F-box/LRR-repeat protein 7

Overview
NameF-box/LRR-repeat protein 7
Smed IDSMED30028816
Length (bp)2139
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of F-box/LRR-repeat protein 7 (SMED30028816) t-SNE clustered cells

Violin plots show distribution of expression levels for F-box/LRR-repeat protein 7 (SMED30028816) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of F-box/LRR-repeat protein 7 (SMED30028816) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for F-box/LRR-repeat protein 7 (SMED30028816) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028816

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30028816SMESG000053104.1 dd_Smed_v4_10647_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30028816SMESG000053104.1 dd_Smed_v4_10647_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028816SMESG000053104.1 dd_Smed_v4_10647_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30028816SMESG000053104.1 dd_Smed_v4_10647_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30028816SMESG000053104.1 dd_Smed_v4_10647_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the whole animalSMED30028816SMESG000053104.1 dd_Smed_v4_10647_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermis progenitor cellSMED30028816SMESG000053104.1 dd_Smed_v4_10647_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Human
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 195.667 bits (496), Expect = 3.230e-54
Identity = 108/379 (28.50%), Postives = 199/379 (52.51%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            +R P   +++IF  L    +  C++ CR WY +AW P LW  I      L  +  +++  +K L   L  +    C ++ +V +  C  LTD  +  I+  CP ++   +  C+ ISN ++F ++S C  L+ L V GC  ++ I+   E+ I    +  K+  +  L+++ C +++D  L   A     +  L LR C R++D G+ Y+V YC +++E+S++    +SD  +  I+ KL   LRYLS+A+C R+TD  +  +A  C  L+YLN   C+ ITD G+  LA +  T+L SL++  CP ++   +  L+  C N+++L +  C  I+ + ++ +  +   L+ +N+ +   ++ +   + +    C I H 
Sbjct:  115 DRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIR-----LTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIA-KLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNC-TKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHT 486          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Human
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 194.126 bits (492), Expect = 3.433e-54
Identity = 108/379 (28.50%), Postives = 199/379 (52.51%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            +R P   +++IF  L    +  C++ CR WY +AW P LW  I      L  +  +++  +K L   L  +    C ++ +V +  C  LTD  +  I+  CP ++   +  C+ ISN ++F ++S C  L+ L V GC  ++ I+   E+ I    +  K+  +  L+++ C +++D  L   A     +  L LR C R++D G+ Y+V YC +++E+S++    +SD  +  I+ KL   LRYLS+A+C R+TD  +  +A  C  L+YLN   C+ ITD G+  LA +  T+L SL++  CP ++   +  L+  C N+++L +  C  I+ + ++ +  +   L+ +N+ +   ++ +   + +    C I H 
Sbjct:   68 DRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIR-----LTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIA-KLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNC-TKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHT 439          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Human
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 194.126 bits (492), Expect = 4.048e-54
Identity = 108/379 (28.50%), Postives = 199/379 (52.51%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            +R P   +++IF  L    +  C++ CR WY +AW P LW  I      L  +  +++  +K L   L  +    C ++ +V +  C  LTD  +  I+  CP ++   +  C+ ISN ++F ++S C  L+ L V GC  ++ I+   E+ I    +  K+  +  L+++ C +++D  L   A     +  L LR C R++D G+ Y+V YC +++E+S++    +SD  +  I+ KL   LRYLS+A+C R+TD  +  +A  C  L+YLN   C+ ITD G+  LA +  T+L SL++  CP ++   +  L+  C N+++L +  C  I+ + ++ +  +   L+ +N+ +   ++ +   + +    C I H 
Sbjct:   73 DRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIR-----LTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIA-KLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNC-TKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHT 444          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Human
Match: FBXL2 (F-box and leucine rich repeat protein 2 [Source:HGNC Symbol;Acc:HGNC:13598])

HSP 1 Score: 130.954 bits (328), Expect = 5.157e-32
Identity = 96/369 (26.02%), Postives = 179/369 (48.51%), Query Frame = 2
Query:  800 YSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            +S+ND     L  ++ P ++L++IF  L I  +  C+Q  + W  +A     W  ID   +      TD+  ++ + +    G        +  + L  C  + D S+   + +C NI++ ++  C  I++ + + +   C +LK L +  C  I+  +    S+  +  E+    LNLS+C  +    +       + ++ LLLR C ++ D  + +I  YC  L  ++L    +I+DE +  I    +  L+ L L+ C+ +TD SL +L  NC  LQ L   +C  +TD+G   LA +    L  +++  C  IT  ++  LS +CP +Q L ++ C LI+D+ +  +    C H  +L+++ +DN
Sbjct:    3 FSNND---EGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNF-----QTDVEGRVVENISKRCGG------FLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEY----LNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHR-LQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCH-ELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGH-ERLRVLELDN 350          

HSP 2 Score: 75.0998 bits (183), Expect = 1.494e-13
Identity = 57/210 (27.14%), Postives = 96/210 (45.71%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKL--NENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGI 1684
            YC  + S+ L  C+ +TDE V+ I   C  ++   +  C  +++ S+  +   C  L+ L                                + C  + DA   + A     +EK+ L  C  I+D+ +  +  +C  L+ +SL+H E I+D+ I ++S     +E LR L L NC  ITD +L  L +NC  L+ L L+ C+ +T +GI
Sbjct:  206 YCHELVSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEA------------------------------ARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALEHL-ENCRGLERLELYDCQQVTRAGI 384          

HSP 3 Score: 68.1662 bits (165), Expect = 2.211e-11
Identity = 48/150 (32.00%), Postives = 82/150 (54.67%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINI-------DNTSATIRSY--DLITKTFPSCS 1951
            NIS++    LR LSL  C  + D+SL + A NC N+++LNL+ C  ITDS   SL+    ++L  L+++ C  IT+ S+  +S  C N++ L+++ C  I+ + +E +      LK + +       D     I++Y  +L++    SCS
Sbjct:   71 NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS-RFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCS 219          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Human
Match: FBXL20 (F-box and leucine rich repeat protein 20 [Source:HGNC Symbol;Acc:HGNC:24679])

HSP 1 Score: 119.783 bits (299), Expect = 3.625e-28
Identity = 87/356 (24.44%), Postives = 168/356 (47.19%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            ++ P ++L++IF  L +  +  C+Q  R W  +A     W  ID   +       DI  ++ + +    G        +  + L  C  + D ++   + +C NI+  ++  C   ++ +   +   C +L+ L +  C  I+ ++    S+       +L  LN+S+C  V    +         ++ L L+ C ++ D  + YI  +C  L  ++L    +I+DE +  I    ++ L+ L  + C+ ITD  L +L  NC  L+ L + +C  +TD G  +LA +    L  +++  C QIT  ++  LS +CP +Q L ++ C LI+D+ +  +    C H  +L++I +DN
Sbjct:   28 KKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDF-----QRDIEGRVVENISKRCGG------FLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCP----LLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHK-LQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCH-ELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAH-DQLEVIELDN 365          

HSP 2 Score: 98.5969 bits (244), Expect = 3.838e-21
Identity = 72/278 (25.90%), Postives = 135/278 (48.56%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEF---VLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSL--AISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKM 1879
            +C  +  + L  CT +T+ S+  +S  CP ++  +I  C  ++   I  ++  CG LK L ++GC       T  E + +K+       L  LNL  C  + D  LI        ++ L    C  I+D  ++ + + C  LR + +    +++D     ++   +E L  + L  C +ITD++L+ L+ +C  LQ L+L  C+LITD GI  L        +L  + +  CP IT  S+  L + C +++++++  C  I+   ++ +  H+  +K+
Sbjct:  143 FCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGC-------TQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHE-LEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHL-KSCHSLERIELYDCQQITRAGIKRLRTHLPNIKV 411          

HSP 3 Score: 72.0182 bits (175), Expect = 1.357e-12
Identity = 51/178 (28.65%), Postives = 83/178 (46.63%), Query Frame = 2
Query: 1397 MEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLIT 1930
            + KL LR C  + D  +    + C+N+  ++LN   K +D +  ++S K    LR+L LA+CT IT+ SL +L++ C  L+                            LN+S+C Q+T   +  L R C  ++ L +  C  + DEA++ I  H  +L  +N+  T   I    LIT
Sbjct:   95 LRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLS-KFCSKLRHLDLASCTSITNMSLKALSEGCPLLE---------------------------QLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNL-QTCLQITDEGLIT 243          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 127.102 bits (318), Expect = 7.175e-31
Identity = 87/350 (24.86%), Postives = 176/350 (50.29%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEIC-EHIIKLKMINIDN 1894
            P ++L+K+F  L  K +   +Q CR+W  +A     W  +D   +    K   +      L    GG        +  + L  C  + D ++   ++ CPN+++ S+ +C  +++ S  ++   C +L  L++E C  I+        D        LS LN+S+C  + D  + I     K+++ L+LR C  +++     +  +   +++++L    +++D ++ NI+      L YL ++NC +I+D SL+SL  +  NL+ L L  C L+ D+G + LA   + +L  L++  C  I+  +++ L+  C  +++L ++ C LI+DE+++ +  +H   L ++ +DN
Sbjct:   61 PKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDLFTFQRDVKTAVVE----NLARRCGG-------FLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPN----LSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATA-LEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCR-QLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDN 393          

HSP 2 Score: 115.546 bits (288), Expect = 4.593e-27
Identity = 78/271 (28.78%), Postives = 141/271 (52.03%), Query Frame = 2
Query: 1049 NRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEH 1861
            N   YC  ++ + L+ C+ +TD ++ +I + CPN+   +I  C  I +  +  ILS C  L  L + GC+ ++  N       V+     +  LNL  C  + D ++   A     +E L + NC++ISD  +  + ++  NL+ + L+    + D     ++    + L  L + +C+ I+D+++ SLA+NC  L+ L+L  C+LITD  I +LA   +  L  L +  CPQ+T  ++S L R+C  ++++D+  C  +S EA+     H
Sbjct:  169 NLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTE-NVFGS---VEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQ-LERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHL-RHCKALKRIDLYDCQNVSKEAIVRFQHH 433          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 127.102 bits (318), Expect = 7.175e-31
Identity = 87/350 (24.86%), Postives = 176/350 (50.29%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEIC-EHIIKLKMINIDN 1894
            P ++L+K+F  L  K +   +Q CR+W  +A     W  +D   +    K   +      L    GG        +  + L  C  + D ++   ++ CPN+++ S+ +C  +++ S  ++   C +L  L++E C  I+        D        LS LN+S+C  + D  + I     K+++ L+LR C  +++     +  +   +++++L    +++D ++ NI+      L YL ++NC +I+D SL+SL  +  NL+ L L  C L+ D+G + LA   + +L  L++  C  I+  +++ L+  C  +++L ++ C LI+DE+++ +  +H   L ++ +DN
Sbjct:   61 PKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDLFTFQRDVKTAVVE----NLARRCGG-------FLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPN----LSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATA-LEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCR-QLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDN 393          

HSP 2 Score: 115.546 bits (288), Expect = 4.593e-27
Identity = 78/271 (28.78%), Postives = 141/271 (52.03%), Query Frame = 2
Query: 1049 NRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEH 1861
            N   YC  ++ + L+ C+ +TD ++ +I + CPN+   +I  C  I +  +  ILS C  L  L + GC+ ++  N       V+     +  LNL  C  + D ++   A     +E L + NC++ISD  +  + ++  NL+ + L+    + D     ++    + L  L + +C+ I+D+++ SLA+NC  L+ L+L  C+LITD  I +LA   +  L  L +  CPQ+T  ++S L R+C  ++++D+  C  +S EA+     H
Sbjct:  169 NLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTE-NVFGS---VEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQ-LERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHL-RHCKALKRIDLYDCQNVSKEAIVRFQHH 433          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 127.102 bits (318), Expect = 7.175e-31
Identity = 87/350 (24.86%), Postives = 176/350 (50.29%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEIC-EHIIKLKMINIDN 1894
            P ++L+K+F  L  K +   +Q CR+W  +A     W  +D   +    K   +      L    GG        +  + L  C  + D ++   ++ CPN+++ S+ +C  +++ S  ++   C +L  L++E C  I+        D        LS LN+S+C  + D  + I     K+++ L+LR C  +++     +  +   +++++L    +++D ++ NI+      L YL ++NC +I+D SL+SL  +  NL+ L L  C L+ D+G + LA   + +L  L++  C  I+  +++ L+  C  +++L ++ C LI+DE+++ +  +H   L ++ +DN
Sbjct:   61 PKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDLFTFQRDVKTAVVE----NLARRCGG-------FLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPN----LSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATA-LEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCR-QLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDN 393          

HSP 2 Score: 115.546 bits (288), Expect = 4.593e-27
Identity = 78/271 (28.78%), Postives = 141/271 (52.03%), Query Frame = 2
Query: 1049 NRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEH 1861
            N   YC  ++ + L+ C+ +TD ++ +I + CPN+   +I  C  I +  +  ILS C  L  L + GC+ ++  N       V+     +  LNL  C  + D ++   A     +E L + NC++ISD  +  + ++  NL+ + L+    + D     ++    + L  L + +C+ I+D+++ SLA+NC  L+ L+L  C+LITD  I +LA   +  L  L +  CPQ+T  ++S L R+C  ++++D+  C  +S EA+     H
Sbjct:  169 NLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTE-NVFGS---VEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQ-LERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHL-RHCKALKRIDLYDCQNVSKEAIVRFQHH 433          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 127.102 bits (318), Expect = 7.175e-31
Identity = 87/350 (24.86%), Postives = 176/350 (50.29%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEIC-EHIIKLKMINIDN 1894
            P ++L+K+F  L  K +   +Q CR+W  +A     W  +D   +    K   +      L    GG        +  + L  C  + D ++   ++ CPN+++ S+ +C  +++ S  ++   C +L  L++E C  I+        D        LS LN+S+C  + D  + I     K+++ L+LR C  +++     +  +   +++++L    +++D ++ NI+      L YL ++NC +I+D SL+SL  +  NL+ L L  C L+ D+G + LA   + +L  L++  C  I+  +++ L+  C  +++L ++ C LI+DE+++ +  +H   L ++ +DN
Sbjct:   61 PKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDLFTFQRDVKTAVVE----NLARRCGG-------FLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPN----LSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATA-LEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCR-QLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDN 393          

HSP 2 Score: 115.546 bits (288), Expect = 4.593e-27
Identity = 78/271 (28.78%), Postives = 141/271 (52.03%), Query Frame = 2
Query: 1049 NRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEH 1861
            N   YC  ++ + L+ C+ +TD ++ +I + CPN+   +I  C  I +  +  ILS C  L  L + GC+ ++  N       V+     +  LNL  C  + D ++   A     +E L + NC++ISD  +  + ++  NL+ + L+    + D     ++    + L  L + +C+ I+D+++ SLA+NC  L+ L+L  C+LITD  I +LA   +  L  L +  CPQ+T  ++S L R+C  ++++D+  C  +S EA+     H
Sbjct:  169 NLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTE-NVFGS---VEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQ-LERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHL-RHCKALKRIDLYDCQNVSKEAIVRFQHH 433          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 125.946 bits (315), Expect = 1.716e-30
Identity = 87/350 (24.86%), Postives = 176/350 (50.29%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEIC-EHIIKLKMINIDN 1894
            P ++L+K+F  L  K +   +Q CR+W  +A     W  +D   +    K   +      L    GG        +  + L  C  + D ++   ++ CPN+++ S+ +C  +++ S  ++   C +L  L++E C  I+        D        LS LN+S+C  + D  + I     K+++ L+LR C  +++     +  +   +++++L    +++D ++ NI+      L YL ++NC +I+D SL+SL  +  NL+ L L  C L+ D+G + LA   + +L  L++  C  I+  +++ L+  C  +++L ++ C LI+DE+++ +  +H   L ++ +DN
Sbjct:   61 PKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDLFTFQRDVKTAVVE----NLARRCGG-------FLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPN----LSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATA-LEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCR-QLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDN 393          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Fly
Match: Fbxl7 (gene:FBgn0038385 transcript:FBtr0083201)

HSP 1 Score: 188.734 bits (478), Expect = 2.434e-50
Identity = 108/375 (28.80%), Postives = 192/375 (51.20%), Query Frame = 2
Query:  836 WERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHH 1960
            ++R P + +++IF  L   ++ N ++ CR +  +AW+P+LW  I      L    T           L G + N  CP V  V L     ++D+ +  ++  CP + +  ++ C  I+N ++   L+KC  L+ L V GC  +S+I+  P   +   +  +L  L+L+ C  +DD  L I       +  L LR C +++D G+ ++  +C +L+E+S++    I+D  +  ++ KL   LRYLS+A C R++D  L  +A  C  L+YLN   C+ ++D  I  LA S   RL +L++  C  ++   +  L+  CPN+++L +  C +I+D  V+ I  +   L+ +NI +   +I  Y  + K    C I H
Sbjct:  401 FDRLPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWKVISLRGEHLNGDKT----LKMIFRQLCGQSCNGACPEVERVMLADGCRISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSNLQHLDVTGCSQVSSIS--PNPHMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELA-KLGAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSC-PRLRALDIGKC-DVSDAGLRALAESCPNLKKLSLRSCDMITDRGVQCIAYYCRGLQQLNIQDCPVSIEGYRAVKKYCKRCIIEH 766          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Fly
Match: CG9003 (gene:FBgn0033639 transcript:FBtr0088088)

HSP 1 Score: 110.153 bits (274), Expect = 3.337e-25
Identity = 102/430 (23.72%), Postives = 184/430 (42.79%), Query Frame = 2
Query:  761 RRSTKKSKETQINYSDNDFYPTELKWE---RTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYC-PLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNIS------------------------------------------------EKLNENLRYLS---LANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAI-SIQTRLIS-LNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKM 1879
            R     +++   + S      TEL  E   + P ++L+++F  L +  +  C+Q C+ W  +A     W  I+   +    +   I             N +  C   + S+ L  C  + D+SV  ++N C NI++  +  C  I++IS   I   C +L  +++  C  I+  +    SD        L ++N+S+C ++ +  +   A     + K   + C +I+D  I  + +YC +L  ++L+  E I+D SI  ++                                                + L  N +YL    L  C++ITD +L  LA  C +L+ L L  C+LITD GI  L   S    ++S L +  CP IT R++  L   C N+Q++++  C LI+  A+ ++  H+  +K+
Sbjct:   25 RNMAGSAQDQSEDQSQTFLGATELDDELIKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEGPVIE------------NISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPN----LMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLEHLVS-CHNLQRIELFDCQLITRTAIRKLKNHLPNIKV 437          

HSP 2 Score: 88.1965 bits (217), Expect = 5.409e-18
Identity = 49/164 (29.88%), Postives = 95/164 (57.93%), Query Frame = 2
Query: 1397 MEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINI 1888
            ++ L LR C  + D  +  +  +C N+  + L+  +KI+D S  +IS   ++ L  ++L +C+ ITDNSL  L+D C NL  +N+  C LI+++G+ +LA     +L   +   C QI   ++  L++YCP++  L+++ C  I+D ++ ++  +  KL+ + +
Sbjct:  121 LKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSK-LTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARGC-VKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCV 282          

HSP 3 Score: 75.0998 bits (183), Expect = 8.167e-14
Identity = 51/150 (34.00%), Postives = 82/150 (54.67%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKL--------KMINIDNTSATIRSY--DLITKTFPSC 1948
            NIS++    L+ LSL  C  + D S+ +LA++C N+++L+L  CK ITD    S++    ++L ++N+  C  IT  S+  LS  CPN+ +++++ C LIS+  VE +    +KL        K IN DN    +  Y  DL+     SC
Sbjct:  112 NISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSIS-RYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQIN-DNAIMCLAKYCPDLMVLNLHSC 259          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Fly
Match: CG9003 (gene:FBgn0033639 transcript:FBtr0113067)

