Spermatogenesis-associated protein 1

Overview
NameSpermatogenesis-associated protein 1
Smed IDSMED30028825
Length (bp)577
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spermatogenesis-associated protein 1 (SMED30028825) t-SNE clustered cells

Violin plots show distribution of expression levels for Spermatogenesis-associated protein 1 (SMED30028825) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Spermatogenesis-associated protein 1 (SMED30028825) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Spermatogenesis-associated protein 1 (SMED30028825) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028825

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30028825SMESG000049418.1 SmedASXL_005767SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30028825SMESG000049418.1 Contig37025newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028825SMESG000049418.1 Contig37025uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Human
Match: SPATA1 (spermatogenesis associated 1 [Source:HGNC Symbol;Acc:HGNC:14682])

HSP 1 Score: 88.5817 bits (218), Expect = 3.704e-20
Identity = 54/159 (33.96%), Postives = 89/159 (55.97%), Query Frame = 1
Query:   22 RNLLSNFNFTMSVLSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELF---IVDSLVAKRSPTS---DSRKTNSSNSE 480
            RN +   N+ +  L +   +  RP SS  + ELH++ VP   W  + N    +++++ ISAGF+R+     +  LR  +   LG + I + ++F K +G  LA V+EKQE+ LK+K F PP +  PEL+   ++D L    SP++   D R+TN+  +E
Sbjct:    7 RNKIPIDNYPIQTLVNMSLNPSRP-SSSELVELHVFYVPEGSWNYKLNTISTEVVNKFISAGFLRVSPQLTLRALRERLGEFLGEDAIAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLLPVMDHLGNVYSPSTVILDERQTNNGVNE 164          
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Zebrafish
Match: SPATA1 (si:dkey-205k8.5 [Source:ZFIN;Acc:ZDB-GENE-141216-11])

HSP 1 Score: 83.1889 bits (204), Expect = 1.916e-18
Identity = 39/102 (38.24%), Postives = 62/102 (60.78%), Query Frame = 1
Query:  109 MCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIV 414
            + ELH++ VP + ++ R N      +   ISAGF+R+D++  + DLR E+   LG + I + Y+F K VGR  A V+ +QE  L VK F PP +  PE++++
Sbjct:   14 LVELHVFFVPEDQFDRRLNKVSAAAVDSFISAGFIRVDSEASLSDLRSELGSILGLDRIAEKYIFLKCVGRSFALVKLRQERELTVKSFTPPFAPFPEIYLL 115          
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Zebrafish
Match: SPATA1 (si:dkey-205k8.5 [Source:ZFIN;Acc:ZDB-GENE-141216-11])

HSP 1 Score: 57.3806 bits (137), Expect = 1.306e-9
Identity = 27/67 (40.30%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  214 RIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIV 414
            R+D++  + DLR E+   LG + I + Y+F K VGR  A V+ +QE  L VK F PP +  PE++++
Sbjct:   12 RVDSEASLSDLRSELGSILGLDRIAEKYIFLKCVGRSFALVKLRQERELTVKSFTPPFAPFPEIYLL 78          
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Xenopus
Match: SPATA1 (spermatogenesis associated 1 [Source:NCBI gene;Acc:100498562])

HSP 1 Score: 50.8322 bits (120), Expect = 3.103e-7
Identity = 25/57 (43.86%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  244 LRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIV 414
            LR  +   LG ++I   + F K VGR LA V+ KQE  LK+K F PP +  PEL+++
Sbjct:    6 LRERLGEFLGDDIILDKFAFLKCVGRSLAVVKAKQEQELKLKSFAPPYAAQPELYLL 62          
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Mouse
Match: Spata1 (spermatogenesis associated 1 [Source:MGI Symbol;Acc:MGI:1918201])

HSP 1 Score: 82.8037 bits (203), Expect = 2.653e-18
Identity = 41/109 (37.61%), Postives = 65/109 (59.63%), Query Frame = 1
Query:   88 RPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIV 414
            RP SS  + ELH++ VP   W  + N    ++I+  ISAGF+R+     +  LR  +   LG + + + ++F K +G  LA V+EKQE+ LK+K F PP +  PEL+++
Sbjct:    7 RP-SSSELVELHVFYVPEGSWNYKLNTISIEVINNFISAGFIRVSPQLTLQALRERLGEFLGVDAVAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLL 114          
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Mouse
Match: Spata1 (spermatogenesis associated 1 [Source:MGI Symbol;Acc:MGI:1918201])

