTCGTATAATGGATGATTGTAATGGTAGTAGATACTTTCAAGT
TAATGAGACATCTGGAGCGATATACTCTACGTGGAGCTGTAGAAACGGTC
AGTTTATCAGTTGTCCAATTGCCGGCCTTTATAGAGTGAATATTGAATTG
AAGGACAGCTCATCTACAATAGTCAGAAGCACGAAAAGTCATTTTTATTT
AACAATCCGTGAGTATTCTGCAAATTACGATCTTCTCAATGTTAATTCAA
ATTCGTTTTTCAAAAATGTCGTCATTCTTGTTATGATTGTTGTGTTTAGC
ATTGTACTGGCAGTTGGCTTAGTAGGTGCAATTGTTTGGGCTCGTACAAG
ACCTTCAGTTCATTTTAATGTTTGTTCAAACGAATCATCAAATTCTTTTA
AAAAGATTACGAAATCAAATCAATGGCTTTATGATCCTCATTTGCTGCTA
CCCGAGGAAATGGAATCTCACTTTTTAGATGTCGAGAAATCTAATTTTAC
TTCTGGAGCTCCACCAAATGAACTCGTTTTGCAAAAACTGTATTCAAATA
ATAATGAAGAATTCCCAGATCCTAATGATCTTCAAATTTATCAACACACG
AAATTACCGGATCAAATCATGAGTCCAAAGCTAAGTATGGCAGATAAGAC
ATTTACAAGCTCACGATACTCTCCATTAAATACCATCTCATCGTCGACAA
CTCCAAGTCAATATCCAGCGCGGACCTCTACGGATAATCATTTGAATAAA
TCTTATTTTGACAGGACTCAATTGTTTGGCTCGTACCAACCTCCGATTCA
TGAAATTAATGAAGATATTAGATTAAAAACAGTTGATAAAAATAGTAAGT
TTATGCAAGATATTCCTGATTTTCTGAAAGACTCAAAATTTTCCAAAGAA
TCATACTATCCAGATTATTATTATACTAGAGACAGCGGTCACGGCACGGC
GGACGAAAACAACTTTTTGATTTGCTATAATAATTGAAAAATAATTTATA
CAATTTAGCTTTGAAACATCAGTTGTAAATCTTTTAGATTTATTTGTTAC
TCTTGTACAGTTAGACTTATAATAAAGA
back to top

protein sequence of SMED30028833-orf-1

>SMED30028833-orf-1 ID=SMED30028833-orf-1|Name=SMED30028833-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
MVLFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNE
NYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKD
ICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQ
KIIE*
back to top

protein sequence of SMED30028833-orf-2

>SMED30028833-orf-2 ID=SMED30028833-orf-2|Name=SMED30028833-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=877bp
MSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFEN
VNERKFHLQLTAFDRGGQFETMSLFITTIDRNDNKPIFTDILYRKTVKEN
TTYTIPILQVQAKDLDEGENGKISYRFDTLTPQEINDKFSLNKLTGEIKL
LQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEI
LKNVSIPENKRIATPIMSIYVHDDDSVHNKVKCNKNSNDNFRLHSSQENS
LTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPI
FTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVI
NISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNP
PRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFY
SYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIID
INDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIR
FRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKD
SSSTIVRSTKSHFYLTIREYSANYDLLNVNSNSFFKNVVILVMIVVFSIV
LAVGLVGAIVWARTRPSVHFNVCSNESSNSFKKITKSNQWLYDPHLLLPE
EMESHFLDVEKSNFTSGAPPNELVLQKLYSNNNEEFPDPNDLQIYQHTKL
PDQIMSPKLSMADKTFTSSRYSPLNTISSSTTPSQYPARTSTDNHLNKSY
FDRTQLFGSYQPPIHEINEDIRLKTVDKNSKFMQDIPDFLKDSKFSKESY
YPDYYYTRDSGHGTADENNFLICYNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 135..148
score: 33.73
coord: 116..135
score: 30.29
coord: 65..84
score: 28.15
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 15..139
e-value: 8.9E-8
score: 34.4
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.706