HSP 1 Score: 110.923 bits (276), Expect = 5.558e-25
Identity = 102/430 (23.72%), Postives = 184/430 (42.79%), Query Frame = 2
Query:  761 RRSTKKSKETQINYSDNDFYPTELKWE---RTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYC-PLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNIS------------------------------------------------EKLNENLRYLS---LANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAI-SIQTRLIS-LNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKM 1879
            R     +++   + S      TEL  E   + P ++L+++F  L +  +  C+Q C+ W  +A     W  I+   +    +   I             N +  C   + S+ L  C  + D+SV  ++N C NI++  +  C  I++IS   I   C +L  +++  C  I+  +    SD        L ++N+S+C ++ +  +   A     + K   + C +I+D  I  + +YC +L  ++L+  E I+D SI  ++                                                + L  N +YL    L  C++ITD +L  LA  C +L+ L L  C+LITD GI  L   S    ++S L +  CP IT R++  L   C N+Q++++  C LI+  A+ ++  H+  +K+
Sbjct:  212 RNMAGSAQDQSEDQSQTFLGATELDDELIKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEGPVIE------------NISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPN----LMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLEHLVS-CHNLQRIELFDCQLITRTAIRKLKNHLPNIKV 624          

HSP 2 Score: 89.3521 bits (220), Expect = 4.372e-18
Identity = 49/164 (29.88%), Postives = 95/164 (57.93%), Query Frame = 2
Query: 1397 MEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINI 1888
            ++ L LR C  + D  +  +  +C N+  + L+  +KI+D S  +IS   ++ L  ++L +C+ ITDNSL  L+D C NL  +N+  C LI+++G+ +LA     +L   +   C QI   ++  L++YCP++  L+++ C  I+D ++ ++  +  KL+ + +
Sbjct:  308 LKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSK-LTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARGC-VKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCV 469          

HSP 3 Score: 75.0998 bits (183), Expect = 1.071e-13
Identity = 51/150 (34.00%), Postives = 82/150 (54.67%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKL--------KMINIDNTSATIRSY--DLITKTFPSC 1948
            NIS++    L+ LSL  C  + D S+ +LA++C N+++L+L  CK ITD    S++    ++L ++N+  C  IT  S+  LS  CPN+ +++++ C LIS+  VE +    +KL        K IN DN    +  Y  DL+     SC
Sbjct:  299 NISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSIS-RYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQIN-DNAIMCLAKYCPDLMVLNLHSC 446          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Fly
Match: CG9003 (gene:FBgn0033639 transcript:FBtr0330632)

HSP 1 Score: 109.383 bits (272), Expect = 5.935e-25
Identity = 100/410 (24.39%), Postives = 178/410 (43.41%), Query Frame = 2
Query:  821 PTELKWE---RTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYC-PLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNIS------------------------------------------------EKLNENLRYLS---LANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAI-SIQTRLIS-LNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKM 1879
             TEL  E   + P ++L+++F  L +  +  C+Q C+ W  +A     W  I+   +    +   I             N +  C   + S+ L  C  + D+SV  ++N C NI++  +  C  I++IS   I   C +L  +++  C  I+  +    SD        L ++N+S+C ++ +  +   A     + K   + C +I+D  I  + +YC +L  ++L+  E I+D SI  ++                                                + L  N +YL    L  C++ITD +L  LA  C +L+ L L  C+LITD GI  L   S    ++S L +  CP IT R++  L   C N+Q++++  C LI+  A+ ++  H+  +K+
Sbjct:   18 ATELDDELIKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEGPVIE------------NISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPN----LMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLEHLVS-CHNLQRIELFDCQLITRTAIRKLKNHLPNIKV 410          

HSP 2 Score: 87.8113 bits (216), Expect = 6.346e-18
Identity = 49/164 (29.88%), Postives = 95/164 (57.93%), Query Frame = 2
Query: 1397 MEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINI 1888
            ++ L LR C  + D  +  +  +C N+  + L+  +KI+D S  +IS   ++ L  ++L +C+ ITDNSL  L+D C NL  +N+  C LI+++G+ +LA     +L   +   C QI   ++  L++YCP++  L+++ C  I+D ++ ++  +  KL+ + +
Sbjct:   94 LKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSK-LTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARGC-VKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCV 255          

HSP 3 Score: 74.7146 bits (182), Expect = 8.454e-14
Identity = 51/150 (34.00%), Postives = 82/150 (54.67%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKL--------KMINIDNTSATIRSY--DLITKTFPSC 1948
            NIS++    L+ LSL  C  + D S+ +LA++C N+++L+L  CK ITD    S++    ++L ++N+  C  IT  S+  LS  CPN+ +++++ C LIS+  VE +    +KL        K IN DN    +  Y  DL+     SC
Sbjct:   85 NISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSIS-RYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQIN-DNAIMCLAKYCPDLMVLNLHSC 232          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Fly
Match: CG9003 (gene:FBgn0033639 transcript:FBtr0113069)

HSP 1 Score: 108.997 bits (271), Expect = 6.507e-25
Identity = 100/410 (24.39%), Postives = 178/410 (43.41%), Query Frame = 2
Query:  821 PTELKWE---RTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYC-PLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNIS------------------------------------------------EKLNENLRYLS---LANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAI-SIQTRLIS-LNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKM 1879
             TEL  E   + P ++L+++F  L +  +  C+Q C+ W  +A     W  I+   +    +   I             N +  C   + S+ L  C  + D+SV  ++N C NI++  +  C  I++IS   I   C +L  +++  C  I+  +    SD        L ++N+S+C ++ +  +   A     + K   + C +I+D  I  + +YC +L  ++L+  E I+D SI  ++                                                + L  N +YL    L  C++ITD +L  LA  C +L+ L L  C+LITD GI  L   S    ++S L +  CP IT R++  L   C N+Q++++  C LI+  A+ ++  H+  +K+
Sbjct:   18 ATELDDELIKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEGPVIE------------NISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPN----LMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLEHLVS-CHNLQRIELFDCQLITRTAIRKLKNHLPNIKV 410          

HSP 2 Score: 87.4261 bits (215), Expect = 7.116e-18
Identity = 49/164 (29.88%), Postives = 95/164 (57.93%), Query Frame = 2
Query: 1397 MEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINI 1888
            ++ L LR C  + D  +  +  +C N+  + L+  +KI+D S  +IS   ++ L  ++L +C+ ITDNSL  L+D C NL  +N+  C LI+++G+ +LA     +L   +   C QI   ++  L++YCP++  L+++ C  I+D ++ ++  +  KL+ + +
Sbjct:   94 LKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSK-LTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARGC-VKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCV 255          

HSP 3 Score: 74.7146 bits (182), Expect = 9.243e-14
Identity = 51/150 (34.00%), Postives = 82/150 (54.67%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKL--------KMINIDNTSATIRSY--DLITKTFPSC 1948
            NIS++    L+ LSL  C  + D S+ +LA++C N+++L+L  CK ITD    S++    ++L ++N+  C  IT  S+  LS  CPN+ +++++ C LIS+  VE +    +KL        K IN DN    +  Y  DL+     SC
Sbjct:   85 NISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSIS-RYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQIN-DNAIMCLAKYCPDLMVLNLHSC 232          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Zebrafish
Match: fbxl7 (F-box and leucine-rich repeat protein 7 [Source:NCBI gene;Acc:569430])

HSP 1 Score: 189.119 bits (479), Expect = 3.783e-52
Identity = 105/376 (27.93%), Postives = 194/376 (51.60%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            P    ++IF +L    +  C++ CR WY +AW P LW  I  +  VL      ++  ++ L   L  +    C  V +V +  C  LTD  +  ++ SCP ++   +  C+ +SN ++F ++S+C  L+ L V GC  ++ I+   +  +    +  ++  +  L+++ C  ++D  L   A     +  L LR C R++D G+ ++V YC  +RE+S++    ISD  +  I+ KL   LRYLS+A+C+RITD  +  +A  C  L+YLN   C+ +TD GI  LA S   +L SL++  CP ++   +  L+    N+++L +  C  I+   ++ +  +   L+++N+ +   ++ +   + +    C I H 
Sbjct:  116 PDHAFLQIFTHLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGDVLH-----VDRALRVLTRRLCQDTPNVCLTVETVMVSGCRRLTDRGLYTVAQSCPELRRLEVAGCYNVSNEAVFEVVSRCPNLEHLDVSGCSKVTCISLTRDVSVKLSPLHGQQISIRFLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRFLVIYCPGVRELSVSDCRFISDFGLREIA-KLEGRLRYLSIAHCSRITDVGVRYVAKYCSRLRYLNARGCEGLTDHGIEHLAKSC-LKLKSLDIGKCPLVSDAGLEQLALNSFNLKRLSLKSCESITGRGLQVVAANCFDLQLLNVQDCDVSLEALRFVKRHCKRCIIEHT 484          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Zebrafish
Match: si:dkey-192l18.9 (si:dkey-192l18.9 [Source:ZFIN;Acc:ZDB-GENE-120709-25])

HSP 1 Score: 177.178 bits (448), Expect = 6.442e-48
Identity = 105/377 (27.85%), Postives = 186/377 (49.34%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHNF 1966
            P  +L+ I   L    +  C++ CR WY ++W P LWS I  +  +L     + +  +K L   L  +    C  + +V    C  L+D  +  I+  CP ++   +  C+ +SN ++F ++SKC  L+ L V GC  ++ I+   E  +    +  ++  L  LN++ C  ++D  L   A     +  L LR C RI+D  +  +  +C  LRE+SL+    + D  +  ++ +L   LRYLS+A+C RITD  L  +A  C  L+YLN   C+ +TD G+  LA +   RL S++V  CP ++   + VL+  C  +++L +  C  ++   +  + E   +L+++N+        +  L+ +    C I H  
Sbjct:  103 PDPVLLHILSYLSTPHLCLCARVCRRWYNLSWDPRLWSTIRLNGELL-----NADRALKVLTHRLCQDTPNVCLTLETVVASGCRRLSDRGLRVIARCCPELRCLEVAGCYNVSNDAVFDVVSKCPNLEHLDVSGCPKVTCISLTEEGSVQHTPLHGQQIGLRYLNMTDCVSLEDKGLKTIAIHCPRLTHLYLRRCIRITDESLRQLALHCTALRELSLSDCHLVGDFGLREVA-RLEGRLRYLSVAHCMRITDVGLRYVARYCPRLRYLNARGCEGLTDQGLSYLARNC-PRLRSIDVGRCPLVSDAGLEVLAHCCKMLRRLSLRGCESLTGRGLMALAEGCPELQLLNVQECDVPPEALRLVRQHCRRCVIEHTI 472          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Zebrafish
Match: fbxl2 (F-box and leucine-rich repeat protein 2 [Source:ZFIN;Acc:ZDB-GENE-030925-12])

HSP 1 Score: 125.561 bits (314), Expect = 2.025e-30
Identity = 87/370 (23.51%), Postives = 179/370 (48.38%), Query Frame = 2
Query:  800 YSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLIS--AINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHII---KLKMINIDN 1894
            +S+ND  P     ++ P ++L++IF  L +  +  C+Q  + W  +A     W  ID   +      TDI  ++ + +    G        +  + L  C  + D S+   + +C NI++ ++  C  I++ +   +   C +L+ L +  C  I+  A+  L E         +L +LNLS+C  +    +   +     +  L LR C ++ DT + ++ ++C  L  I++    +I+D+   ++    ++ L+ + ++ C+ ITD SL +L  NC  L+ L   +C  +TD+G   LA +    +  +++  C  +T  ++  LS +CP +Q L ++ C LI+D+ +  +   +    +L+++ +DN
Sbjct:   12 FSNNDEAPIN---KKLPKELLLRIFSYLDVVTLCRCAQVSKAWNVLALDGSNWQKIDLFNF-----QTDIEGRVVENISKRCGG------FLRQLSLRGCLSVGDASMKTFAQNCRNIEHLNLNGCTKITDSTCISLSKFCFKLRHLDLTSCVSITNHALKALSEGC------RMLENLNLSWCDQITSDGIEALSRGCTALRALFLRGCTQLDDTALKHLQKHCPELMTINMQSCTQITDDGFVSLCRGCHK-LQMVCISGCSNITDASLTALGLNCQRLKILEAARCSHVTDAGFTVLARNCH-EMEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITDDGIRHLSSSVCGQERLQVVELDN 359          

HSP 2 Score: 87.0409 bits (214), Expect = 1.238e-17
Identity = 52/168 (30.95%), Postives = 91/168 (54.17%), Query Frame = 2
Query: 1397 MEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTS 1900
            + +L LR C  + D  +    + C+N+  ++LN   KI+D +  ++S K    LR+L L +C  IT+++L +L++ C  L+ LNL  C  IT  GI +L+    T L +L +  C Q+   ++  L ++CP +  ++M  C  I+D+    +C    KL+M+ I   S
Sbjct:   89 LRQLSLRGCLSVGDASMKTFAQNCRNIEHLNLNGCTKITDSTCISLS-KFCFKLRHLDLTSCVSITNHALKALSEGCRMLENLNLSWCDQITSDGIEALSRGC-TALRALFLRGCTQLDDTALKHLQKHCPELMTINMQSCTQITDDGFVSLCRGCHKLQMVCISGCS 254          

HSP 3 Score: 73.1738 bits (178), Expect = 3.827e-13
Identity = 53/210 (25.24%), Postives = 95/210 (45.24%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKL--NENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGI 1684
            +CP + ++ +  CT++TD+  + +   C  ++   I  C  I++ S+  +   C  LK L                                + C  V DA   + A     MEK+ L  C  ++D  +  +  +C  L+ +SL+H E I+D+ I ++S  +   E L+ + L NC  ITD +L  L  NC  L+ + L+ C+ ++ +GI
Sbjct:  215 HCPELMTINMQSCTQITDDGFVSLCRGCHKLQMVCISGCSNITDASLTALGLNCQRLKILEA------------------------------ARCSHVTDAGFTVLARNCHEMEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITDDGIRHLSSSVCGQERLQVVELDNCPLITDITLEHL-KNCQRLERIELYDCQQVSRAGI 393          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Zebrafish
Match: fbxl20 (F-box and leucine-rich repeat protein 20 [Source:ZFIN;Acc:ZDB-GENE-081031-27])

HSP 1 Score: 122.479 bits (306), Expect = 2.833e-29
Identity = 90/356 (25.28%), Postives = 169/356 (47.47%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            ++ P ++L++IF  L +  +  C+Q  R+W  +A     W  ID   +       DI  ++ + +    G        +  + L  C  + D ++   + +C NI+  S+  C  I++ +   +   C +LK L +  C  I+ ++    S+        L  LN+S+C  V    +         ++ L L+ C ++ D  + +I  +C  L  ++L    +I+DE +  I    +  L+ L ++ C  ITD  L +L  NC  L+ L + +C  +TD G  SLA +    L  +++  C QIT  ++  LS +CP +Q L ++ C LI+D+ + ++    C H  +L++I +DN
Sbjct:   26 KKLPKELLLRIFSFLDVVTLCRCAQVSRSWNVLALDGSNWQRIDLFDF-----QRDIEGRVVENISKRCGG------FLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSLKALSEGCPL----LEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGCTQLEDEALKHIGGHCPELVTLNLQTCSQITDEGLITICRGCHR-LQSLCVSGCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTSLARNCH-ELEKMDLEECVQITDATLIQLSIHCPRLQVLSLSHCELITDDGIRQLGSGPCAH-DRLEVIELDN 363          

HSP 2 Score: 96.6709 bits (239), Expect = 9.016e-21
Identity = 74/280 (26.43%), Postives = 135/280 (48.21%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKF-----KEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAIS--IQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKM 1879
            +CP +  + L  CT +T+ S+  +S  CP ++  +I  C  ++   I  ++  C  LK L ++GC       T  E + +K       E V   LNL  C  + D  LI        ++ L +  C  I+D  ++ + + C  LR + +    +++D    +++   +E L  + L  C +ITD +L+ L+ +C  LQ L+L  C+LITD GI  L        RL  + +  CP IT  S+  L + C ++ ++++  C  I+   ++ +  H+  +K+
Sbjct:  141 FCPKLKHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGC-------TQLEDEALKHIGGHCPELV--TLNLQTCSQITDEGLITICRGCHRLQSLCVSGCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTSLARNCHE-LEKMDLEECVQITDATLIQLSIHCPRLQVLSLSHCELITDDGIRQLGSGPCAHDRLEVIELDNCPLITDASLEHL-KSCHSLDRIELYDCQQITRAGIKRLRTHLPNIKV 409          

HSP 3 Score: 82.4185 bits (202), Expect = 3.726e-16
Identity = 65/249 (26.10%), Postives = 116/249 (46.59%), Query Frame = 2
Query: 1319 LSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESI------CNISEKLN-------------------ENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDN----TSATIRSYDLITKTFPSCSIHH-NFVTD 1975
            L  L+L  C  V D++L  FA   +N+E L L  C +I+D+  + + ++C  L+ + L     I++ S+      C + E+LN                     L+ L L  CT++ D +L  +  +C  L  LNL  C  ITD G++++      RL SL VS C  IT   ++ L + CP ++ L++ +C  ++D     +  +  +L+ ++++     T AT+    +        S+ H   +TD
Sbjct:   93 LRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGCTQLEDEALKHIGGHCPELVTLNLQTCSQITDEGLITICRGCH-RLQSLCVSGCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTSLARNCHELEKMDLEECVQITDATLIQLSIHCPRLQVLSLSHCELITD 340          

HSP 4 Score: 71.2478 bits (173), Expect = 1.520e-12
Identity = 51/159 (32.08%), Postives = 77/159 (48.43%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSL------------------------AISIQTRLIS-LNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLIT 1930
            NIS++    LR LSL  C  + D++L + A NC N++ L+L+ C  ITDS   SL                        A+S    L+  LN+S+C Q+T   +  L R CP ++ L +  C  + DEA++ I  H  +L  +N+  T + I    LIT
Sbjct:   84 NISKRCGGFLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGCTQLEDEALKHIGGHCPELVTLNL-QTCSQITDEGLIT 241          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Zebrafish
Match: fbxl20 (F-box and leucine-rich repeat protein 20 [Source:ZFIN;Acc:ZDB-GENE-081031-27])

HSP 1 Score: 109.768 bits (273), Expect = 4.003e-25
Identity = 90/364 (24.73%), Postives = 171/364 (46.98%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHL--------EKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            ++ P ++L++IF  L +  +  C+Q  R+W  +A     W  ID   +       DI  ++ + +    G        +  + L  C  + D ++   + +C NI+  S+  C  I++ +   +   C +LK L +  C  I+ ++    S+        L  LN+S+C  V    +         ++ L L+ C ++ D  + +I  +C  L  ++LN +        ++I+DE +  I    +  L+ L ++ C  ITD  L +L  NC  L+ L + +C  +TD G  SLA +    L  +++  C  IT  ++  LS +CP +Q L ++ C LI+D+ + ++    C H  +L++I +DN
Sbjct:   12 KKLPKELLLRIFSFLDVVTLCRCAQVSRSWNVLALDGSNWQRIDLFDF-----QRDIEGRVVENISKRCGG------FLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSLKALSEGCPL----LEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGCTQLEDEALKHIGGHCPEL--VTLNFMIVCLCVNEQQITDEGLITICRGCHR-LQSLCVSGCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTSLARNCH-ELEKMDLEEC--ITDATLIQLSIHCPRLQVLSLSHCELITDDGIRQLGSGPCAH-DRLEVIELDN 353          