HSP 1 Score: 82.8037 bits (203), Expect = 2.653e-18
Identity = 41/109 (37.61%), Postives = 65/109 (59.63%), Query Frame = 1
Query:   88 RPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIV 414
            RP SS  + ELH++ VP   W  + N    ++I+  ISAGF+R+     +  LR  +   LG + + + ++F K +G  LA V+EKQE+ LK+K F PP +  PEL+++
Sbjct:    7 RP-SSSELVELHVFYVPEGSWNYKLNTISIEVINNFISAGFIRVSPQLTLQALRERLGEFLGVDAVAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLL 114          
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Mouse
Match: Spata1 (spermatogenesis associated 1 [Source:MGI Symbol;Acc:MGI:1918201])

HSP 1 Score: 74.3294 bits (181), Expect = 3.635e-17
Identity = 38/99 (38.38%), Postives = 58/99 (58.59%), Query Frame = 1
Query:   88 RPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPP 384
            RP SS  + ELH++ VP   W  + N    ++I+  ISAGF+R+     +  LR  +   LG + + + ++F K +G  LA V+EKQE+ LK+K F PP
Sbjct:    7 RPSSS-ELVELHVFYVPEGSWNYKLNTISIEVINNFISAGFIRVSPQLTLQALRERLGEFLGVDAVAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPP 104          
BLAST of Spermatogenesis-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q5VX52|SPAT1_HUMAN (Spermatogenesis-associated protein 1 OS=Homo sapiens OX=9606 GN=SPATA1 PE=2 SV=4)