HSP 2 Score: 83.9593 bits (206), Expect = 1.131e-16
Identity = 73/284 (25.70%), Postives = 136/284 (47.89%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKF-----KEFV-LSDLNLSFC---QMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAIS--IQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKM 1879
            +CP +  + L  CT +T+ S+  +S  CP ++  +I  C  ++   I  ++  C  LK L ++GC       T  E + +K       E V L+ + +  C   Q + D  LI        ++ L +  C  I+D  ++ + + C  LR + +    +++D    +++   +E L  + L  C  ITD +L+ L+ +C  LQ L+L  C+LITD GI  L        RL  + +  CP IT  S+  L + C ++ ++++  C  I+   ++ +  H+  +K+
Sbjct:  127 FCPKLKHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGC-------TQLEDEALKHIGGHCPELVTLNFMIVCLCVNEQQITDEGLITICRGCHRLQSLCVSGCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTSLARNCHE-LEKMDLEEC--ITDATLIQLSIHCPRLQVLSLSHCELITDDGIRQLGSGPCAHDRLEVIELDNCPLITDASLEHL-KSCHSLDRIELYDCQQITRAGIKRLRTHLPNIKV 399          

HSP 3 Score: 70.8626 bits (172), Expect = 1.754e-12
Identity = 64/253 (25.30%), Postives = 115/253 (45.45%), Query Frame = 2
Query: 1319 LSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESI------CNISEKLN-------------------ENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKL------ITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDN--TSATIRSYDLITKTFPSCSIHH-NFVTD 1975
            L  L+L  C  V D++L  FA   +N+E L L  C +I+D+  + + ++C  L+ + L     I++ S+      C + E+LN                     L+ L L  CT++ D +L  +  +C  L  LN     L      ITD G++++      RL SL VS C  IT   ++ L + CP ++ L++ +C  ++D     +  +  +L+ ++++   T AT+    +        S+ H   +TD
Sbjct:   79 LRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGCTQLEDEALKHIGGHCPELVTLNFMIVCLCVNEQQITDEGLITICRGCH-RLQSLCVSGCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTSLARNCHELEKMDLEECITDATLIQLSIHCPRLQVLSLSHCELITD 330          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Xenopus
Match: med13l (mediator complex subunit 13-like [Source:Xenbase;Acc:XB-GENE-6045769])

HSP 1 Score: 199.134 bits (505), Expect = 8.102e-56
Identity = 114/379 (30.08%), Postives = 201/379 (53.03%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            +R P + +I+IF  L    +  C++ CR WY IAW P LW  I      L  +  +++  +K L   L  +    C ++ +V +  C  LTD  +  I+  CP ++   +  C+ ISN +IF ++S C  L+ L V GC  ++ I+   E+ I    +  K+  +  L+++ C +++D  L   A     +  L LR C RI+D G+ YI+ YC +++E+S++    +SD  +  I+ KL   LRYLS+A+C RITD  +  +A  C  L+YLN   C+ ITD G+  LA +  T+L SL++  CP ++   +  L+  C N+++L +  C  I+ + ++ +  +   L+M+N+ +   ++ +   + +    C I H 
Sbjct:   82 DRLPDQCIIQIFSYLPTNQLCRCARVCRRWYNIAWDPRLWRTIR-----LTGETINVDRALKVLTRRLCQDTPNVCLMLETVIVSGCRRLTDRGLYIIAQCCPELRRLEVSNCYNISNEAIFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPMHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCIRITDEGLRYIMIYCTSIKELSVSDCRFVSDFGMREIA-KLESRLRYLSIAHCGRITDVGIRYIAKYCSKLRYLNARGCEGITDHGVEYLAKNC-TKLKSLDIGKCPLVSDIGLEFLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCEVSVDALRFVKRHCKRCIIEHT 453          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Xenopus
Match: med13l (mediator complex subunit 13-like [Source:Xenbase;Acc:XB-GENE-6045769])

HSP 1 Score: 199.519 bits (506), Expect = 9.470e-56
Identity = 114/379 (30.08%), Postives = 201/379 (53.03%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            +R P + +I+IF  L    +  C++ CR WY IAW P LW  I      L  +  +++  +K L   L  +    C ++ +V +  C  LTD  +  I+  CP ++   +  C+ ISN +IF ++S C  L+ L V GC  ++ I+   E+ I    +  K+  +  L+++ C +++D  L   A     +  L LR C RI+D G+ YI+ YC +++E+S++    +SD  +  I+ KL   LRYLS+A+C RITD  +  +A  C  L+YLN   C+ ITD G+  LA +  T+L SL++  CP ++   +  L+  C N+++L +  C  I+ + ++ +  +   L+M+N+ +   ++ +   + +    C I H 
Sbjct:  114 DRLPDQCIIQIFSYLPTNQLCRCARVCRRWYNIAWDPRLWRTIR-----LTGETINVDRALKVLTRRLCQDTPNVCLMLETVIVSGCRRLTDRGLYIIAQCCPELRRLEVSNCYNISNEAIFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPMHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCIRITDEGLRYIMIYCTSIKELSVSDCRFVSDFGMREIA-KLESRLRYLSIAHCGRITDVGIRYIAKYCSKLRYLNARGCEGITDHGVEYLAKNC-TKLKSLDIGKCPLVSDIGLEFLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCEVSVDALRFVKRHCKRCIIEHT 485          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Xenopus
Match: adcy3 (adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-1007339])

HSP 1 Score: 124.405 bits (311), Expect = 2.296e-29
Identity = 105/457 (22.98%), Postives = 204/457 (44.64%), Query Frame = 2
Query:  548 FAQNLSAINENSITS-PNPIGLHSNVIDYGP--IHPYMKVPNYHRDQHSDAYATVASTSDDDTKSNMSDLFIPIRRSTKKSKETQIN-YSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            F Q L A     +   P P   H      GP    P    P+Y R +  +       + +   +  ++    P+RR      +++   +S+ND     L  ++ P ++L++IF  L +  +  C+Q  R W  +A     W  ID   +       DI  ++ + +    G        +  + L  C  + D ++   + +C NI+  ++  C  I++ +   +   C +L++L +  C  I+ ++    S+        L  LN+S+C  +    +         +  L L+ C ++ D  + +I  +C  L  ++L    +I+D+ +  I    ++ L+ L  + C+ ITD+ L +L  NC  L+ L + +C  +TD G  +LA +    L  +++  C QIT  ++  LS +CP +Q L ++ C LI+D+ +  +    C H  +L++I +DN
Sbjct:   14 FGQKLKAWETGELPEYPVPTHWHFRAQGPGPSVTAPPPIGPHYIRCEPGN-------SGEKGPQHLVTHTAAPMRRDMNGVTKSRFEMFSNND---EALINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDF-----QRDIEGRVVENISKRCGG------FLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKITDATSTSLSKFCSKLRQLDLASCTSITNLSLKAISEGCP----QLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRGCHK-LQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKNCH-ELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAH-DRLEVIELDN 442          

HSP 2 Score: 111.694 bits (278), Expect = 3.295e-25
Identity = 79/280 (28.21%), Postives = 139/280 (49.64%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKF-----KEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSL--AISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKM 1879
            +C  +  + L  CT +T+ S+  IS  CP ++  +I  C  IS   I  ++  CG L+ LS++GC       T  E + +KF      E V   LNL  C  + D  LI        ++ L    C  I+D+ ++ + + C  LR + +    +++D     +++  +E L  + L  C +ITD++L+ L+ +C  LQ L+L  C+LITD GI  L        RL  + +  CP IT  S+  L + C +++++++  C  IS   ++ +  H+  +K+
Sbjct:  220 FCSKLRQLDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGC-------TQLEDEALKFIGSHCPELV--TLNLQACSQITDDGLITICRGCHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKNCHE-LEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDRLEVIELDNCPLITDASLEHL-KSCQSLERIELYDCQQISRAGIKRLRTHLPNIKV 488          

HSP 3 Score: 74.7146 bits (182), Expect = 2.193e-13
Identity = 47/150 (31.33%), Postives = 84/150 (56.00%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINI-------DNTSATIRSY--DLITKTFPSCS 1951
            NIS++    LR LSL  C  + DN+L + A NC N++ LNL+ C  ITD+   SL+    ++L  L+++ C  IT+ S+  +S  CP ++QL+++ C  IS + ++ + +    L+++++       D     I S+  +L+T    +CS
Sbjct:  163 NISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKITDATSTSLS-KFCSKLRQLDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACS 311          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Xenopus
Match: adcy3 (adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-1007339])

HSP 1 Score: 120.168 bits (300), Expect = 7.847e-28
Identity = 106/444 (23.87%), Postives = 201/444 (45.27%), Query Frame = 2
Query:  581 SITSPNPIGLHSNVIDYGPIHPYMKVPNYHRDQHSDAYATVASTSDDDTKSNMSDLFIPIRRSTKKSKETQIN-YSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHL-EKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            S+T+P PIG H   I   P +   K P  H   H+ A                     P+RR      +++   +S+ND     L  ++ P ++L++IF  L +  +  C+Q  R W  +A     W  ID   +       DI  ++ + +    G        +  + L  C  + D ++   + +C NI+  ++  C  I++ +   +   C +L++L +  C  I+ ++    S+        L  LN+S+C  +    +         +  L L+ C ++ D  + +I  +C  L  ++L    ++I+D+ +  I    ++ L+ L  + C+ ITD+ L +L  NC  L+ L + +C  +TD G  +LA +    L  +++  C QIT  ++  LS +CP +Q L ++ C LI+D+ +  +    C H  +L++I +DN
Sbjct:   45 SVTAPPPIGPH--YIRCEPGNSGEKGPQ-HLVTHTAA---------------------PMRRDMNGVTKSRFEMFSNND---EALINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDF-----QRDIEGRVVENISKRCGG------FLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKITDATSTSLSKFCSKLRQLDLASCTSITNLSLKAISEGCP----QLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACSQQITDDGLITICRGCHK-LQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKNCH-ELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAH-DRLEVIELDN 443          

HSP 2 Score: 108.227 bits (269), Expect = 5.517e-24
Identity = 90/323 (27.86%), Postives = 153/323 (47.37%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKF-----KEFVLSDLNLSFC-QMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSL--AISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI------------CEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHNFV 1969
            +C  +  + L  CT +T+ S+  IS  CP ++  +I  C  IS   I  ++  CG L+ LS++GC       T  E + +KF      E V   LNL  C Q + D  LI        ++ L    C  I+D+ ++ + + C  LR + +    +++D     +++  +E L  + L  C +ITD++L+ L+ +C  LQ L+L  C+LITD GI  L        RL  + +  CP IT  S+  L + C +++++++  C  IS   ++ +             +H+ K K + I     T+RS+D    T  +C  H   V
Sbjct:  220 FCSKLRQLDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGC-------TQLEDEALKFIGSHCPELV--TLNLQACSQQITDDGLITICRGCHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKNCHE-LEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDRLEVIELDNCPLITDASLEHL-KSCQSLERIELYDCQQISRAGIKRLRGSHEAGFIWHMSDHLGKSKGVMI----RTMRSWDY---TMENCYDHSQAV 524          

HSP 3 Score: 75.0998 bits (183), Expect = 2.047e-13
Identity = 47/150 (31.33%), Postives = 84/150 (56.00%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINI-------DNTSATIRSY--DLITKTFPSCS 1951
            NIS++    LR LSL  C  + DN+L + A NC N++ LNL+ C  ITD+   SL+    ++L  L+++ C  IT+ S+  +S  CP ++QL+++ C  IS + ++ + +    L+++++       D     I S+  +L+T    +CS
Sbjct:  163 NISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKITDATSTSLS-KFCSKLRQLDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACS 311          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Xenopus
Match: adcy3 (adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-1007339])

HSP 1 Score: 117.087 bits (292), Expect = 2.068e-27
Identity = 89/369 (24.12%), Postives = 175/369 (47.43%), Query Frame = 2
Query:  800 YSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            +S+ND     L  ++ P ++L++IF  L +  +  C+Q  R W  +A     W  ID   +       DI  ++ + +    G        +  + L  C  + D ++   + +C NI+  ++  C  I++ +   +   C +L++L +  C  I+ ++    S+        L  LN+S+C  +    +         +  L L+ C ++ D  + +I  +C  L  ++L    +I+D+ +  I    ++ L+ L  + C+ ITD+ L +L  NC  L+ L + +C  +TD G  +LA +    L  +++  C QIT  ++  LS +CP +Q L ++ C LI+D+ +  +    C H  +L++I +DN
Sbjct:   12 FSNND---EALINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDF-----QRDIEGRVVENISKRCGG------FLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKITDATSTSLSKFCSKLRQLDLASCTSITNLSLKAISEGCP----QLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRGCHK-LQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKNCH-ELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAH-DRLEVIELDN 359          

HSP 2 Score: 109.383 bits (272), Expect = 8.676e-25
Identity = 79/280 (28.21%), Postives = 139/280 (49.64%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKF-----KEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSL--AISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKM 1879
            +C  +  + L  CT +T+ S+  IS  CP ++  +I  C  IS   I  ++  CG L+ LS++GC       T  E + +KF      E V   LNL  C  + D  LI        ++ L    C  I+D+ ++ + + C  LR + +    +++D     +++  +E L  + L  C +ITD++L+ L+ +C  LQ L+L  C+LITD GI  L        RL  + +  CP IT  S+  L + C +++++++  C  IS   ++ +  H+  +K+
Sbjct:  137 FCSKLRQLDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGC-------TQLEDEALKFIGSHCPELV--TLNLQACSQITDDGLITICRGCHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKNCHE-LEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDRLEVIELDNCPLITDASLEHL-KSCQSLERIELYDCQQISRAGIKRLRTHLPNIKV 405          

HSP 3 Score: 73.9442 bits (180), Expect = 2.882e-13
Identity = 47/150 (31.33%), Postives = 84/150 (56.00%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINI-------DNTSATIRSY--DLITKTFPSCS 1951
            NIS++    LR LSL  C  + DN+L + A NC N++ LNL+ C  ITD+   SL+    ++L  L+++ C  IT+ S+  +S  CP ++QL+++ C  IS + ++ + +    L+++++       D     I S+  +L+T    +CS
Sbjct:   80 NISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKITDATSTSLS-KFCSKLRQLDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACS 228          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Mouse
Match: Fbxl7 (F-box and leucine-rich repeat protein 7 [Source:MGI Symbol;Acc:MGI:3052506])

HSP 1 Score: 196.823 bits (499), Expect = 7.345e-55
Identity = 110/379 (29.02%), Postives = 200/379 (52.77%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            +R P   +++IF  L    +  C++ CR WY +AW P LW  I      L  +  +++  +K L   L  +    C ++ +V +  C  LTD  +  I+  CP ++   +  C+ ISN ++F ++S C  L+ L V GC  ++ I+   E+ I    +  K+  +  L+++ C +++D  L   A     +  L LR C R++D G+ Y+V YC +++E+S++    +SD  +  I+ KL   LRYLS+A+C RITD  +  +A  C  L+YLN   C+ ITD G+  LA +  T+L SL++  CP ++   +  L+  C N+++L +  C  I+ + ++ +  +   L+M+N+ +   ++ +   + +    C I H 
Sbjct:  115 DRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIR-----LTGETINVDRALKVLTRRLCQDTPNVCLMLETVIVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLREIA-KLESRLRYLSIAHCGRITDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNC-TKLKSLDIGKCPLVSDTGLESLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCEVSVEALRFVKRHCKRCVIEHT 486          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Mouse
Match: Fbxl2 (F-box and leucine-rich repeat protein 2 [Source:MGI Symbol;Acc:MGI:1919429])

HSP 1 Score: 129.413 bits (324), Expect = 9.783e-32
Identity = 89/356 (25.00%), Postives = 173/356 (48.60%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            ++ P ++L++IF  L I  +  C+Q  + W  +A     W  +D   +      TD+  ++ + +    G        +  + L  C  + D S+   + +C NI++ ++  C  I++ + + +   C +LK L +  C  ++  +    S+  +  E+    LNLS+C  +    +       + ++ LLLR C ++ D  + +I  +C  L  ++L    +I+D+ +  I    +  L+ L L+ C+ +TD SL +L  NC  LQ L   +C  +TD+G   LA +    L  +++  C  IT  ++  LS +CP +Q L ++ C LI+DE +  +    C H  +L+++ +DN
Sbjct:   13 KKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRVDLFNF-----QTDVEGRVVENISKRCGG------FLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEY----LNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRGCHR-LQALCLSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLARNCH-ELEKMDLEECVLITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSSTCGH-ERLRVLELDN 350          

HSP 2 Score: 83.1889 bits (204), Expect = 1.976e-16
Identity = 49/168 (29.17%), Postives = 89/168 (52.98%), Query Frame = 2
Query: 1397 MEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTS 1900
            + KL LR C  + D+ +    + C+N+  ++LN   KI+D S C    +    L++L L +C  +T++SL  +++ C NL+YLNL  C  IT  GI +L    +  L +L +  C Q+   ++  +  +C  +  L++  C  I+D+ V +IC    +L+ + +   S
Sbjct:   80 LRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITD-STCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRG-LKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRGCHRLQALCLSGCS 245          

HSP 3 Score: 70.4774 bits (171), Expect = 2.985e-12
Identity = 50/149 (33.56%), Postives = 72/149 (48.32%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSL------------------------AISIQTR-LISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTS 1900
            NIS++    LR LSL  C  + D+SL + A NC N+++LNL+ C  ITDS   SL                         IS   R L  LN+S+C QIT   +  L R C  ++ L +  C  + DEA++ I  H  +L  +N+ + S
Sbjct:   71 NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCS 219          

HSP 4 Score: 53.5286 bits (127), Expect = 6.006e-7
Identity = 35/128 (27.34%), Postives = 65/128 (50.78%), Query Frame = 2
Query: 1064 CPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGI 1447
            CP +  ++  +C+ LTD     ++ +C  ++   + +C LI++ ++  +   C +L+ LS+  C+LI+    L  S      E  L  L L  C +V DASL       + +E+L L +C +++  GI
Sbjct:  259 CPRLQVLEAARCSHLTDAGFTLLARNCHELEKMDLEECVLITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSSTCGHER-LRVLELDNCLLVTDASL-EHLENCRGLERLELYDCQQVTRAGI 384          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Mouse
Match: Fbxl2 (F-box and leucine-rich repeat protein 2 [Source:MGI Symbol;Acc:MGI:1919429])

HSP 1 Score: 129.413 bits (324), Expect = 9.783e-32
Identity = 89/356 (25.00%), Postives = 173/356 (48.60%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            ++ P ++L++IF  L I  +  C+Q  + W  +A     W  +D   +      TD+  ++ + +    G        +  + L  C  + D S+   + +C NI++ ++  C  I++ + + +   C +LK L +  C  ++  +    S+  +  E+    LNLS+C  +    +       + ++ LLLR C ++ D  + +I  +C  L  ++L    +I+D+ +  I    +  L+ L L+ C+ +TD SL +L  NC  LQ L   +C  +TD+G   LA +    L  +++  C  IT  ++  LS +CP +Q L ++ C LI+DE +  +    C H  +L+++ +DN
Sbjct:   13 KKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRVDLFNF-----QTDVEGRVVENISKRCGG------FLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEY----LNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRGCHR-LQALCLSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLARNCH-ELEKMDLEECVLITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSSTCGH-ERLRVLELDN 350          

HSP 2 Score: 83.1889 bits (204), Expect = 1.976e-16
Identity = 49/168 (29.17%), Postives = 89/168 (52.98%), Query Frame = 2
Query: 1397 MEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTS 1900
            + KL LR C  + D+ +    + C+N+  ++LN   KI+D S C    +    L++L L +C  +T++SL  +++ C NL+YLNL  C  IT  GI +L    +  L +L +  C Q+   ++  +  +C  +  L++  C  I+D+ V +IC    +L+ + +   S
Sbjct:   80 LRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITD-STCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRG-LKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRGCHRLQALCLSGCS 245          

HSP 3 Score: 70.4774 bits (171), Expect = 2.985e-12
Identity = 50/149 (33.56%), Postives = 72/149 (48.32%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSL------------------------AISIQTR-LISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTS 1900
            NIS++    LR LSL  C  + D+SL + A NC N+++LNL+ C  ITDS   SL                         IS   R L  LN+S+C QIT   +  L R C  ++ L +  C  + DEA++ I  H  +L  +N+ + S
Sbjct:   71 NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCS 219          

HSP 4 Score: 53.5286 bits (127), Expect = 6.006e-7
Identity = 35/128 (27.34%), Postives = 65/128 (50.78%), Query Frame = 2
Query: 1064 CPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGI 1447
            CP +  ++  +C+ LTD     ++ +C  ++   + +C LI++ ++  +   C +L+ LS+  C+LI+    L  S      E  L  L L  C +V DASL       + +E+L L +C +++  GI
Sbjct:  259 CPRLQVLEAARCSHLTDAGFTLLARNCHELEKMDLEECVLITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSSTCGHER-LRVLELDNCLLVTDASL-EHLENCRGLERLELYDCQQVTRAGI 384          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Mouse
Match: Fbxl20 (F-box and leucine-rich repeat protein 20 [Source:MGI Symbol;Acc:MGI:1919444])

HSP 1 Score: 121.324 bits (303), Expect = 7.189e-29
Identity = 88/356 (24.72%), Postives = 167/356 (46.91%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            ++ P ++L++IF  L +  +  C+Q  R W  +A     W  ID   +       DI  ++ + +    G        +  + L  C  + D ++   + +C NI+  S+  C   ++ +   +   C +L+ L +  C  I+ ++    S+        L  LN+S+C  V    +         ++ L L+ C ++ D  + YI  +C  L  ++L    +I+DE +  I    ++ L+ L  + C+ ITD  L +L  NC  L+ L + +C  +TD G  +LA +    L  +++  C QIT  ++  LS +CP +Q L ++ C LI+D+ +  +    C H  +L++I +DN
Sbjct:   26 KKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDF-----QRDIEGRVVENISKRCGG------FLRKLSLRGCLGVGDNALRTFAQNCRNIEVLSLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPL----LEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHK-LQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCH-ELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAH-DQLEVIELDN 363          

HSP 2 Score: 98.2117 bits (243), Expect = 2.757e-21
Identity = 72/278 (25.90%), Postives = 135/278 (48.56%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEF---VLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSL--AISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKM 1879
            +C  +  + L  CT +T+ S+  +S  CP ++  +I  C  ++   I  ++  CG LK L ++GC       T  E + +K+       L  LNL  C  + D  LI        ++ L    C  I+D  ++ + + C  LR + +    +++D     ++   +E L  + L  C +ITD++L+ L+ +C  LQ L+L  C+LITD GI  L        +L  + +  CP IT  S+  L + C +++++++  C  I+   ++ +  H+  +K+
Sbjct:  141 FCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGC-------TQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHE-LEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHL-KSCHSLERIELYDCQQITRAGIKRLRTHLPNIKV 409          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Mouse
Match: Fbxl14 (F-box and leucine-rich repeat protein 14 [Source:MGI Symbol;Acc:MGI:2141676])

HSP 1 Score: 98.2117 bits (243), Expect = 2.119e-21
Identity = 88/381 (23.10%), Postives = 168/381 (44.09%), Query Frame = 2
Query:  854 KILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLIS-NISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYI-----------VRYCQNLREISLNHL----------------------EKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDN 1894
            ++L  IF  L ++D    +Q C  W   A+   +W  ++    + +  P+                                        +F     P+++   IR+  ++S   S+ +++     ++ L++ GC  ++  N L  + + +     L  LNLS C+ + D+SL   A   K +E L L  C  I++TG+  I           +R C++L ++ + HL                      +K++D S+ +IS  L   LR L+L+ C  I+D  L+ L+ +  +L+ LNL  C  I+D+GIM LA+    RL  L+VS+C ++  +S++ +++    ++ L +  C  ISD+ +  +   +  L+ +NI  
Sbjct:   11 ELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPS----------------------------------------LF-----PSLQARGIRRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTD-NGLGHAFVQEIGS--LRALNLSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLT-GLRLLNLSFCGGISDAGLLHLS-HMGSLRSLNLRSCDNISDTGIMHLAMG-SLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCH-ISDDGINRMVRQMHGLRTLNIGQ 339          

HSP 2 Score: 93.2041 bits (230), Expect = 1.042e-19
Identity = 70/277 (25.27%), Postives = 136/277 (49.10%), Query Frame = 2
Query: 1046 GNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSD----------LNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVE 1846
            G    Y   +  ++L  C+ +T+  ++ I+     +K+ ++R C  +S++ I H+      + R + EGC     +  L   D  K  +  L            LNLSFC  + DA L+  +    ++  L LR+C  ISDTGI ++      L  + ++  +K+ D+S+  I++ L + L+ LSL +C  I+D+ +  +      L+ LN+ +C  ITD G+  +A  + ++L  +++  C +IT R +  +++  P ++ L++    +   E V 
Sbjct:  136 GRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAG----MTRSAAEGCL---GLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHLS-HMGSLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGL-DGLKSLSLCSC-HISDDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHL-SQLTGIDLYGCTRITKRGLERITQL-PCLKVLNLGLWQMTDSEKVR 400          
BLAST of F-box/LRR-repeat protein 7 vs. UniProt/SwissProt
Match: sp|Q5BJ29|FBXL7_MOUSE (F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 5.138e-54
Identity = 110/379 (29.02%), Postives = 200/379 (52.77%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            +R P   +++IF  L    +  C++ CR WY +AW P LW  I      L  +  +++  +K L   L  +    C ++ +V +  C  LTD  +  I+  CP ++   +  C+ ISN ++F ++S C  L+ L V GC  ++ I+   E+ I    +  K+  +  L+++ C +++D  L   A     +  L LR C R++D G+ Y+V YC +++E+S++    +SD  +  I+ KL   LRYLS+A+C RITD  +  +A  C  L+YLN   C+ ITD G+  LA +  T+L SL++  CP ++   +  L+  C N+++L +  C  I+ + ++ +  +   L+M+N+ +   ++ +   + +    C I H 
Sbjct:  115 DRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIR-----LTGETINVDRALKVLTRRLCQDTPNVCLMLETVIVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLREIA-KLESRLRYLSIAHCGRITDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNC-TKLKSLDIGKCPLVSDTGLESLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCEVSVEALRFVKRHCKRCVIEHT 486          
BLAST of F-box/LRR-repeat protein 7 vs. UniProt/SwissProt
Match: sp|Q9UJT9|FBXL7_HUMAN (F-box/LRR-repeat protein 7 OS=Homo sapiens OX=9606 GN=FBXL7 PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.551e-53
Identity = 108/379 (28.50%), Postives = 199/379 (52.51%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            +R P   +++IF  L    +  C++ CR WY +AW P LW  I      L  +  +++  +K L   L  +    C ++ +V +  C  LTD  +  I+  CP ++   +  C+ ISN ++F ++S C  L+ L V GC  ++ I+   E+ I    +  K+  +  L+++ C +++D  L   A     +  L LR C R++D G+ Y+V YC +++E+S++    +SD  +  I+ KL   LRYLS+A+C R+TD  +  +A  C  L+YLN   C+ ITD G+  LA +  T+L SL++  CP ++   +  L+  C N+++L +  C  I+ + ++ +  +   L+ +N+ +   ++ +   + +    C I H 
Sbjct:  115 DRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIR-----LTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIA-KLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNC-TKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHT 486          
BLAST of F-box/LRR-repeat protein 7 vs. UniProt/SwissProt
Match: sp|A1A5X2|FBXL7_DANRE (F-box/LRR-repeat protein 7 OS=Danio rerio OX=7955 GN=fbxl7 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 2.856e-51
Identity = 105/376 (27.93%), Postives = 194/376 (51.60%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            P    ++IF +L    +  C++ CR WY +AW P LW  I  +  VL      ++  ++ L   L  +    C  V +V +  C  LTD  +  ++ SCP ++   +  C+ +SN ++F ++S+C  L+ L V GC  ++ I+   +  +    +  ++  +  L+++ C  ++D  L   A     +  L LR C R++D G+ ++V YC  +RE+S++    ISD  +  I+ KL   LRYLS+A+C+RITD  +  +A  C  L+YLN   C+ +TD GI  LA S   +L SL++  CP ++   +  L+    N+++L +  C  I+   ++ +  +   L+++N+ +   ++ +   + +    C I H 
Sbjct:  116 PDHAFLQIFTHLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGDVLH-----VDRALRVLTRRLCQDTPNVCLTVETVMVSGCRRLTDRGLYTVAQSCPELRRLEVAGCYNVSNEAVFEVVSRCPNLEHLDVSGCSKVTCISLTRDVSVKLSPLHGQQISIRFLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRFLVIYCPGVRELSVSDCRFISDFGLREIA-KLEGRLRYLSIAHCSRITDVGVRYVAKYCSRLRYLNARGCEGLTDHGIEHLAKSC-LKLKSLDIGKCPLVSDAGLEQLALNSFNLKRLSLKSCESITGRGLQVVAANCFDLQLLNVQDCDVSLEALRFVKRHCKRCIIEHT 484          
BLAST of F-box/LRR-repeat protein 7 vs. UniProt/SwissProt
Match: sp|A6H779|FBXL2_BOVIN (F-box/LRR-repeat protein 2 OS=Bos taurus OX=9913 GN=FBXL2 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 3.547e-32
Identity = 95/369 (25.75%), Postives = 179/369 (48.51%), Query Frame = 2
Query:  800 YSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            +S+ND     L  ++ P ++L++IF  L I  +  C+Q  + W  +A     W  ID   +      TD+  ++ + +    G        +  + L  C  + D S+   + +C NI++ ++  C  I++ + + +   C +LK L +  C  I+  +    S+  +  E+    LNLS+C  +    +       + +  LLLR C ++ D  + +I  YC  L  ++L    +++D+ +  +       L+ L L+ C  +TD SL +LA NC  LQ L   +C  +TD+G   LA +    L  +++  C  IT R+++ LS +CP +Q L ++ C LI+D+ +  +    C H  +L+++ +DN
Sbjct:    3 FSNND---EGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNF-----QTDVEGRVVENISKRCGG------FLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRHLEY----LNLSWCDQITKDGVEALVRGCRGLRALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRVTDDGVVQLCRGC-PRLQALCLSGCGSLTDASLTALALNCPRLQILEAARCSHLTDAGFTLLARNCHD-LEKMDLEECILITDRTLTQLSIHCPKLQALSLSHCELITDDGILHLSNSPCGH-ERLRVLELDN 350          

HSP 2 Score: 86.6557 bits (213), Expect = 1.254e-16
Identity = 59/211 (27.96%), Postives = 108/211 (51.18%), Query Frame = 2
Query: 1064 CPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFV--LSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEK--LNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGI 1684
            C  + ++ L  CT+L DE++  I N C  + + +++ C  +++  +  +   C  L+ L + GC       +L ++ +         L  L  + C  + DA   + A    ++EK+ L  C  I+D  ++ +  +C  L+ +SL+H E I+D+ I ++S     +E LR L L NC  ITD +L  L ++C  L+ L L+ C+ +T +GI
Sbjct:  181 CRGLRALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRVTDDGVVQLCRGCPRLQALCLSGC------GSLTDASLTALALNCPRLQILEAARCSHLTDAGFTLLARNCHDLEKMDLEECILITDRTLTQLSIHCPKLQALSLSHCELITDDGILHLSNSPCGHERLRVLELDNCLLITDVALEHL-EHCRGLERLELYDCQQVTRAGI 384          

HSP 3 Score: 67.781 bits (164), Expect = 1.267e-10
Identity = 50/149 (33.56%), Postives = 72/149 (48.32%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSL------------------------AISIQTR-LISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTS 1900
            NIS++    LR LSL  C  + D+SL + A NC N+++LNL+ C  ITDS   SL                         IS   R L  LN+S+C QIT   V  L R C  ++ L +  C  + DEA++ I  +  +L  +N+ + S
Sbjct:   71 NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRHLEYLNLSWCDQITKDGVEALVRGCRGLRALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCS 219          
BLAST of F-box/LRR-repeat protein 7 vs. UniProt/SwissProt
Match: sp|Q9UKC9|FBXL2_HUMAN (F-box/LRR-repeat protein 2 OS=Homo sapiens OX=9606 GN=FBXL2 PE=1 SV=3)

HSP 1 Score: 130.954 bits (328), Expect = 2.476e-31
Identity = 96/369 (26.02%), Postives = 179/369 (48.51%), Query Frame = 2
Query:  800 YSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            +S+ND     L  ++ P ++L++IF  L I  +  C+Q  + W  +A     W  ID   +      TD+  ++ + +    G        +  + L  C  + D S+   + +C NI++ ++  C  I++ + + +   C +LK L +  C  I+  +    S+  +  E+    LNLS+C  +    +       + ++ LLLR C ++ D  + +I  YC  L  ++L    +I+DE +  I    +  L+ L L+ C+ +TD SL +L  NC  LQ L   +C  +TD+G   LA +    L  +++  C  IT  ++  LS +CP +Q L ++ C LI+D+ +  +    C H  +L+++ +DN
Sbjct:    3 FSNND---EGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNF-----QTDVEGRVVENISKRCGG------FLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEY----LNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHR-LQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCH-ELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGH-ERLRVLELDN 350          

HSP 2 Score: 75.0998 bits (183), Expect = 7.177e-13
Identity = 57/210 (27.14%), Postives = 96/210 (45.71%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKL--NENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGI 1684
            YC  + S+ L  C+ +TDE V+ I   C  ++   +  C  +++ S+  +   C  L+ L                                + C  + DA   + A     +EK+ L  C  I+D+ +  +  +C  L+ +SL+H E I+D+ I ++S     +E LR L L NC  ITD +L  L +NC  L+ L L+ C+ +T +GI
Sbjct:  206 YCHELVSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEA------------------------------ARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALEHL-ENCRGLERLELYDCQQVTRAGI 384          

HSP 3 Score: 68.1662 bits (165), Expect = 1.062e-10
Identity = 48/150 (32.00%), Postives = 82/150 (54.67%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINI-------DNTSATIRSY--DLITKTFPSCS 1951
            NIS++    LR LSL  C  + D+SL + A NC N+++LNL+ C  ITDS   SL+    ++L  L+++ C  IT+ S+  +S  C N++ L+++ C  I+ + +E +      LK + +       D     I++Y  +L++    SCS
Sbjct:   71 NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS-RFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCS 219          
BLAST of F-box/LRR-repeat protein 7 vs. TrEMBL
Match: A0A1S3HGJ8 (F-box/LRR-repeat protein 7-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106154362 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 3.289e-55
Identity = 111/374 (29.68%), Postives = 206/374 (55.08%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKE---FVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHH 1960
            P  +++KIF++L    +  C++ C+ WY + W+P LW+ I  +  +      +I+  +K L   L  N    C +V  + ++ C  LTD+ +  I+  CP +++  I+ C  I+N+++F ++S+C  L+ L+V GC LI+ I+  P++ +   +      L  L+++ C  ++D+ L I A     ++ + LR C RI+D G+  I  YC  L+E S++   +++D  +  +S KL  +LRYLS+A C +++D  +  +A  C  L+YLN+  C+ ++D  +  LA + + RL SL+V  C  +T   + +L+ +CP +++L +  C  I+D  V  I +    L+ +NI +   T+ +Y  + K    C I H
Sbjct:  309 PDDVILKIFQHLPTDQLCRCARVCKRWYTLVWEPSLWTQITINNEI-----ANIDRALKFLTRRLSYNTPHVCIMVEKINMNSCERLTDKGLHLIAKRCPELRHLEIQGCANITNLALFEVVSRCTNLEHLNVTGCALITCISLTPDAKLQYGQNPCTIYLRHLDMTDCYALEDSGLKIIASHCTQLQYMYLRRCMRITDIGVQAIALYCTMLKEFSVSDCRRVTDFGLRELS-KLGSSLRYLSVAKCDKVSDVGVKYIAKYCKKLRYLNVRGCEAVSDDALQLLAENCR-RLKSLDVGKC-DVTDEGLEILAEHCPQLKKLSLKSCDAITDSGVVAIAQKCRHLQQLNIQDCHITVDAYRTVKKLCKRCIIEH 674          
BLAST of F-box/LRR-repeat protein 7 vs. TrEMBL
Match: A0A1S3HDN6 (F-box/LRR-repeat protein 7-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106154362 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 4.805e-55
Identity = 111/374 (29.68%), Postives = 206/374 (55.08%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKE---FVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHH 1960
            P  +++KIF++L    +  C++ C+ WY + W+P LW+ I  +  +      +I+  +K L   L  N    C +V  + ++ C  LTD+ +  I+  CP +++  I+ C  I+N+++F ++S+C  L+ L+V GC LI+ I+  P++ +   +      L  L+++ C  ++D+ L I A     ++ + LR C RI+D G+  I  YC  L+E S++   +++D  +  +S KL  +LRYLS+A C +++D  +  +A  C  L+YLN+  C+ ++D  +  LA + + RL SL+V  C  +T   + +L+ +CP +++L +  C  I+D  V  I +    L+ +NI +   T+ +Y  + K    C I H
Sbjct:  335 PDDVILKIFQHLPTDQLCRCARVCKRWYTLVWEPSLWTQITINNEI-----ANIDRALKFLTRRLSYNTPHVCIMVEKINMNSCERLTDKGLHLIAKRCPELRHLEIQGCANITNLALFEVVSRCTNLEHLNVTGCALITCISLTPDAKLQYGQNPCTIYLRHLDMTDCYALEDSGLKIIASHCTQLQYMYLRRCMRITDIGVQAIALYCTMLKEFSVSDCRRVTDFGLRELS-KLGSSLRYLSVAKCDKVSDVGVKYIAKYCKKLRYLNVRGCEAVSDDALQLLAENCR-RLKSLDVGKC-DVTDEGLEILAEHCPQLKKLSLKSCDAITDSGVVAIAQKCRHLQQLNIQDCHITVDAYRTVKKLCKRCIIEH 700          
BLAST of F-box/LRR-repeat protein 7 vs. TrEMBL
Match: A0A1S3IJC1 (F-box/LRR-repeat protein 7 OS=Lingula unguis OX=7574 GN=LOC106164854 PE=4 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 6.120e-55
Identity = 111/374 (29.68%), Postives = 206/374 (55.08%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKE---FVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHH 1960
            P  +++KIF++L    +  C++ C+ WY + W+P LW+ I  +  +      +I+  +K L   L  N    C +V  + ++ C  LTD+ +  I+  CP +++  I+ C  I+N+++F ++S+C  L+ L+V GC LI+ I+  P++ +   +      L  L+++ C  ++D+ L I A     ++ + LR C RI+D G+  I  YC  L+E S++   +++D  +  +S KL  +LRYLS+A C +++D  +  +A  C  L+YLN+  C+ ++D  +  LA + + RL SL+V  C  +T   + +L+ +CP +++L +  C  I+D  V  I +    L+ +NI +   T+ +Y  + K    C I H
Sbjct:  360 PDDVILKIFQHLPTDQLCRCARVCKRWYTLVWEPSLWTQITINNEI-----ANIDRALKFLTRRLSYNTPHVCIMVEKINMNSCERLTDKGLHLIAKRCPELRHLEIQGCANITNLALFEVVSRCTNLEHLNVTGCALITCISLTPDAKLQYGQNPCTIYLRHLDMTDCYALEDSGLKIIASHCTQLQYMYLRRCMRITDIGVQAIALYCTMLKEFSVSDCRRVTDFGLRELS-KLGSSLRYLSVAKCDKVSDVGVKYIAKYCKKLRYLNVRGCEAVSDDALQLLAENCR-RLKSLDVGKC-DVTDEGLEILAEHCPQLKKLSLKSCDAITDSGVVAIAQKCRHLQQLNIQDCHITVDAYRTVKKLCKRCIIEH 725          
BLAST of F-box/LRR-repeat protein 7 vs. TrEMBL
Match: K1P4A1 (F-box/LRR-repeat protein 7 OS=Crassostrea gigas OX=29159 GN=CGI_10012028 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.137e-54
Identity = 112/372 (30.11%), Postives = 204/372 (54.84%), Query Frame = 2
Query:  857 ILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLP----ESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHH 1960
            +++KIF +L    +   S+ C+ WY + W P+LW  I     V+ ++  +++  +K L   L  N    C +V  + L+ C +LTD+ +  I+  CP +++  I+ C  ++N S+F ++S C  L+ L V GC  I+ I+  P    ++     ++  L  L+++ C  ++D  L + A     ++ L LR C RI D G+ YI  YC  L+E+S++  +K++D  +C ++ K+  NLRYLS+A C +I+D  ++ L  +C  L+YLNL  C+ ++D  +  LA    +++ SL++  C  +T   + VL++ CP +++L +  C  I+D  V+ + +   +L+  NI +   T+ +Y  I K    C I H
Sbjct:  304 VIVKIFSHLSSDQLCRASRVCQRWYRVVWDPLLWKRI-----VINSERINVDKAVKYLTKRLSYNTPTVCVIVEKINLNGCEKLTDKGLHTIAKRCPELRHLEIQGCSNVTNHSLFEVVSYCVNLEHLDVTGCPCITRISLTPQIMQQATAHHLRQIYLRTLDMTDCYALEDEGLQVIATHCSQLQFLYLRRCVRIGDAGLQYIAYYCSGLKELSISDCKKVTDFGVCELA-KIGTNLRYLSVAKCDKISDVGIIQLCKHCTKLRYLNLRGCEAVSDDSMDVLARHC-SKIKSLDIGKC-DVTDEGLCVLAQNCPQLKKLSLKSCDAITDAGVKFVAKSCRQLQQFNIQDCHLTVDAYRTIKKYCKKCFIEH 667          
BLAST of F-box/LRR-repeat protein 7 vs. TrEMBL
Match: A0A0P5T7K9 (F-box/LRR-repeat protein OS=Daphnia magna OX=35525 GN=APZ42_031342 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 2.385e-54
Identity = 113/384 (29.43%), Postives = 204/384 (53.12%), Query Frame = 2
Query:  857 ILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLP-----------ESDIVKFKE----FVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            +L+++F  L    +  CS+ CR W+ +AW+P LWS+I  S   L T     +  +K +  ++G    P+CP V  V ++ C+ LTD  +  +S  CP +++  +R C  ++++ +  ++SKC  L  L V GC  I+ I+  P           +SD+           L  ++L+ C  ++D+ + +       +  + LR C  I+D G+ Y+  YC  LRE+S++   +++D  +  ++ +L  NLRYLS+A C +I+D  +  +  +C  L+YLNL  C+ ++D  +  LA +  +RL +L++  C  IT R + +L+ +CPN+++L +  C L++DE V  I  +   L+ +NI +   T+  Y  + K    C I H 
Sbjct:  251 VLLRVFSFLSSSHLALCSRVCRRWHVLAWEPQLWSSIYLSGDNLHT-----DRALKSITRVVGRASPPFCPAVERVVINSCSRLTDRGLQTLSRRCPELRHVELRGCVQLTDVGVLELVSKCVHLTHLDVSGCSQITCIDAGPLRANGNNGDRYKSDLCSNSRPQLYLQLQYIDLTDCVSLEDSGIQMIVRSCAQLTCIYLRRCVHITDLGVKYLASYCTGLRELSISDCVQVTDFGMYELA-RLGPNLRYLSVAKCDQISDAGIKQIGRHCYKLRYLNLRGCEAVSDDSLEVLARTC-SRLRALDLGKC-DITDRGLRLLAEHCPNLKKLSVKSCELVTDEGVRSIAYYCRGLRQLNIQDCLITVEGYRAVKKFCRKCIIEHT 626          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Cavefish
Match: si:dkey-192l18.9 (F-box/LRR-repeat protein 7-like [Source:NCBI gene;Acc:103043891])