HSP 1 Score: 88.5817 bits (218), Expect = 1.779e-19
Identity = 54/159 (33.96%), Postives = 89/159 (55.97%), Query Frame = 1
Query:   22 RNLLSNFNFTMSVLSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELF---IVDSLVAKRSPTS---DSRKTNSSNSE 480
            RN +   N+ +  L +   +  RP SS  + ELH++ VP   W  + N    +++++ ISAGF+R+     +  LR  +   LG + I + ++F K +G  LA V+EKQE+ LK+K F PP +  PEL+   ++D L    SP++   D R+TN+  +E
Sbjct:    7 RNKIPIDNYPIQTLVNMSLNPSRP-SSSELVELHVFYVPEGSWNYKLNTISTEVVNKFISAGFLRVSPQLTLRALRERLGEFLGEDAIAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLLPVMDHLGNVYSPSTVILDERQTNNGVNE 164          
BLAST of Spermatogenesis-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q9D5R4|SPAT1_MOUSE (Spermatogenesis-associated protein 1 OS=Mus musculus OX=10090 GN=Spata1 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.856e-17
Identity = 41/109 (37.61%), Postives = 65/109 (59.63%), Query Frame = 1
Query:   88 RPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIV 414
            RP SS  + ELH++ VP   W  + N    ++I+  ISAGF+R+     +  LR  +   LG + + + ++F K +G  LA V+EKQE+ LK+K F PP +  PEL+++
Sbjct:    7 RP-SSSELVELHVFYVPEGSWNYKLNTISIEVINNFISAGFIRVSPQLTLQALRERLGEFLGVDAVAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLL 114          
BLAST of Spermatogenesis-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q6AY22|SPAT1_RAT (Spermatogenesis-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Spata1 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.740e-17
Identity = 41/109 (37.61%), Postives = 65/109 (59.63%), Query Frame = 1
Query:   88 RPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIV 414
            RP SS  + ELH++ VP   W  + N    ++I+  ISAGF+R+     +  LR  +   LG + + + ++F K +G  LA V+EKQE+ LK+K F PP +  PEL+++
Sbjct:    7 RP-SSSELVELHVFYVPEGSWNYKLNTISIEVINNFISAGFIRVSPQLTLQALRERLGEFLGVDAVAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLL 114          
BLAST of Spermatogenesis-associated protein 1 vs. TrEMBL
Match: A0A1I8IF45 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 7.987e-45
Identity = 69/126 (54.76%), Postives = 98/126 (77.78%), Query Frame = 1
Query:  100 SGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSLVAKRSPTSDSRKTNSSNS 477
            S  M +LH+YVVPP LW+ER + AFNQII ET+SAGF+R+  ++ +  +R +I+RQLG E++P+++VFCKSVGRCL QVR +QE  LKVKHFLPP+++CPE+F++D  +A+RS +S      S+ S
Sbjct:   12 SEQMVDLHVYVVPPALWQERLHSAFNQIIGETVSAGFIRVFPESLLQQVRSDIERQLGYEIVPRNFVFCKSVGRCLTQVRSRQEKELKVKHFLPPHAYCPEIFVLDYDIARRSQSSSDGSIASNRS 137          
BLAST of Spermatogenesis-associated protein 1 vs. TrEMBL
Match: A0A267GYE7 (SPATA1_C domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003676g1 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 1.344e-44
Identity = 77/148 (52.03%), Postives = 106/148 (71.62%), Query Frame = 1
Query:   40 FNFTMSVLSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSLVAKRSPTSD--SRKTNSSNS 477
            F  T  ++++ R  Y+ P  S  + +LHIYVVP  LW +R   AFNQ+I E++SAGFVR+  D  +  LR EI++QLG EV+P+ +V+CKSVGRCL QVR  QE  +KVKHFLPP+++CPE+F++DS VA+RS TS   S  +N SN+
Sbjct:   20 FTLTKEIMNYDRPTYRPP--SEQLVDLHIYVVPAYLWHDRLRSAFNQVIGESVSAGFVRVPPDIHLDHLRSEIEKQLGFEVVPRSFVYCKSVGRCLTQVRGHQEQEMKVKHFLPPHAYCPEIFVLDSEVARRSQTSSNGSMASNRSNN 165          
BLAST of Spermatogenesis-associated protein 1 vs. TrEMBL
Match: A0A267FRY9 (SPATA1_C domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003676g2 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 6.552e-44
Identity = 77/148 (52.03%), Postives = 105/148 (70.95%), Query Frame = 1
Query:   40 FNFTMSVLSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSLVAKRSPTSD--SRKTNSSNS 477
            F  T   +++ R  Y+ P  S  + +LHIYVVP  LW +R   AFNQ+I E++SAGFVR+  D  +  LR EI++QLG EV+P+ +V+CKSVGRCL QVR  QE  +KVKHFLPP+++CPE+F++DS VA+RS TS   S  +N SN+
Sbjct:   15 FTLTKERMNYDRPTYRPP--SEQLVDLHIYVVPAYLWHDRLRSAFNQVIGESVSAGFVRVPPDIHLDHLRSEIEKQLGFEVVPRSFVYCKSVGRCLTQVRGHQEQEMKVKHFLPPHAYCPEIFVLDSEVARRSQTSSNGSMASNRSNN 160          
BLAST of Spermatogenesis-associated protein 1 vs. TrEMBL
Match: A0A1I8I6D8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 4.312e-35
Identity = 62/120 (51.67%), Postives = 84/120 (70.00%), Query Frame = 1
Query:  118 LHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSLVAKRSPTSDSRKTNSSNS 477
            LH+YVVPP LW+ER + AFNQII ET+                R +I+RQLG E++P+++VFCKSVGRCL QVR +QE  LKVKHFLPP+++CPE+F++D  +A+RS +S      S+ S
Sbjct:    1 LHVYVVPPALWQERLHSAFNQIIGETV----------------RSDIERQLGYEIVPRNFVFCKSVGRCLTQVRSRQEKELKVKHFLPPHAYCPEIFVLDYDIARRSQSSSDGSIASNRS 104          
BLAST of Spermatogenesis-associated protein 1 vs. TrEMBL
Match: K1S5U0 (Spermatogenesis-associated protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10021364 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 6.068e-35
Identity = 59/122 (48.36%), Postives = 91/122 (74.59%), Query Frame = 1
Query:   52 MSVLSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVD 417
            MS L      ++RP SSG + +LH+Y+VPPE+W ER N   NQ ++ETISAG +R+  + FV DLR E+++Q+G +++P+DYVF KSVGR + ++++KQE  LK KHF+PP ++ PEL++++
Sbjct:    1 MSSLMERYKTFKRP-SSGELIDLHVYIVPPEIWRERYNNLLNQNVTETISAGIIRVHPERFVYDLRNELEQQVGEDMLPRDYVFLKSVGRSITRLKQKQEYQLKAKHFIPPQAYAPELYLLE 121          
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Cavefish
Match: si:dkey-205k8.5 (spermatogenesis associated 1 [Source:NCBI gene;Acc:103031330])

HSP 1 Score: 84.3445 bits (207), Expect = 5.328e-19
Identity = 48/112 (42.86%), Postives = 63/112 (56.25%), Query Frame = 1
Query:   82 YQRPQSSGNMC-ELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIV 414
            Y   +S  + C ELH++ VP E W  R N    + I   ISAGF+R+  D  +  +R E+   LG + I   Y F K VGR LA V+ KQE  LKVK F PP S  PEL+++
Sbjct:    4 YMGERSRSSECVELHVFFVPDEQWNSRLNKVSVEAIDSFISAGFIRVYPDISLKTVRDELGALLGLDRITDKYCFLKCVGRSLALVKAKQEKDLKVKSFAPPYSPYPELYLL 115          
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Cavefish
Match: si:dkey-205k8.5 (spermatogenesis associated 1 [Source:NCBI gene;Acc:103031330])

HSP 1 Score: 58.151 bits (139), Expect = 5.898e-10
Identity = 36/100 (36.00%), Postives = 48/100 (48.00%), Query Frame = 1
Query:  115 ELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIV 414
            ELH++ VP E W  R N    + I   ISAGF+R+  D  +  +R E+   LG + I   Y F K VGR LA V              P  S  PEL+++
Sbjct:    8 ELHVFFVPDEQWNSRLNKVSVEAIDSFISAGFIRVYPDISLKTVRDELGALLGLDRITDKYCFLKCVGRSLALVS------------CPQRSPYPELYLL 95          
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Nematostella
Match: EDO46192 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQN1])

HSP 1 Score: 116.316 bits (290), Expect = 2.287e-30
Identity = 55/115 (47.83%), Postives = 81/115 (70.43%), Query Frame = 1
Query:   79 DYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSL 423
            D  R Q S  + +LHI+VVP +LW ++   AFN +  E++SAGFVR+  D  + +LR  I+ QLG +++P+D+VF +SVGRC+A V+E QE+LLK   FLPP +F PE+F++  L
Sbjct:    5 DSGRSQPS-KVADLHIFVVPLDLWLDKYRTAFNNVALESVSAGFVRVLPDITLRNLRGCIEDQLGDDIVPEDFVFLRSVGRCMAVVKENQESLLKASDFLPPIAFSPEIFLLPGL 118          
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Medaka
Match: si:dkey-205k8.5 (spermatogenesis associated 1 [Source:NCBI gene;Acc:101173620])

HSP 1 Score: 87.0409 bits (214), Expect = 6.244e-20
Identity = 57/146 (39.04%), Postives = 82/146 (56.16%), Query Frame = 1
Query:   61 LSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISET----ISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSLVAKRSPTSD--SRKTNSSNSE 480
            ++H+ +D +RP +S    ELH+  VP + W    N+  N++ +ET    ISAGF+R   D  +  LR E+D  LG +     Y F K VGR LA V+  QE  LKVK F PP +  PEL+++ ++ A  S  S   S  T SS++E
Sbjct:    8 MTHTEDD-RRP-TSCKFVELHVLCVPGDQW----NVKLNKVPAETSESFISAGFIRAYPDLTLKRLRTELDTHLGGDRSTNKYSFLKCVGRSLALVKRNQEKELKVKLFAPPYAAQPELYLLPAMEADGSSCSRSFSLDTGSSSTE 147          
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Medaka
Match: si:dkey-205k8.5 (spermatogenesis associated 1 [Source:NCBI gene;Acc:101173620])

HSP 1 Score: 87.0409 bits (214), Expect = 6.299e-20
Identity = 57/146 (39.04%), Postives = 82/146 (56.16%), Query Frame = 1
Query:   61 LSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISET----ISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSLVAKRSPTSD--SRKTNSSNSE 480
            ++H+ +D +RP +S    ELH+  VP + W    N+  N++ +ET    ISAGF+R   D  +  LR E+D  LG +     Y F K VGR LA V+  QE  LKVK F PP +  PEL+++ ++ A  S  S   S  T SS++E
Sbjct:   13 MTHTEDD-RRP-TSCKFVELHVLCVPGDQW----NVKLNKVPAETSESFISAGFIRAYPDLTLKRLRTELDTHLGGDRSTNKYSFLKCVGRSLALVKRNQEKELKVKLFAPPYAAQPELYLLPAMEADGSSCSRSFSLDTGSSSTE 152          
BLAST of Spermatogenesis-associated protein 1 vs. Planmine SMEST
Match: SMESG000049418.1 (SMESG000049418.1)