HSP 1 Score: 194.512 bits (493), Expect = 4.255e-54
Identity = 106/377 (28.12%), Postives = 189/377 (50.13%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHNF 1966
            P  +L+++F +L    +  C++ CR WY +AW P LW  I  +   L       +  +K L   L  +    C  + +V    C  L+D  +  ++ SCP ++   +  C+ ++N ++F ++S+C  L+ L V GC  ++ I+   E+ +    ++ ++  L  L++  C  ++D  L   A     +  L LR C R+SD  +  +  +C  LRE+SL+    ISD  +  ++ ++   LRYLS+A+CTRITD  L  +A  C  L+YLN   C+ +TD G+  LA S   RL SL+V  CP ++   + +L+  CP +++L +  C  +    +  +     +L+M+N+        +  L+ +    C I H  
Sbjct:  118 PDPVLLQVFSHLSTPQLCRCARVCRRWYNLAWDPRLWRTIQLTGESLHA-----DRALKILTHRLCQDTPNVCLTLETVVASGCRRLSDRGLHVVAQSCPELRRLEVAGCYNVTNEAVFDVVSRCPNLEHLDVSGCPKVTCISLTQETSVQLSPIQGQQTGLRYLDMGDCVSLEDKGLHAIASHCPRLTHLYLRRCSRLSDEALRQLALHCPALRELSLSDCRLISDFGLREVA-RMEGRLRYLSVAHCTRITDVGLRYVARYCPRLRYLNARGCEGLTDQGLGHLARSC-PRLRSLDVGRCPLVSDMGLEILAHCCPGLRRLSLRGCESVIGRGLRALAAGCPELQMLNVQECEVPPEALRLVRRHCRRCVIEHTI 487          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Cavefish
Match: si:dkey-192l18.9 (F-box/LRR-repeat protein 7-like [Source:NCBI gene;Acc:103043891])

HSP 1 Score: 194.512 bits (493), Expect = 4.643e-54
Identity = 106/377 (28.12%), Postives = 189/377 (50.13%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHNF 1966
            P  +L+++F +L    +  C++ CR WY +AW P LW  I  +   L       +  +K L   L  +    C  + +V    C  L+D  +  ++ SCP ++   +  C+ ++N ++F ++S+C  L+ L V GC  ++ I+   E+ +    ++ ++  L  L++  C  ++D  L   A     +  L LR C R+SD  +  +  +C  LRE+SL+    ISD  +  ++ ++   LRYLS+A+CTRITD  L  +A  C  L+YLN   C+ +TD G+  LA S   RL SL+V  CP ++   + +L+  CP +++L +  C  +    +  +     +L+M+N+        +  L+ +    C I H  
Sbjct:  115 PDPVLLQVFSHLSTPQLCRCARVCRRWYNLAWDPRLWRTIQLTGESLHA-----DRALKILTHRLCQDTPNVCLTLETVVASGCRRLSDRGLHVVAQSCPELRRLEVAGCYNVTNEAVFDVVSRCPNLEHLDVSGCPKVTCISLTQETSVQLSPIQGQQTGLRYLDMGDCVSLEDKGLHAIASHCPRLTHLYLRRCSRLSDEALRQLALHCPALRELSLSDCRLISDFGLREVA-RMEGRLRYLSVAHCTRITDVGLRYVARYCPRLRYLNARGCEGLTDQGLGHLARSC-PRLRSLDVGRCPLVSDMGLEILAHCCPGLRRLSLRGCESVIGRGLRALAAGCPELQMLNVQECEVPPEALRLVRRHCRRCVIEHTI 484          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Cavefish
Match: fbxl7 (F-box and leucine-rich repeat protein 7 [Source:NCBI gene;Acc:569430])

HSP 1 Score: 186.808 bits (473), Expect = 1.116e-51
Identity = 101/376 (26.86%), Postives = 195/376 (51.86%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            P    ++IF +L    +  C++ CR WY +AW P LW  +  +  VL      ++  ++ L   L  +    C  + +V +  C  LTD  +  ++  CP ++   +  C+ +SN ++F ++S+C  L+ L + GC  ++ I+   E+ +    +  ++  +  L+++ C  ++D  L   A     +  L LR C R++D G+ ++V YC ++RE+S++    +SD  +  I+ KL  +LRYLS+A+C RITD  +  +A  C  L+YLN   C+ +TD GI  LA S   +L SL++  CP ++   + +L+    N+++L +  C  I+   ++ +  +   L+++N+ +    + +   + +    C I H 
Sbjct:   86 PDHAFLQIFSHLPTNQLCRCARVCRRWYNLAWDPRLWRTVQLAGDVLH-----VDRALRVLTRRLCQDTPNVCLTLETVVVSGCRRLTDRGLYTVAQCCPELRRLEMAGCYNVSNEAVFEVVSRCPNLEHLDISGCSKVTCISLTQEASVKLSPLHGQQISIRYLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRFLVIYCTSIRELSVSDCRFVSDFGLREIA-KLEGHLRYLSIAHCGRITDVGVRYIAKYCIRLRYLNARGCEGLTDHGIEHLAKSC-LKLKSLDIGKCPLVSDAGLELLALNSFNLKRLSVKACESITGRGLQVVAANCFDLQLLNVQDCDVPLEALRFVKRHCKRCVIEHT 454          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Cavefish
Match: fbxl7 (F-box and leucine-rich repeat protein 7 [Source:NCBI gene;Acc:569430])

HSP 1 Score: 188.734 bits (478), Expect = 1.213e-50
Identity = 101/375 (26.93%), Postives = 195/375 (52.00%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHH 1960
            P    ++IF +L    +  C++ CR WY +AW P LW  +  +  VL      ++  ++ L   L  +    C  + +V +  C  LTD  +  ++  CP ++   +  C+ +SN ++F ++S+C  L+ L + GC  ++ I+   E+ +    +  ++  +  L+++ C  ++D  L   A     +  L LR C R++D G+ ++V YC ++RE+S++    +SD  +  I+ KL  +LRYLS+A+C RITD  +  +A  C  L+YLN   C+ +TD GI  LA S   +L SL++  CP ++   + +L+    N+++L +  C  I+   ++ +  +   L+++N+ +    + +   + +    C I H
Sbjct:  315 PDHAFLQIFSHLPTNQLCRCARVCRRWYNLAWDPRLWRTVQLAGDVLH-----VDRALRVLTRRLCQDTPNVCLTLETVVVSGCRRLTDRGLYTVAQCCPELRRLEMAGCYNVSNEAVFEVVSRCPNLEHLDISGCSKVTCISLTQEASVKLSPLHGQQISIRYLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRFLVIYCTSIRELSVSDCRFVSDFGLREIA-KLEGHLRYLSIAHCGRITDVGVRYIAKYCIRLRYLNARGCEGLTDHGIEHLAKSC-LKLKSLDIGKCPLVSDAGLELLALNSFNLKRLSVKACESITGRGLQVVAANCFDLQLLNVQDCDVPLEALRFVKRHCKRCVIEH 682          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Cavefish
Match: fbxl20 (F-box and leucine rich repeat protein 20 [Source:NCBI gene;Acc:103040563])

HSP 1 Score: 120.939 bits (302), Expect = 7.599e-29
Identity = 89/356 (25.00%), Postives = 168/356 (47.19%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            ++ P ++L++IF  L +  +  C+Q  R+W  +A     W  ID   +       DI  ++ + +    G        +  + L  C  + D ++   + +C NI+  S+  C  I++ +   +   C +LK L +  C  I+ ++    S+        L  LN+S+C  V    +         ++ L L+ C ++ D  + +I  +C  L  ++L    +I+DE +  I    +  L+ L ++ C  ITD  L +L  NC  L+ L + +C  +TD G  +LA +    L  +++  C QIT  ++  LS +CP +Q L ++ C LI+D+ +  +    C H  +L++I +DN
Sbjct:   26 KKLPKELLLRIFSFLDVVTLCRCAQVSRSWNVLALDGSNWQRIDLFDF-----QRDIEGRVVENISKRCGG------FLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSLKALSEGCPL----LEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGCTQLEDEALKHIGAHCPELVTLNLQTCSQITDEGLITICRGCHR-LQSLCVSGCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCH-ELEKMDLEECVQITDATLIQLSIHCPRLQVLSLSHCELITDDGIRHLGSGPCAH-DRLEVIELDN 363          

HSP 2 Score: 96.6709 bits (239), Expect = 8.366e-21
Identity = 73/278 (26.26%), Postives = 133/278 (47.84%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEF---VLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAIS--IQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKM 1879
            +CP +  + L  CT +T+ S+  +S  CP ++  +I  C  ++   I  ++  C  LK L ++GC       T  E + +K        L  LNL  C  + D  LI        ++ L +  C  I+D  ++ + + C  LR + +    +++D     ++   +E L  + L  C +ITD +L+ L+ +C  LQ L+L  C+LITD GI  L        RL  + +  CP IT  S+  L + C ++ ++++  C  I+   ++ +  H+  +K+
Sbjct:  141 FCPKLKHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGC-------TQLEDEALKHIGAHCPELVTLNLQTCSQITDEGLITICRGCHRLQSLCVSGCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHE-LEKMDLEECVQITDATLIQLSIHCPRLQVLSLSHCELITDDGIRHLGSGPCAHDRLEVIELDNCPLITDASLEHL-KTCHSLDRIELYDCQQITRAGIKRLRTHLPNIKV 409          

HSP 3 Score: 81.6481 bits (200), Expect = 5.642e-16
Identity = 61/226 (26.99%), Postives = 109/226 (48.23%), Query Frame = 2
Query: 1319 LSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESI------CNISEKLN-------------------ENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDN----TSATI 1909
            L  L+L  C  V D++L  FA   +N+E L L  C +I+D+  + + ++C  L+ + L     I++ S+      C + E+LN                     L+ L L  CT++ D +L  +  +C  L  LNL  C  ITD G++++      RL SL VS C  IT   ++ L + CP ++ L++ +C  ++D     +  +  +L+ ++++     T AT+
Sbjct:   93 LRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGCTQLEDEALKHIGAHCPELVTLNLQTCSQITDEGLITICRGCH-RLQSLCVSGCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDATL 317          

HSP 4 Score: 71.2478 bits (173), Expect = 1.233e-12
Identity = 51/159 (32.08%), Postives = 77/159 (48.43%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSL------------------------AISIQTRLIS-LNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLIT 1930
            NIS++    LR LSL  C  + D++L + A NC N++ L+L+ C  ITDS   SL                        A+S    L+  LN+S+C Q+T   +  L R CP ++ L +  C  + DEA++ I  H  +L  +N+  T + I    LIT
Sbjct:   84 NISKRCGGFLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGCTQLEDEALKHIGAHCPELVTLNL-QTCSQITDEGLIT 241          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Sea Lamprey
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 195.667 bits (496), Expect = 6.480e-56
Identity = 104/416 (25.00%), Postives = 199/416 (47.84%), Query Frame = 2
Query:  731 SNMSDLFIPIRRSTKKSKETQINYSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQ-WVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            S  + +F P  R   +      + +        L  E  P  +++++  +L ++ +   ++ CR WY++ W P LW  +   + W   + P ++   +  L   L  +    C  + ++ L     L D  ++ ++  CP ++   +  C  ISN  +  ++++C  L+ L V  C  I+ ++ +PE+      +  +  +L  L++S C  + D  L+  A     + +L LR C  ++D G+  + R+C  LRE+SL      +D  + +++  L   LRYLSLA+C R+TD +L  L   C  L+YLN   C  +TD G+ SL      RL SL+V  CP +T   + VL+R CP +++L +  C  +S+  +  +      L+++++ + + +  +   + +    C I H 
Sbjct:    2 STSASVFQPSLRHRHREPPGAPDAAAVRVRSGPLSTEWLPDAVMLRVLTHLPVESLCRSARVCRRWYWLVWDPRLWQTVQLGRPWDEGSGP-NVERALDALTARLCRDTPFVCLSLETLVLSGSPALGDAGLLTVARRCPELRRLEVSGCGEISNRGLLEVVTRCPNLEHLDVSDCPEITCVSLIPEASCQACPLHSRHLLLRHLDMSGCSGLTDEGLLAVARHCPRLARLYLRRCPGVADGGLRALARHCTALRELSLCDCPTATDAGLRDVAAALGPRLRYLSLAHCERVTDVTLRCLGRRCPGLRYLNARGCLGVTDRGLESLGRGCP-RLRSLDVGRCPLVTDVGLEVLARGCPGLKRLGLKGCEGVSERGLRGVALCCPGLQLLSVQDCNLSPDTLRFVQQHCRRCVIEHT 415          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Sea Lamprey
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 132.88 bits (333), Expect = 8.910e-35
Identity = 74/293 (25.26%), Postives = 134/293 (45.73%), Query Frame = 2
Query: 1088 LDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTS-ATIRSYDLITKTFPSCSIHHN 1963
            L  C  LTD  +  +++ C +++   +  C  I+   +  ++ +C  L  L   G      +  L    +V      L  L+LS C  ++ A+L   A    N+  L +R C  + D  +  + R C  LR IS +     SD  +  ++  L   L YL  A+C RITD  +  L   C  L+Y+N+  C+ +TD+G+ SLA      L +L+V  CP+++   +  L+   P ++ + +  C  +S   +  + +   +L+ +++     AT  S   + +  P+C I H 
Sbjct:    5 LSGCASLTDAGLRTVASRCSDLRRLEVSGCGGITEEGLREVVLQCRSLHHLDASGNG--GCLAVLSSGHLVAHASLSLRRLDLSGCPSLEAAALRSLAVHCPNLTHLYVRRCPALGDGALRALARGCPRLRAISFSDCPLPSDLGLREVAAALGARLAYLGAAHCGRITDGGMRHLGQRCPALRYVNVRGCEAVTDAGVGSLARGCLA-LAALDVGSCPRVSDLGLVTLAARQPGLRCVGLRGCGAVSGAGLRALADGCPQLRRLSVQGCDVATAESLRYVRRRCPACVIEHT 294          

HSP 2 Score: 67.3958 bits (163), Expect = 2.082e-12
Identity = 38/204 (18.63%), Postives = 82/204 (40.20%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLIT 1672
            +CP +  + + +C  L D ++  ++  CP ++  S   C L S++ +  + +  G                               L+ L  + C  + D  +     +   +  + +R C  ++D G+  + R C  L  + +    ++SD  +  ++ +    LR + L  C  ++   L +LAD C  L+ L++  C + T
Sbjct:  102 HCPNLTHLYVRRCPALGDGALRALARGCPRLRAISFSDCPLPSDLGLREVAAALGAR-----------------------------LAYLGAAHCGRITDGGMRHLGQRCPALRYVNVRGCEAVTDAGVGSLARGCLALAALDVGSCPRVSDLGLVTLAAR-QPGLRCVGLRGCGAVSGAGLRALADGCPQLRRLSVQGCDVAT 275          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Sea Lamprey
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 131.339 bits (329), Expect = 3.832e-34
Identity = 73/302 (24.17%), Postives = 136/302 (45.03%), Query Frame = 2
Query: 1088 LDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEF---------VLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTS-ATIRSYDLITKTFPSCSIHHN 1963
            L  C  LTD  +  +++ C +++   +  C  I+   +  ++ +C  L  L    C  +  +     +D +  +            L  L+LS C  ++ A+L   A    N+  L +R C  + D  +  + R C  LR IS +     SD  +  ++  L   L YL  A+C RITD  +  L   C  L+Y+N+  C+ +TD+G+ SLA      L +L+V  CP+++   +  L+   P ++ + +  C  +S   +  + +   +L+ +++     AT  S   + +  P+C I H 
Sbjct:    3 LSGCASLTDAGLRTVASRCSDLRRLEVSGCGGITEEGLREVVLQCRSLHHLDASDCPCVCGLGLHTRADHMALRALPAVSCGASLSLRRLDLSGCPSLEAAALRSLAVHCPNLTHLYVRRCPALGDGALRALARGCPRLRAISFSDCPLPSDLGLREVAAALGARLAYLGAAHCGRITDGGMRHLGQRCPALRYVNVRGCEAVTDAGVGSLARGCLA-LAALDVGSCPRVSDLGLVTLAARQPGLRCVGLRGCGAVSGAGLRALADGCPQLRRLSVQGCDVATAESLRYVRRRCPACVIEHT 303          

HSP 2 Score: 67.3958 bits (163), Expect = 2.059e-12
Identity = 38/204 (18.63%), Postives = 82/204 (40.20%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLIT 1672
            +CP +  + + +C  L D ++  ++  CP ++  S   C L S++ +  + +  G                               L+ L  + C  + D  +     +   +  + +R C  ++D G+  + R C  L  + +    ++SD  +  ++ +    LR + L  C  ++   L +LAD C  L+ L++  C + T
Sbjct:  111 HCPNLTHLYVRRCPALGDGALRALARGCPRLRAISFSDCPLPSDLGLREVAAALGAR-----------------------------LAYLGAAHCGRITDGGMRHLGQRCPALRYVNVRGCEAVTDAGVGSLARGCLALAALDVGSCPRVSDLGLVTLAAR-QPGLRCVGLRGCGAVSGAGLRALADGCPQLRRLSVQGCDVAT 284          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003881.1 (pep scaffold:Pmarinus_7.0:GL477033:429527:460683:1 gene:ENSPMAG00000003530.1 transcript:ENSPMAT00000003881.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.946 bits (315), Expect = 2.962e-31
Identity = 91/358 (25.42%), Postives = 175/358 (48.88%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQL--DMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
             + P ++L++IF  L +  +  C+Q  R W  +A     W  ID   +       DI  ++ + +    G        +  + L  C  + D ++   S +C NI+  S+  C  I++ +   +   C +LK+L +  C  I+  +    SD  K     L  LN+S+C  V +  +   A +  +M+ LLL+ C+ ++D  +  I +YC  L  ++L +  +++D+ +  +    ++ L+ LS++ C  +TD  L +L  NC +L+ L +  C  ++D+G   LA +    L  +++  C QIT  ++  LS +CP +Q L   ++ C LI+D+ +  +    C H  +L ++ +DN
Sbjct:   27 RKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQKIDLFNF-----QRDIEGRVVENISKRCGG------FLRQLSLRGCLGVGDSALRTFSQNCRNIETLSLNGCTKITDNTCASLGKFCSKLKQLDLTSCTAITNHSLKALSDGCKG----LEHLNVSWCDQVTEDGITALARECHSMKVLLLKGCYMVNDVSLKQIGKYCPELVTLNLQNCSRVTDDGVITVCRGCHK-LQSLSVSGCNALTDALLNALGHNCYHLRILEVAGCSQLSDTGFQMLARNCHD-LEKMDLEECIQITDATLIQLSLHCPRLQVLMQSLSHCELITDDGIRHLGNGACSH-ERLTVLELDN 366          

HSP 2 Score: 89.3521 bits (220), Expect = 4.205e-19
Identity = 50/169 (29.59%), Postives = 92/169 (54.44%), Query Frame = 2
Query: 1397 MEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSA 1903
            + +L LR C  + D+ +    + C+N+  +SLN   KI+D + C    K    L+ L L +CT IT++SL +L+D C  L++LN+  C  +T+ GI +LA    +  + L +  C  +   S+  + +YCP +  L++  C  ++D+ V  +C    KL+ +++   +A
Sbjct:   94 LRQLSLRGCLGVGDSALRTFSQNCRNIETLSLNGCTKITDNT-CASLGKFCSKLKQLDLTSCTAITNHSLKALSDGCKGLEHLNVSWCDQVTEDGITALARECHSMKVLL-LKGCYMVNDVSLKQIGKYCPELVTLNLQNCSRVTDDGVITVCRGCHKLQSLSVSGCNA 260          

HSP 3 Score: 75.8702 bits (185), Expect = 7.685e-15
Identity = 61/215 (28.37%), Postives = 106/215 (49.30%), Query Frame = 2
Query: 1076 HSVK---LDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPES--DIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREI--SLNHLEKISDESICNISEKL--NENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSL 1693
            HS+K   L  C  + D S+  I   CP +   +++ C  +++  +  +   C +L+ LSV GC      N L ++  + +    + L  L ++ C  + D    + A    ++EK+ L  C +I+D  +  +  +C  L+ +  SL+H E I+D+ I ++      +E L  L L NC  +TD SL  L   C +LQ + L+ C+ IT +GI  L
Sbjct:  196 HSMKVLLLKGCYMVNDVSLKQIGKYCPELVTLNLQNCSRVTDDGVITVCRGCHKLQSLSVSGC------NALTDALLNALGHNCYHLRILEVAGCSQLSDTGFQMLARNCHDLEKMDLEECIQITDATLIQLSLHCPRLQVLMQSLSHCELITDDGIRHLGNGACSHERLTVLELDNCPLVTDASLEHL-KGCQSLQRVELYDCQQITRAGIKRL 403          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008139.1 (pep scaffold:Pmarinus_7.0:GL476334:657211:690462:-1 gene:ENSPMAG00000007325.1 transcript:ENSPMAT00000008139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.553 bits (301), Expect = 2.237e-29
Identity = 94/374 (25.13%), Postives = 179/374 (47.86%), Query Frame = 2
Query:  791 QINYSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLIS--AINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            Q+  SD D     L  ++ P ++L++IF  L +  +  C+Q  R+W  +A     W  ID   +       DI  ++ + +    G        +  + L  C  + D ++   + +C NI+  ++  C  I++ +   +   C +LK+L +  C  I+  ++  L  SD  K     L  LN+S+C  V +  +     +   M+ LLL+ CH ++D  +  + +Y   L  ++L +  +++DE +  +    ++ L+ LSL+ CT +TD  L +L  NC  L+ L +  C  ++D+G   LA +    L  +++  C  IT  ++  LS  CP +  L ++ C LI+D+ +  +    C H  +L ++ +DN
Sbjct:    9 QMFSSDGD---EALINKKLPKELLLRIFSCLDVVTLCRCAQVSRSWNVLALDGSNWQRIDLFNF-----QRDIEGRVVENISKRCGG------FLRQLGLRGCQGVGDSALRTFAQNCRNIEILNLNGCTKITDNTCSSLGKFCSKLKQLDLTSCTSITNHSLKALRCSDGCKG----LEHLNVSWCDNVSEDGITALVRECPGMKVLLLKGCHMVNDGALKQVGKYSPGLITLNLQNCSRLTDEGVITMCRGCHK-LQSLSLSGCTALTDAVLNALGHNCPQLRILEVSSCSQLSDAGFQVLARNCH-ELEKMDLEECILITDATLMQLSINCPRLTVLSLSHCELITDDGIRHLTNGACSH-ERLTVLELDN 361          

HSP 2 Score: 80.8777 bits (198), Expect = 1.915e-16
Identity = 49/198 (24.75%), Postives = 100/198 (50.51%), Query Frame = 2
Query: 1319 LSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESI----CNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTS 1900
            L  L L  CQ V D++L  FA   +N+E L L  C +I+D   S + ++C  L+++ L     I++ S+    C+   K    L +L+++ C  ++++ + +L   C  ++ L L  C ++ D  +  +       LI+LN+  C ++T   V  + R C  +Q L ++ C  ++D  +  +  +  +L+++ + + S
Sbjct:   89 LRQLGLRGCQGVGDSALRTFAQNCRNIEILNLNGCTKITDNTCSSLGKFCSKLKQLDLTSCTSITNHSLKALRCSDGCK---GLEHLNVSWCDNVSEDGITALVRECPGMKVLLLKGCHMVNDGALKQVG-KYSPGLITLNLQNCSRLTDEGVITMCRGCHKLQSLSLSGCTALTDAVLNALGHNCPQLRILEVSSCS 282          

HSP 3 Score: 72.4034 bits (176), Expect = 1.033e-13
Identity = 58/215 (26.98%), Postives = 95/215 (44.19%), Query Frame = 2
Query: 1055 NPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKL--NENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSL 1693
              Y P + ++ L  C+ LTDE VI +   C  +++ S+  C  +++  +  +   C +L+ L V                              S C  + DA   + A     +EK+ L  C  I+D  +  +   C  L  +SL+H E I+D+ I +++     +E L  L L NC  +TD SL  L   C +LQ + L+ C+ IT +GI  L
Sbjct:  215 GKYSPGLITLNLQNCSRLTDEGVITMCRGCHKLQSLSLSGCTALTDAVLNALGHNCPQLRILEV------------------------------SSCSQLSDAGFQVLARNCHELEKMDLEECILITDATLMQLSINCPRLTVLSLSHCELITDDGIRHLTNGACSHERLTVLELDNCPLVTDASLEHL-KGCQSLQRVELYDCQQITRAGIKRL 398          

HSP 4 Score: 63.1586 bits (152), Expect = 9.351e-11
Identity = 47/171 (27.49%), Postives = 81/171 (47.37%), Query Frame = 2
Query: 1472 NLREISLNHLEK-ISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLA--------------ISIQTR-------------LISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTS 1900
            N + I L + ++ I    + NIS++    LR L L  C  + D++L + A NC N++ LNL+ C  ITD+   SL                SI                L  LNVS+C  ++   ++ L R CP ++ L +  C +++D A++++ ++   L  +N+ N S
Sbjct:   60 NWQRIDLFNFQRDIEGRVVENISKRCGGFLRQLGLRGCQGVGDSALRTFAQNCRNIEILNLNGCTKITDNTCSSLGKFCSKLKQLDLTSCTSITNHSLKALRCSDGCKGLEHLNVSWCDNVSEDGITALVRECPGMKVLLLKGCHMVNDGALKQVGKYSPGLITLNLQNCS 230          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Yeast
Match: GRR1 (F-box protein component of an SCF ubiquitin-ligase complex; modular substrate specificity factor which associates with core SCF (Cdc53p, Skp1p and Hrt1p/Rbx1p) to form the SCF(Grr1) complex; SCF(Grr1) acts as a ubiquitin-protein ligase directing ubiquitination of substrates such as: Gic2p, Mks1p, Mth1p, Cln1p, Cln2p and Cln3p; involved in carbon catabolite repression, glucose-dependent divalent cation transport, glucose transport, morphogenesis, and sulfite detoxification [Source:SGD;Acc:S000003850])

HSP 1 Score: 75.8702 bits (185), Expect = 1.438e-14
Identity = 68/268 (25.37%), Postives = 138/268 (51.49%), Query Frame = 2
Query: 1064 CPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPES--DIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDT---GISYIVRYCQNLREISLNHLEKISD---ESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAV 1843
            C  + SV +    +++D+    ++  CP ++ F + +   ++  S+ + +     LKR+       I+A N + +   +++  K  +L +++++    V D+SL+    +   + +  + +   I+D     +S +V    +LR I L+  E I+D   ESI N++ K    LR + L  C+RITD SL  L+    NLQ ++   C  ITD+G+ +L  S  TR+  ++ + C  +T+R++  L+   P ++++ + KC  ++DE +
Sbjct:  439 CKFLQSVDITGIRDVSDDVFDTLATYCPRVQGFYVPQARNVTFDSLRNFIVHSPMLKRIK------ITANNNMNDELVELLANKCPLLVEVDITLSPNVTDSSLLKLLTRLVQLREFRITHNTNITDNLFQELSKVVDDMPSLRLIDLSGCENITDKTIESIVNLAPK----LRNVFLGKCSRITDASLFQLSKLGKNLQTVHFGHCFNITDNGVRALFHSC-TRIQYVDFACCTNLTNRTLYELAD-LPKLKRIGLVKCTQMTDEGL 694          

HSP 2 Score: 70.4774 bits (171), Expect = 6.585e-13
Identity = 63/282 (22.34%), Postives = 120/282 (42.55%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLN-------------------------LHKCKLITDSGIMSLAISIQTR---LISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCP 1822
            + P++  +K+     + DE V  ++N CP +    I     +++ S+  +L++  +L+   +     I+                   +L     ++VDD       P  + ++   L  C  I+D  I  IV     LR + L    +I+D S+  +S KL +NL+ +   +C  ITDN + +L  +C  +QY++                         L KC  +TD G++++ +S++ R   L  +++SYC  +T   +  L   CP +  L +   P
Sbjct:  490 HSPMLKRIKITANNNMNDELVELLANKCPLLVEVDITLSPNVTDSSLLKLLTRLVQLREFRITHNTNIT------------------DNLFQELSKVVDDM------PSLRLID---LSGCENITDKTIESIVNLAPKLRNVFLGKCSRITDASLFQLS-KLGKNLQTVHFGHCFNITDNGVRALFHSCTRIQYVDFACCTNLTNRTLYELADLPKLKRIGLVKCTQMTDEGLLNM-VSLRGRNDTLERVHLSYCSNLTIYPIYELLMSCPRLSHLSLTAVP 742          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Nematostella
Match: EDO45889 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU9])

HSP 1 Score: 157.532 bits (397), Expect = 2.499e-42
Identity = 106/376 (28.19%), Postives = 194/376 (51.60%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPES----DIVKFKEFV-LSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHH 1960
            P  +L+ IF  L   ++   S  C  W ++ W PVLW++I     +L  + +DIN  ++  L  LG +   YC  V S+KL+    ++D+ +  IS  C ++++  +  C  +++  I  +L  C  L+ L+V GC  +++I   P S     I +  +F+ L  L+LS C   DD  L         +E L LR C +++D GI +I   C+ L+E+S +   K+ D S+  +++ +   L+YLS+A C  ++D  +  +   C +L+YLN+  C+ +TD+GI +  +    +L SL++  C  IT  +++ +  +CP +++L M  C  +S   ++ I      ++ +N+   +    ++  I K   SC I H
Sbjct:    7 PEDLLLNIFSYLTTPELCLASGVCCKWQYLCWDPVLWTSIK----ILNHQNSDINRVLRNTLTKLGSSTQGYCLTVRSIKLNGSELVSDKGLGCISRFCIDLEHLELIGCCCVTSKGIQEVLMNCSSLRHLNVAGCSCLNSI--CPPSFNGFSITENGQFLKLRHLDLSDCVAFDDMGLRTVGLSCGLLENLYLRRCTQVTDVGIRHIANNCRQLKELSTSDCYKVRDFSLKEMAKNI-PTLKYLSVAKCP-VSDTGIKYIGRYCVHLKYLNVRGCEAVTDAGI-AFVVQNCLKLRSLDIGKCA-ITDSALNTIGIHCPQLKKLSMKGCDRVSVNGIKCIANQCCNIQYLNVQECNLDYDTFVYIRKHCRSCIIEH 372          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Nematostella
Match: EDO42575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S147])

HSP 1 Score: 105.145 bits (261), Expect = 1.106e-24
Identity = 93/344 (27.03%), Postives = 156/344 (45.35%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTD--ESVIF-----ISNSCPNIKNFSIRKCFLISNISIFHILSKC--GELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI 1852
            P  +++ IF+ L IK +   S+ CR WY +     LW  +D   W L  +   I +K+          RN  C  V  +++      T   E++ F     I   CPN++  ++  C       + ++ ++C  G LK L ++    I  +N     D+  F   +L +LNL++C  V D  L   A K   ++ L L NC+R+ D GI  I     NL                         NL +L L+NCT ITD  L  +  +   L+YL L  C+ ITD+G+ +L  S+   L  L+++ C ++TS  +  ++  C  ++ LD+  C L++ + ++ I
Sbjct:   15 PDNVMLNIFRYLDIKALCAASKVCRRWYHLGKDRSLWKAVDLRPWPLALR---ILWKVV---------RNRLCETVTELQIKGFLGTTKKHENISFSLLEEIKTKCPNLEKLTLCYC------DMRNVDARCLPGTLKSLDLD--HSIVPLNWFDSLDVDLFFANLL-ELNLTYCTRVSDQDLASIA-KLTQLKCLNLSNCYRVGDNGIQQIA---TNL------------------------TNLLHLDLSNCTDITDLGLHHIGRHLVRLKYLYLTCCRRITDTGVEALVHSM-AELQGLSLAKCRELTSTGIVTIAENCKQLKHLDITDCTLVNTQGLDTI 308          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Nematostella
Match: EDO35101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMF7])

HSP 1 Score: 105.145 bits (261), Expect = 2.913e-23
Identity = 93/372 (25.00%), Postives = 165/372 (44.35%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDF-------SQW---VLKTKPTDINFXX-XXXXXXXGGNRNPY---CPLVHSVKLDKCT--ELTDESVIF-ISNSCPNIKNFSI-------------------------RKCFLISNISIFHILSKCGE-LKRLSVEGCKLISAINTLPES-DIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKC-KLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLI 1828
            P +I++KIF +L  KD+  C+  C+ +Y IA    LW +I          +W   + K  PT +     +   +   G R+ +   C  +  V    C+  EL  ES++  IS  C ++ +  +                           C  +++ S+  I  + GE L+   V GC      N  P    ++  K   L  LNL  C  + D++L         +E L LR C +I D+ +  IVR+C  L+ ++L +  +I+D ++  I+  L  ++R L +  C++++D  + +LA  C  ++ L+L    + +T   + SLA      L +L +S+C  IT  +V  L+R C  +  L +  C  +
Sbjct:  774 PDEIVLKIFSSLSHKDLATCALVCQQFYRIAMDETLWGSITLIKKEIKSDEWLEEIGKRHPTSLTISHCRGNCVTANGLRSLFRNCCDTLEEVDFSGCSGGELIGESILLHISARCTSVVSVDVSWTNVSDNGVQALVENIIQLECLCLNGCQAVTDKSLRSIADRHGESLRIFEVFGC-----FNITPGGFKMLAGKCCHLQTLNLGQCHKMTDSALGSLVSHLPELENLDLRGCKQIRDSAVKKIVRHCPLLKCLALANCPRITDVTLAEIATNL-PDIRSLDICGCSKVSDVGVRALARCCNKMESLDLSSTGEAVTHKSVTSLANYCSQSLQTLKLSFCADITDETVLHLARQCRKLSLLHLYGCKRV 1139          