HSP 1 Score: 343.584 bits (880), Expect = 1.254e-114
Identity = 157/157 (100.00%), Postives = 157/157 (100.00%), Query Frame = 1
Query:   52 MSVLSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSLVAKRSPTSDSRKTNSSNSERPYLTDPYIYFRGP 522
            MSVLSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSLVAKRSPTSDSRKTNSSNSERPYLTDPYIYFRGP
Sbjct:    1 MSVLSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSLVAKRSPTSDSRKTNSSNSERPYLTDPYIYFRGP 157          
BLAST of Spermatogenesis-associated protein 1 vs. Planmine SMEST
Match: SMESG000049418.1 (SMESG000049418.1)

HSP 1 Score: 235.728 bits (600), Expect = 2.079e-80
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
Query:   52 MSVLSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPN 387
            MSVLSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPN
Sbjct:    1 MSVLSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPN 112          
BLAST of Spermatogenesis-associated protein 1 vs. Planmine SMEST
Match: SMESG000004654.1 (SMESG000004654.1)

HSP 1 Score: 154.836 bits (390), Expect = 7.659e-45
Identity = 71/121 (58.68%), Postives = 92/121 (76.03%), Query Frame = 1
Query:   85 QRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSLVAKRSPTS 447
            +RPQS   + ELH+YV+P  LW+++   A NQ+IS+TISAGF+R+  D  +  LR EI +QLGA+VIP++Y+FCKSVGRCL QVR  QE+LLK  HFLPPNS+CPELF++D   A RS  S
Sbjct:    3 ERPQSE-KLIELHVYVIPSVLWQDKLRSAVNQVISDTISAGFIRVRPDANLEYLRDEISKQLGADVIPREYIFCKSVGRCLTQVRVNQESLLKAYHFLPPNSYCPELFLLDLDTASRSTPS 122          
BLAST of Spermatogenesis-associated protein 1 vs. Planmine SMEST
Match: SMESG000061267.1 (SMESG000061267.1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.440e-16
Identity = 38/104 (36.54%), Postives = 66/104 (63.46%), Query Frame = 1
Query:  115 ELHIYVVPPELWEERQNLAFNQI-ISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSL 423
            ++H+Y +P EL+ +  N + N+  + + IS GF+R    T + D+R  I  ++ ++++PK+YVFC+ VG  +  +  K E  +K+  FLPPNS+ PELFI ++ 
Sbjct:   19 DIHLYFIPNELFND--NFSDNKSKLQKCISLGFLRTSPITTLPDVRKLIASEIESDLVPKNYVFCRFVGESIDSI--KSETTMKILAFLPPNSYQPELFIGEAF 118          
BLAST of Spermatogenesis-associated protein 1 vs. Planmine SMEST
Match: SMESG000061267.1 (SMESG000061267.1)