HSP 2 Score: 88.5817 bits (218), Expect = 4.673e-18
Identity = 49/153 (32.03%), Postives = 86/153 (56.21%), Query Frame = 2
Query: 1430 ISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINI 1888
            +SD G+  +V     L  + LN  + ++D+S+ +I+++  E+LR   +  C  IT      LA  CC+LQ LNL +C  +TDS + SL +S    L +L++  C QI   +V  + R+CP ++ L +  CP I+D  + EI  ++  ++ ++I
Sbjct:  902 VSDNGVQALVENIIQLECLCLNGCQAVTDKSLRSIADRHGESLRIFEVFGCFNITPGGFKMLAGKCCHLQTLNLGQCHKMTDSALGSL-VSHLPELENLDLRGCKQIRDSAVKKIVRHCPLLKCLALANCPRITDVTLAEIATNLPDIRSLDI 1053          

HSP 3 Score: 53.1434 bits (126), Expect = 3.528e-7
Identity = 41/167 (24.55%), Postives = 80/167 (47.90%), Query Frame = 2
Query: 1418 NCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCT----------RITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINI 1888
            NC  ++  G+  + R C        + LE++ D S C+  E + E++     A CT           ++DN + +L +N   L+ L L+ C+ +TD  + S+A      L    V  C  IT     +L+  C ++Q L++ +C  ++D A+  +  H+ +L+ +++
Sbjct:  845 NC--VTANGLRSLFRNC-------CDTLEEV-DFSGCSGGELIGESILLHISARCTSVVSVDVSWTNVSDNGVQALVENIIQLECLCLNGCQAVTDKSLRSIADRHGESLRIFEVFGCFNITPGGFKMLAGKCCHLQTLNLGQCHKMTDSALGSLVSHLPELENLDL 1001          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Nematostella
Match: EDO47403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLW1])

HSP 1 Score: 96.2857 bits (238), Expect = 1.039e-21
Identity = 86/327 (26.30%), Postives = 156/327 (47.71%), Query Frame = 2
Query:  857 ILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISD---ESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLIT---DSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKC 1819
            +L+KIF  L IK  L+    C  WY + +   +W  I+     L+   +   F+     I   G R      V  V +     + D  V+ I+ +CPN+K   ++ CF +++ S+  +   C  L+ +++      +A       ++V+    +   ++L++C  + D SL   A + K ++   +R C +++D G+  I+  C  LR + +  L ++SD   +S+ N +E L  NL+ L + + TR+ D +L  L + C NL+ L      L+    DS + ++A     +LI L +  C   + R VS LSR CP + +L +  C
Sbjct:    1 LLLKIFHFLPIKSRLSLRCVCWKWYQLLFDFSIWQKINLGD-DLELLSSGRCFEFFTEWIFYFGAR------VQEVDVGGVAWVDDRMVVLIAQNCPNLKRLDLKACFKVTDASLKEVARYCTNLECINL----YCTATTENGFEELVRRCRNISGCIHLTWCFFITDESLKSIANQCKCLKTFRIRECQQVTDQGLKEILLSCSMLRTLEIERLYQVSDLTNQSM-NRAENL-PNLQSLKITD-TRMNDETLTKLTERCPNLRSLLKWLSVLVRRVHDSDLFAIATH-SHQLIGLELGDCGGCSDRGVSSLSRGCPYLMKLVLKGC 312          

HSP 2 Score: 59.3066 bits (142), Expect = 1.965e-9
Identity = 49/181 (27.07%), Postives = 90/181 (49.72%), Query Frame = 2
Query: 1352 VDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLS----LANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRY--CPNIQQLDMNKCPLISDEAVEEICEHIIKLK 1876
            VDD  +++ A    N+++L L+ C +++D  +  + RYC NL  I+L            N  E+L    R +S    L  C  ITD SL S+A+ C  L+   + +C+ +TD G+  + +S  + L +L +    Q++  +   ++R    PN+Q L +     ++DE + ++ E    L+
Sbjct:   77 VDDRMVVLIAQNCPNLKRLDLKACFKVTDASLKEVARYCTNLECINLYCTATTE-----NGFEELVRRCRNISGCIHLTWCFFITDESLKSIANQCKCLKTFRIRECQQVTDQGLKEILLSC-SMLRTLEIERLYQVSDLTNQSMNRAENLPNLQSLKITD-TRMNDETLTKLTERCPNLR 250          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Nematostella
Match: EDO41009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5H2])

HSP 1 Score: 89.7373 bits (221), Expect = 1.905e-19
Identity = 86/348 (24.71%), Postives = 176/348 (50.57%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWV-LKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLD--KCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKE---FVLSDLNLSFCQMVDDASLIIFAPKFKN----MEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSL---ANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI 1852
            P +++  IF  L + DI + ++ C  W   +  P+LW N   + +   KT P  + + ++         ++  C L    KLD   C  L D +V  ++ + P+I + S+  C  + ++S +  L K   LK LS     L  + + + +  ++KF E     L  ++LS C+ + D  +  F P  K+    ++ L+L  C   +D  +   +    NL+++ ++    + D  +  I+E L  NL+ L +   AN T +TD +L++++ +  +L+ L+ + C L+TD+G++++A  + ++L +L+ S C  ++  SV  L+++   +  LD++ C  ++   V+E+
Sbjct:    2 PQEVVSYIFSFLPLADIKSSARVCHLWAKASDDPLLWKNTTATLYTKSKTFPDSLIYSLQC--------KSQQC-LTSLSKLDISWCKGLGDSAVKTVATALPSISHLSLAGCKEV-HLSSWQSLGK--NLKSLSF----LDISRSDITDVILLKFAEVPTLSLRSIDLSACKQLTDNGVKFFIPDSKSSVLPLQTLILNGCTMATDNFLKRCLPAMVNLQQLDISSCLHVGDSGMHVITELLT-NLKMLKISWCANITDVTDATLVNVSRHLRSLRELSFNGCSLVTDTGVIAIAQGL-SQLQTLDASKCDGVSDLSVFHLAKHSSRLTHLDLSMCSHVTSNGVDEL 331          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Medaka
Match: si:dkey-192l18.9 (F-box and leucine rich repeat protein 7 [Source:NCBI gene;Acc:101166834])

HSP 1 Score: 185.652 bits (470), Expect = 7.146e-51
Identity = 99/376 (26.33%), Postives = 195/376 (51.86%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            P   L++IF  L    +  C++ CR WY +AW P LW ++  +  +L       +  I+ L   L  +    C  + +V ++ C  LTD  +  ++  CP ++   +  C+ ISN ++F ++++C  L+ L++ GC  ++ I+   E+ +    +  ++  +  L+++ C  ++D  L   A     +  L LR C R++D  + ++  YC ++RE+SL+    + D  +  ++ +L   LRYLS+A+CTRITD  +  +A  C  L+YLN   C+ +TD G+  LA S   +L SL+V  CP ++   +  L+ YC  ++++ +  C  +S   ++ +  +  +L+++N+ +   +  +   + +    C I H 
Sbjct:  118 PDHTLLQIFSRLSTNQLCRCARVCRRWYNLAWDPRLWVSVRLTGELLHA-----DRAIRVLTHRLCQDTPNVCLTLETVVVNGCKRLTDRGLHVLAQCCPELRRLEVAGCYNISNGAVFEVVTRCPNLEHLNLSGCSKVTCISLTQEASLQLSPLHGQQISIHYLDMTDCFSLEDEGLRTIAAHCPRLTHLYLRRCVRLTDEALRHLALYCSSIRELSLSDCRLVGDFGLREVA-RLEGCLRYLSVAHCTRITDVGVRYVARYCPRLRYLNARGCEGLTDHGLGHLARSC-PKLKSLDVGKCPLVSDSGLEQLAMYCQGLRRVSLRACESVSGRGLKALAANCCELQLLNVQDCEVSPEALRFVRRHCRRCVIEHT 486          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Medaka
Match: si:dkey-192l18.9 (F-box and leucine rich repeat protein 7 [Source:NCBI gene;Acc:101166834])

HSP 1 Score: 184.496 bits (467), Expect = 7.743e-51
Identity = 99/376 (26.33%), Postives = 195/376 (51.86%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            P   L++IF  L    +  C++ CR WY +AW P LW ++  +  +L       +  I+ L   L  +    C  + +V ++ C  LTD  +  ++  CP ++   +  C+ ISN ++F ++++C  L+ L++ GC  ++ I+   E+ +    +  ++  +  L+++ C  ++D  L   A     +  L LR C R++D  + ++  YC ++RE+SL+    + D  +  ++ +L   LRYLS+A+CTRITD  +  +A  C  L+YLN   C+ +TD G+  LA S   +L SL+V  CP ++   +  L+ YC  ++++ +  C  +S   ++ +  +  +L+++N+ +   +  +   + +    C I H 
Sbjct:   76 PDHTLLQIFSRLSTNQLCRCARVCRRWYNLAWDPRLWVSVRLTGELLHA-----DRAIRVLTHRLCQDTPNVCLTLETVVVNGCKRLTDRGLHVLAQCCPELRRLEVAGCYNISNGAVFEVVTRCPNLEHLNLSGCSKVTCISLTQEASLQLSPLHGQQISIHYLDMTDCFSLEDEGLRTIAAHCPRLTHLYLRRCVRLTDEALRHLALYCSSIRELSLSDCRLVGDFGLREVA-RLEGCLRYLSVAHCTRITDVGVRYVARYCPRLRYLNARGCEGLTDHGLGHLARSC-PKLKSLDVGKCPLVSDSGLEQLAMYCQGLRRVSLRACESVSGRGLKALAANCCELQLLNVQDCEVSPEALRFVRRHCRRCVIEHT 444          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Medaka
Match: si:dkey-192l18.9 (F-box and leucine rich repeat protein 7 [Source:NCBI gene;Acc:101166834])

HSP 1 Score: 184.882 bits (468), Expect = 9.417e-51
Identity = 99/376 (26.33%), Postives = 195/376 (51.86%), Query Frame = 2
Query:  848 PSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDI----VKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHN 1963
            P   L++IF  L    +  C++ CR WY +AW P LW ++  +  +L       +  I+ L   L  +    C  + +V ++ C  LTD  +  ++  CP ++   +  C+ ISN ++F ++++C  L+ L++ GC  ++ I+   E+ +    +  ++  +  L+++ C  ++D  L   A     +  L LR C R++D  + ++  YC ++RE+SL+    + D  +  ++ +L   LRYLS+A+CTRITD  +  +A  C  L+YLN   C+ +TD G+  LA S   +L SL+V  CP ++   +  L+ YC  ++++ +  C  +S   ++ +  +  +L+++N+ +   +  +   + +    C I H 
Sbjct:  109 PDHTLLQIFSRLSTNQLCRCARVCRRWYNLAWDPRLWVSVRLTGELLHA-----DRAIRVLTHRLCQDTPNVCLTLETVVVNGCKRLTDRGLHVLAQCCPELRRLEVAGCYNISNGAVFEVVTRCPNLEHLNLSGCSKVTCISLTQEASLQLSPLHGQQISIHYLDMTDCFSLEDEGLRTIAAHCPRLTHLYLRRCVRLTDEALRHLALYCSSIRELSLSDCRLVGDFGLREVA-RLEGCLRYLSVAHCTRITDVGVRYVARYCPRLRYLNARGCEGLTDHGLGHLARSC-PKLKSLDVGKCPLVSDSGLEQLAMYCQGLRRVSLRACESVSGRGLKALAANCCELQLLNVQDCEVSPEALRFVRRHCRRCVIEHT 477          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Medaka
Match: fbxl2 (F-box/LRR-repeat protein 2 [Source:NCBI gene;Acc:101157070])

HSP 1 Score: 124.405 bits (311), Expect = 4.853e-30
Identity = 89/368 (24.18%), Postives = 174/368 (47.28%), Query Frame = 2
Query:  800 YSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHII---KLKMINIDN 1894
            +S++D  P     ++ P ++L++IF  L +  +  C+Q  + W  +A     W  ID   +      TDI  ++ + +    G        +  + L  C  + D S+   + +C NI+  ++  C  I++ +   +   C +L++L +  C  IS  +    SD  +    +L  LNLS+C  +    +   A     +  L LR C ++ D  + +  ++C  L  I++    +I+DE + ++    ++ L+ L ++ C  ITD SL +L  NC  L+ L   +C  +TD+G   LA +    L  +++  C  +T  ++  LS +CP +Q L ++ C LI+D+ +  +        +L ++ +DN
Sbjct:   12 FSNSDEAPIN---KKLPKELLLRIFSYLDVVTLCRCAQVSKAWNVLALDGSNWQKIDLFNF-----QTDIEGRVVENISKRCGG------FLRQLSLRGCLSVGDASMKTFAQNCRNIEVLNLNGCTKITDSTCLSLSKFCSKLRQLDLTSCVSISNHSLKALSDGCR----MLETLNLSWCDQITRDGIEALARGCMGLRALFLRGCTQLDDGALKHFQKHCPELTTINMQSCTQITDEGLVSLCRGCHK-LQVLCVSGCGNITDASLTALGLNCPRLKILEAARCSHVTDAGFTVLARNCH-ELEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITDDGIRALSSSTCGQERLTVLELDN 359          

HSP 2 Score: 72.4034 bits (176), Expect = 6.151e-13
Identity = 53/210 (25.24%), Postives = 93/210 (44.29%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKL--NENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGI 1684
            +CP + ++ +  CT++TDE ++ +   C  ++   +  C  I++ S+  +   C  LK L                                + C  V DA   + A     +EK+ L  C  ++D  +  +  +C  L+ +SL+H E I+D+ I  +S      E L  L L NC  ITD +L  L  +C  L+ + L+ C+ +T +GI
Sbjct:  215 HCPELTTINMQSCTQITDEGLVSLCRGCHKLQVLCVSGCGNITDASLTALGLNCPRLKILEA------------------------------ARCSHVTDAGFTVLARNCHELEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITDDGIRALSSSTCGQERLTVLELDNCPLITDVTLEHL-KSCHRLERIELYDCQQVTRAGI 393          
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Medaka
Match: fbxl20 (F-box/LRR-repeat protein 20 [Source:NCBI gene;Acc:101160411])

HSP 1 Score: 120.939 bits (302), Expect = 8.287e-29
Identity = 90/356 (25.28%), Postives = 166/356 (46.63%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEI----CEHIIKLKMINIDN 1894
            ++ P ++L++IF  L +  +  C+Q  R+W  +A     W  ID   +       DI  ++ + +    G        +  + L  C  + D ++   + +C NI+  S+  C  I++ +   +   C +LK L +  C  I+ ++    S+        L  LN+S+C  V    +         ++ L L+ C ++ D  +  I  YC  L  ++L    +I+DE +  I    +  L+ L ++ C  ITD  L +L  NC  L+ L + +C  +TD G  +LA +    L  +++  C QIT  ++  LS +CP +Q L ++ C LI+D+ +  +    C H   L++I +DN
Sbjct:   26 KKLPKELLLRIFSFLDVVTLCRCAQVSRSWNVLALDGSNWQRIDLFDF-----QRDIEGRVVENISKRCGG------FLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCSSLSKFCPKLKHLDLASCTSITNLSLKALSEGCH----SLEQLNISWCDQVTKDGIQALVRSCPGLKGLFLKGCTQLEDEALKQIGAYCPELVTLNLQTCSQITDEGLITICRGCHR-LQSLCVSGCANITDAILHALGQNCPRLRILEVARCSQLTDVGFTTLARNCH-ELEKMDLEECVQITDGTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGSGPCAHDC-LEVIELDN 363          

HSP 2 Score: 93.5893 bits (231), Expect = 8.743e-20
Identity = 69/277 (24.91%), Postives = 131/277 (47.29%), Query Frame = 2
Query: 1061 YCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFV--LSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAIS--IQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKM 1879
            +CP +  + L  CT +T+ S+  +S  C +++  +I  C  ++   I  ++  C  LK L ++GC        L +  + +   +   L  LNL  C  + D  LI        ++ L +  C  I+D  +  + + C  LR + +    +++D     ++   +E L  + L  C +ITD +L+ L+ +C  LQ L+L  C+LITD GI  L         L  + +  CP IT  S+  L + C ++ ++++  C  I+   ++ +  H+  +K+
Sbjct:  141 FCPKLKHLDLASCTSITNLSLKALSEGCHSLEQLNISWCDQVTKDGIQALVRSCPGLKGLFLKGC------TQLEDEALKQIGAYCPELVTLNLQTCSQITDEGLITICRGCHRLQSLCVSGCANITDAILHALGQNCPRLRILEVARCSQLTDVGFTTLARNCHE-LEKMDLEECVQITDGTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGSGPCAHDCLEVIELDNCPLITDASLEHL-KSCHSLDRIELYDCQQITRAGIKRLRTHLPNIKV 409          

HSP 3 Score: 70.0922 bits (170), Expect = 2.962e-12
Identity = 49/159 (30.82%), Postives = 79/159 (49.69%), Query Frame = 2
Query: 1529 NISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLA-------------------ISIQT------RLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLIT 1930
            NIS++    LR LSL  C  + D++L + A NC N++ L+L+ C  ITDS   SL+                   +S++        L  LN+S+C Q+T   +  L R CP ++ L +  C  + DEA+++I  +  +L  +N+  T + I    LIT
Sbjct:   84 NISKRCGGFLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCSSLSKFCPKLKHLDLASCTSITNLSLKALSEGCHSLEQLNISWCDQVTKDGIQALVRSCPGLKGLFLKGCTQLEDEALKQIGAYCPELVTLNL-QTCSQITDEGLIT 241          
BLAST of F-box/LRR-repeat protein 7 vs. Planmine SMEST
Match: SMESG000053104.1 (SMESG000053104.1)

HSP 1 Score: 1095.49 bits (2832), Expect = 0.000e+0
Identity = 574/575 (99.83%), Postives = 574/575 (99.83%), Query Frame = 2
Query:  254 MKKFKRKLNISACIGYKNQKEDCNISNFSEFQTADSGIVSDQSSLQDHPHTKPLSDKXXXXXXXXXXXXAILAKSRPSPLYQXXXXXXXXXXXQKRINFAQNLSAINENSITSPNPIGLHSNVIDYGPIHPYMKVPNYHRDQHSDAYATVASTSDDDTKSNMSDLFIPIRRSTKKSKETQINYSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHNFVTDC 1978
            MKKFKRKLNISACIGYKNQKEDCNISNFSEFQTADSGIVSDQSSLQDHPHTKPLSDKSTTTNFTESSSFAILAKSRPSPLYQNINNNNINNTNQKRINFAQNLSAINENSITSPNPIGLHSNVIDYGPIHPYMKVPNYHRDQHSDAYATVASTSDDDTKSNMSDLFIPIRRSTKKSKE QINYSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFKIKKLLILLGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHNFVTDC
Sbjct:    1 MKKFKRKLNISACIGYKNQKEDCNISNFSEFQTADSGIVSDQSSLQDHPHTKPLSDKSTTTNFTESSSFAILAKSRPSPLYQNINNNNINNTNQKRINFAQNLSAINENSITSPNPIGLHSNVIDYGPIHPYMKVPNYHRDQHSDAYATVASTSDDDTKSNMSDLFIPIRRSTKKSKENQINYSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFKIKKLLILLGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSATIRSYDLITKTFPSCSIHHNFVTDC 575          
BLAST of F-box/LRR-repeat protein 7 vs. Planmine SMEST
Match: SMESG000050765.1 (SMESG000050765.1)