HSP 1 Score: 71.633 bits (174), Expect = 4.136e-16
Identity = 38/104 (36.54%), Postives = 66/104 (63.46%), Query Frame = 1
Query:  115 ELHIYVVPPELWEERQNLAFNQI-ISETISAGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQENLLKVKHFLPPNSFCPELFIVDSL 423
            ++H+Y +P EL+ +  N + N+  + + IS GF+R    T + D+R  I  ++ ++++PK+YVFC+ VG  +  +  K E  +K+  FLPPNS+ PELFI ++ 
Sbjct:   26 DIHLYFIPNELFND--NFSDNKSKLQKCISLGFLRTSPITTLPDVRKLIASEIESDLVPKNYVFCRFVGESIDSI--KSETTMKILAFLPPNSYQPELFIGEAF 125          
The following BLAST results are available for this feature:
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SPATA13.704e-2033.96spermatogenesis associated 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SPATA11.916e-1838.24si:dkey-205k8.5 [Source:ZFIN;Acc:ZDB-GENE-141216-1... [more]
SPATA11.306e-940.30si:dkey-205k8.5 [Source:ZFIN;Acc:ZDB-GENE-141216-1... [more]
back to top
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SPATA13.103e-743.86spermatogenesis associated 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Spata12.653e-1837.61spermatogenesis associated 1 [Source:MGI Symbol;Ac... [more]
Spata12.653e-1837.61spermatogenesis associated 1 [Source:MGI Symbol;Ac... [more]
Spata13.635e-1738.38spermatogenesis associated 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Spermatogenesis-associated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q5VX52|SPAT1_HUMAN1.779e-1933.96Spermatogenesis-associated protein 1 OS=Homo sapie... [more]
sp|Q9D5R4|SPAT1_MOUSE1.856e-1737.61Spermatogenesis-associated protein 1 OS=Mus muscul... [more]
sp|Q6AY22|SPAT1_RAT2.740e-1737.61Spermatogenesis-associated protein 1 OS=Rattus nor... [more]
back to top
BLAST of Spermatogenesis-associated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IF457.987e-4554.76Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GYE71.344e-4452.03SPATA1_C domain-containing protein (Fragment) OS=M... [more]
A0A267FRY96.552e-4452.03SPATA1_C domain-containing protein (Fragment) OS=M... [more]
A0A1I8I6D84.312e-3551.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
K1S5U06.068e-3548.36Spermatogenesis-associated protein 1 OS=Crassostre... [more]
back to top
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-205k8.55.328e-1942.86spermatogenesis associated 1 [Source:NCBI gene;Acc... [more]
si:dkey-205k8.55.898e-1036.00spermatogenesis associated 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO461922.287e-3047.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Spermatogenesis-associated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-205k8.56.244e-2039.04spermatogenesis associated 1 [Source:NCBI gene;Acc... [more]
si:dkey-205k8.56.299e-2039.04spermatogenesis associated 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Spermatogenesis-associated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049418.11.254e-114100.00SMESG000049418.1[more]
SMESG000049418.12.079e-80100.00SMESG000049418.1[more]
SMESG000004654.17.659e-4558.68SMESG000004654.1[more]
SMESG000061267.12.440e-1636.54SMESG000061267.1[more]
SMESG000061267.14.136e-1636.54SMESG000061267.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028825 ID=SMED30028825|Name=Spermatogenesis-associated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=577bp
TTTTAAATATTATTTTTGATAAGAAATTTGTTGTCAAATTTCAATTTTAC
GATGAGCGTTCTATCTCATTCGAGAAATGATTATCAAAGGCCTCAGTCAT
CGGGAAATATGTGTGAACTGCACATTTACGTAGTGCCACCAGAATTATGG
GAAGAGCGACAAAACTTAGCTTTCAATCAAATTATAAGTGAAACAATTTC
TGCTGGATTTGTGAGAATAGATGCCGACACATTTGTTGGAGATCTGCGAT
TGGAAATTGACAGGCAACTAGGAGCAGAAGTCATTCCGAAGGACTATGTA
TTTTGCAAGAGTGTGGGTCGGTGTCTCGCCCAGGTGCGAGAGAAACAGGA
AAACCTTCTGAAAGTCAAACATTTCCTTCCACCAAATTCTTTTTGTCCCG
AACTCTTTATTGTTGATAGTTTGGTGGCTAAACGTAGTCCAACATCGGAC
AGTAGAAAAACAAATTCCTCAAATTCTGAAAGGCCTTACTTAACAGACCC
GTATATATATTTCCGAGGCCCAGGTAATTCCAAATAAAATATTCATTCTC
ATACAATTAAATATTACAGAGTTAGGG
back to top

protein sequence of SMED30028825-orf-1

>SMED30028825-orf-1 ID=SMED30028825-orf-1|Name=SMED30028825-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=162bp
MSVLSHSRNDYQRPQSSGNMCELHIYVVPPELWEERQNLAFNQIISETIS
AGFVRIDADTFVGDLRLEIDRQLGAEVIPKDYVFCKSVGRCLAQVREKQE
NLLKVKHFLPPNSFCPELFIVDSLVAKRSPTSDSRKTNSSNSERPYLTDP
YIYFRGPGNSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR039062SPAT1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR039062Spermatogenesis-associated protein 1PANTHERPTHR14421SPERMATOGENESIS-ASSOCIATED PROTEIN 1coord: 10..139