HSP 1 Score: 120.168 bits (300), Expect = 2.372e-28
Identity = 100/355 (28.17%), Postives = 189/355 (53.24%), Query Frame = 2
Query:  857 ILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFV------LSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLS---RYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDN 1894
            IL  I + L + D+ +C++ C+ WY + W   +W  +DFSQ        +I+  I  +L +L     P+C  +  + L KC ++TD+ +I I+N CP ++  ++     + N S+ H++  C  +  L++  C  I+ +  L +S I     F       L  L+LS+C+ +DD+ +  F+P F  + KL+L+ C  I+D G+  + +Y  +L+ + +     ++D+ I ++   L   LR LS++ C +IT+NS+ +++ +   +  + L  C  IT S   SL +    R+I L+ +   QI+ +S+  ++   RY  +++ L +NK   IS E + E+ +  ++LK I+I N
Sbjct:  166 ILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQ-CHNDSGINIHKGIDTILKILSYRTPPFCYCLKMIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELK-LIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNL-HCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFS---SLKLLRNLRIIDLSDNC--QISRQSIFQIAENNRY--SLKILIINKFDNISREFLRELFQMCVRLKYIDIKN 509          
BLAST of F-box/LRR-repeat protein 7 vs. Planmine SMEST
Match: SMESG000081003.1 (SMESG000081003.1)

HSP 1 Score: 117.857 bits (294), Expect = 1.704e-27
Identity = 102/397 (25.69%), Postives = 187/397 (47.10%), Query Frame = 2
Query:  755 PIRRSTKKSKETQINYSDNDFYPTELKWERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHL-EKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADN----------------------------CCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICE 1858
             +R++ +K +E +    + +  P  +  E+ P ++ I IF  L I  +  CSQ C+ WY IA+    W  I+   +       DI   +   +  + G        +  +++  C  ++D+ +  ++  CP I++ ++ +C  ++N S   +   C  L  L ++ C   + IN     +I   K   L  L+LSFC + D+  L   A     +  L L+ C +I+  GIS I + C  LR ++ N++ E ++D+++  ++   +E LR L ++NC  ITD  L +LA N                            C  L  + + +C+ ITD+GI SL     +RL  L++  C  +T  S++ LS +CP ++ L ++ C  I+D  V+++ E
Sbjct:   63 AMRQTEQKDQEQEKEIKELNLKPGYIN-EKLPKELFIMIFGYLDITALCRCSQVCKFWYEIAFDGSNWKTINLFDF-----QKDITSNVVSKITEISGR------FLRELRMKGCIHISDKDIKNLAEQCPLIEDLTLSECVNLTNESSVSVTRNCTNLTSLYIDSC---TKINDDGIKEIANCKN--LMKLDLSFCDISDEG-LRYIARGCPLLTFLRLKGCLKITSDGISEIAKSCPKLRLMNCNYVGELLTDKALALLARYCSE-LRTLCVSNCN-ITDAGLKALAGNISAFSIDKSDIDSGEGDNMHNNGLKQFGCRELTVVEVSRCR-ITDTGI-SLLAGACSRLEKLDLEDCASLTDGSLTFLSIHCPKLRILLLSHCDQITDNGVQKLVE 437          

HSP 2 Score: 84.7297 bits (208), Expect = 7.505e-17
Identity = 63/234 (26.92%), Postives = 114/234 (48.72%), Query Frame = 2
Query: 1064 CPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCF-LISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKF--------------------KEFVLSDL---NLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLN---ENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGI 1684
            CPL+  ++L  C ++T + +  I+ SCP ++  +      L+++ ++  +   C EL+ L V  C +  A       +I  F                    K+F   +L    +S C+ + D  + + A     +EKL L +C  ++D  ++++  +C  LR + L+H ++I+D  +  + E  +    NL YL+L NC  +TD SL  L+ NC  L+ L+L+ C+LIT   I
Sbjct:  256 CPLLTFLRLKGCLKITSDGISEIAKSCPKLRLMNCNYVGELLTDKALALLARYCSELRTLCVSNCNITDAGLKALAGNISAFSIDKSDIDSGEGDNMHNNGLKQFGCRELTVVEVSRCR-ITDTGISLLAGACSRLEKLDLEDCASLTDGSLTFLSIHCPKLRILLLSHCDQITDNGVQKLVEMPSGGCRNLEYLALDNCPLLTDESLTCLSKNCAFLKKLDLYDCQLITKQSI 488          
BLAST of F-box/LRR-repeat protein 7 vs. Planmine SMEST
Match: SMESG000081003.1 (SMESG000081003.1)

HSP 1 Score: 114.005 bits (284), Expect = 1.709e-26
Identity = 98/369 (26.56%), Postives = 174/369 (47.15%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHL-EKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADN----------------------------CCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICE 1858
            E+ P ++ I IF  L I  +  CSQ C+ WY IA+    W  I+   +       DI   +   +  + G        +  +++  C  ++D+ +  ++  CP I++ ++ +C  ++N S   +   C  L  L ++ C   + IN     +I   K   L  L+LSFC + D+  L   A     +  L L+ C +I+  GIS I + C  LR ++ N++ E ++D+++  ++   +E LR L ++NC  ITD  L +LA N                            C  L  + + +C+ ITD+GI SL     +RL  L++  C  +T  S++ LS +CP ++ L ++ C  I+D  V+++ E
Sbjct:   41 EKLPKELFIMIFGYLDITALCRCSQVCKFWYEIAFDGSNWKTINLFDF-----QKDITSNVVSKITEISGR------FLRELRMKGCIHISDKDIKNLAEQCPLIEDLTLSECVNLTNESSVSVTRNCTNLTSLYIDSC---TKINDDGIKEIANCKN--LMKLDLSFCDISDEG-LRYIARGCPLLTFLRLKGCLKITSDGISEIAKSCPKLRLMNCNYVGELLTDKALALLARYCSE-LRTLCVSNCN-ITDAGLKALAGNISAFSIDKSDIDSGEGDNMHNNGLKQFGCRELTVVEVSRCR-ITDTGI-SLLAGACSRLEKLDLEDCASLTDGSLTFLSIHCPKLRILLLSHCDQITDNGVQKLVE 388          

HSP 2 Score: 83.9593 bits (206), Expect = 9.901e-17
Identity = 63/234 (26.92%), Postives = 114/234 (48.72%), Query Frame = 2
Query: 1064 CPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCF-LISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKF--------------------KEFVLSDLNL---SFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLN---ENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGI 1684
            CPL+  ++L  C ++T + +  I+ SCP ++  +      L+++ ++  +   C EL+ L V  C +  A       +I  F                    K+F   +L +   S C+ + D  + + A     +EKL L +C  ++D  ++++  +C  LR + L+H ++I+D  +  + E  +    NL YL+L NC  +TD SL  L+ NC  L+ L+L+ C+LIT   I
Sbjct:  207 CPLLTFLRLKGCLKITSDGISEIAKSCPKLRLMNCNYVGELLTDKALALLARYCSELRTLCVSNCNITDAGLKALAGNISAFSIDKSDIDSGEGDNMHNNGLKQFGCRELTVVEVSRCR-ITDTGISLLAGACSRLEKLDLEDCASLTDGSLTFLSIHCPKLRILLLSHCDQITDNGVQKLVEMPSGGCRNLEYLALDNCPLLTDESLTCLSKNCAFLKKLDLYDCQLITKQSI 439          
BLAST of F-box/LRR-repeat protein 7 vs. Planmine SMEST
Match: SMESG000081003.1 (SMESG000081003.1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.757e-19
Identity = 87/352 (24.72%), Postives = 150/352 (42.61%), Query Frame = 2
Query:  839 ERTPSKILIKIFKNLQIKDILNCSQTCRNWYFIAW----QPVLWSNIDFSQWVLKTKPT---------------------------------------DINFXXXXXXXXXGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCF-LISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKF--------------------KEFVLSDLN---LSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLN---ENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGI 1684
            E+ P ++ I IF  L I  +  CSQ C+ WY IA+    Q  L  ++  S+ V  T  +                                       D++F       L    R   CPL+  ++L  C ++T + +  I+ SCP ++  +      L+++ ++  +   C EL+ L V  C +  A       +I  F                    K+F   +L    +S C+ + D  + + A     +EKL L +C  ++D  ++++  +C  LR + L+H ++I+D  +  + E  +    NL YL+L NC  +TD SL  L+ NC  L+ L+L+ C+LIT   I
Sbjct:   41 EKLPKELFIMIFGYLDITALCRCSQVCKFWYEIAFDGTEQCPLIEDLTLSECVNLTNESSVSVTRNCTNLTSLYIDSCTKINDDGIKEIANCKNLMKLDLSFCDISDEGLRYIARG--CPLLTFLRLKGCLKITSDGISEIAKSCPKLRLMNCNYVGELLTDKALALLARYCSELRTLCVSNCNITDAGLKALAGNISAFSIDKSDIDSGEGDNMHNNGLKQFGCRELTVVEVSRCR-ITDTGISLLAGACSRLEKLDLEDCASLTDGSLTFLSIHCPKLRILLLSHCDQITDNGVQKLVEMPSGGCRNLEYLALDNCPLLTDESLTCLSKNCAFLKKLDLYDCQLITKQSI 389          
The following BLAST results are available for this feature:
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBXL73.230e-5428.50F-box and leucine rich repeat protein 7 [Source:HG... [more]
FBXL73.433e-5428.50F-box and leucine rich repeat protein 7 [Source:HG... [more]
FBXL74.048e-5428.50F-box and leucine rich repeat protein 7 [Source:HG... [more]
FBXL25.157e-3226.02F-box and leucine rich repeat protein 2 [Source:HG... [more]
FBXL203.625e-2824.44F-box and leucine rich repeat protein 20 [Source:H... [more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxl-17.175e-3124.86Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-17.175e-3124.86Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-17.175e-3124.86Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-17.175e-3124.86Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-11.716e-3024.86Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fbxl72.434e-5028.80gene:FBgn0038385 transcript:FBtr0083201[more]
CG90033.337e-2523.72gene:FBgn0033639 transcript:FBtr0088088[more]
CG90035.558e-2523.72gene:FBgn0033639 transcript:FBtr0113067[more]
CG90035.935e-2524.39gene:FBgn0033639 transcript:FBtr0330632[more]
CG90036.507e-2524.39gene:FBgn0033639 transcript:FBtr0113069[more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxl73.783e-5227.93F-box and leucine-rich repeat protein 7 [Source:NC... [more]
si:dkey-192l18.96.442e-4827.85si:dkey-192l18.9 [Source:ZFIN;Acc:ZDB-GENE-120709-... [more]
fbxl22.025e-3023.51F-box and leucine-rich repeat protein 2 [Source:ZF... [more]
fbxl202.833e-2925.28F-box and leucine-rich repeat protein 20 [Source:Z... [more]
fbxl204.003e-2524.73F-box and leucine-rich repeat protein 20 [Source:Z... [more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
med13l8.102e-5630.08mediator complex subunit 13-like [Source:Xenbase;A... [more]
med13l9.470e-5630.08mediator complex subunit 13-like [Source:Xenbase;A... [more]
adcy32.296e-2922.98adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-10... [more]
adcy37.847e-2823.87adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-10... [more]
adcy32.068e-2724.12adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-10... [more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fbxl77.345e-5529.02F-box and leucine-rich repeat protein 7 [Source:MG... [more]
Fbxl29.783e-3225.00F-box and leucine-rich repeat protein 2 [Source:MG... [more]
Fbxl29.783e-3225.00F-box and leucine-rich repeat protein 2 [Source:MG... [more]
Fbxl207.189e-2924.72F-box and leucine-rich repeat protein 20 [Source:M... [more]
Fbxl142.119e-2123.10F-box and leucine-rich repeat protein 14 [Source:M... [more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5BJ29|FBXL7_MOUSE5.138e-5429.02F-box/LRR-repeat protein 7 OS=Mus musculus OX=1009... [more]
sp|Q9UJT9|FBXL7_HUMAN1.551e-5328.50F-box/LRR-repeat protein 7 OS=Homo sapiens OX=9606... [more]
sp|A1A5X2|FBXL7_DANRE2.856e-5127.93F-box/LRR-repeat protein 7 OS=Danio rerio OX=7955 ... [more]
sp|A6H779|FBXL2_BOVIN3.547e-3225.75F-box/LRR-repeat protein 2 OS=Bos taurus OX=9913 G... [more]
sp|Q9UKC9|FBXL2_HUMAN2.476e-3126.02F-box/LRR-repeat protein 2 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HGJ83.289e-5529.68F-box/LRR-repeat protein 7-like isoform X2 OS=Ling... [more]
A0A1S3HDN64.805e-5529.68F-box/LRR-repeat protein 7-like isoform X1 OS=Ling... [more]
A0A1S3IJC16.120e-5529.68F-box/LRR-repeat protein 7 OS=Lingula unguis OX=75... [more]
K1P4A11.137e-5430.11F-box/LRR-repeat protein 7 OS=Crassostrea gigas OX... [more]
A0A0P5T7K92.385e-5429.43F-box/LRR-repeat protein OS=Daphnia magna OX=35525... [more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-192l18.94.255e-5428.12F-box/LRR-repeat protein 7-like [Source:NCBI gene;... [more]
si:dkey-192l18.94.643e-5428.12F-box/LRR-repeat protein 7-like [Source:NCBI gene;... [more]
fbxl71.116e-5126.86F-box and leucine-rich repeat protein 7 [Source:NC... [more]
fbxl71.213e-5026.93F-box and leucine-rich repeat protein 7 [Source:NC... [more]
fbxl207.599e-2925.00F-box and leucine rich repeat protein 20 [Source:N... [more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBXL76.480e-5625.00F-box and leucine rich repeat protein 7 [Source:HG... [more]
FBXL78.910e-3525.26F-box and leucine rich repeat protein 7 [Source:HG... [more]
FBXL73.832e-3424.17F-box and leucine rich repeat protein 7 [Source:HG... [more]
ENSPMAT00000003881.12.962e-3125.42pep scaffold:Pmarinus_7.0:GL477033:429527:460683:1... [more]
ENSPMAT00000008139.12.237e-2925.13pep scaffold:Pmarinus_7.0:GL476334:657211:690462:-... [more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GRR11.438e-1425.37F-box protein component of an SCF ubiquitin-ligase... [more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458892.499e-4228.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425751.106e-2427.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351012.913e-2325.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474031.039e-2126.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410091.905e-1924.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-192l18.97.146e-5126.33F-box and leucine rich repeat protein 7 [Source:NC... [more]
si:dkey-192l18.97.743e-5126.33F-box and leucine rich repeat protein 7 [Source:NC... [more]
si:dkey-192l18.99.417e-5126.33F-box and leucine rich repeat protein 7 [Source:NC... [more]
fbxl24.853e-3024.18F-box/LRR-repeat protein 2 [Source:NCBI gene;Acc:1... [more]
fbxl208.287e-2925.28F-box/LRR-repeat protein 20 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of F-box/LRR-repeat protein 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053104.10.000e+099.83SMESG000053104.1[more]
SMESG000050765.12.372e-2828.17SMESG000050765.1[more]
SMESG000081003.11.704e-2725.69SMESG000081003.1[more]
SMESG000081003.11.709e-2626.56SMESG000081003.1[more]
SMESG000081003.11.757e-1924.72SMESG000081003.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028816 ID=SMED30028816|Name=F-box/LRR-repeat protein 7|organism=Schmidtea mediterranea sexual|type=transcript|length=2139bp
CAAAGTTCAAAGCCGTAATTTTTATACATCAGCTCTCTCTATACTATACA
ATATATACATTTGAGAGTGTTAATTGTGAATGAAATAATGAATTTCAATG
GCCATTTAGCGATGCGCTGCAGTGCAGCACAAGCAGCCAATCAGAAGTCG
ATTGGAAAACAATAAATTCTACTTTTCAATATTTATTTTTACCACAAAAA
AAACAAACAGATTTTATTGCACATTTACTCTATTAGATTTATTGGATGAA
AAAATGAAAAAATTCAAGAGAAAGTTGAACATTTCTGCATGCATTGGATA
TAAGAACCAAAAAGAAGACTGCAACATCAGTAACTTCTCGGAATTCCAAA
CCGCAGACTCAGGAATTGTTAGTGATCAGTCTAGTCTTCAAGACCATCCT
CATACCAAACCCCTTTCTGATAAATCTACAACGACTAATTTTACAGAATC
ATCATCCTTTGCGATTCTTGCTAAATCTAGACCCAGCCCCTTATACCAAA
ATATAAATAATAATAATATTAATAATACCAACCAAAAACGGATTAACTTC
GCTCAAAATCTCTCAGCAATTAATGAAAATTCTATTACCAGTCCTAATCC
AATCGGTTTACACTCTAACGTAATTGACTATGGGCCCATTCATCCATACA
TGAAGGTCCCAAATTATCACAGAGACCAACATTCAGATGCCTATGCCACA
GTGGCGTCGACATCGGACGATGATACTAAGTCCAATATGAGCGATCTTTT
TATTCCTATTAGAAGGTCAACAAAAAAGTCTAAAGAAACTCAAATCAATT
ATTCTGACAATGACTTCTATCCGACTGAATTAAAATGGGAAAGAACCCCA
TCGAAGATTTTAATAAAAATCTTCAAAAACCTACAAATTAAAGACATTTT
GAATTGTTCACAGACTTGTAGAAACTGGTATTTCATTGCTTGGCAACCGG
TGCTTTGGAGCAATATTGATTTTTCACAATGGGTATTAAAAACCAAACCA
ACCGATATCAATTTCAAAATAAAAAAGTTACTAATTCTCTTAGGTGGAAA
CCGAAATCCTTATTGTCCTCTCGTCCATTCGGTAAAACTTGATAAATGTA
CCGAGCTGACGGACGAATCCGTTATCTTTATCAGCAATTCTTGCCCTAAT
ATAAAAAATTTCAGTATCAGAAAGTGTTTTTTAATATCAAACATTTCAAT
ATTCCATATTTTGTCCAAGTGCGGCGAACTGAAGAGATTGAGTGTCGAAG
GATGCAAACTGATTTCAGCGATTAATACTTTACCGGAATCAGATATTGTT
AAATTCAAAGAATTCGTTCTTTCAGATTTAAATCTTTCATTTTGTCAAAT
GGTTGATGATGCCAGTTTAATTATTTTTGCACCAAAATTTAAAAACATGG
AAAAGTTGCTACTTAGAAATTGTCATAGAATCTCCGATACTGGTATTAGT
TATATCGTTCGGTATTGTCAGAACCTCCGTGAGATCAGTTTGAATCATTT
GGAAAAGATATCGGATGAAAGTATTTGCAATATTTCAGAAAAGCTGAACG
AAAATCTGCGGTACCTGAGTCTGGCAAATTGCACTCGAATCACTGACAAC
AGTTTAATGAGCTTGGCGGATAACTGCTGCAATCTGCAGTACCTAAATCT
CCACAAATGTAAACTGATAACGGATTCTGGGATCATGTCACTAGCAATAT
CAATTCAGACCCGGCTGATTTCTCTCAATGTCAGTTATTGCCCACAAATC
ACCAGCAGATCTGTCAGTGTCCTATCAAGATATTGCCCGAATATCCAACA
ATTGGACATGAACAAGTGCCCACTAATCTCCGACGAAGCGGTTGAGGAAA
TCTGCGAGCATATAATAAAACTGAAAATGATTAATATAGATAACACGTCA
GCGACAATCCGATCATATGACCTCATCACTAAGACCTTTCCCAGTTGTTC
TATACACCACAACTTTGTTACAGATTGTTGAGATTCTGTGATAGTCGAGC
GTCAAATTATCTTTTAAAATAAGTCTTTCAAGCTACAGATGATTTATACT
CTGGCACTTAACTTTGAGTTTTTTGTTTTAATAGATTGTCAATTATTGTT
TGTAATTTGAATGCAAATTCGTTCTCTAATTATATTGGC
back to top

protein sequence of SMED30028816-orf-1

>SMED30028816-orf-1 ID=SMED30028816-orf-1|Name=SMED30028816-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=576bp
MKKFKRKLNISACIGYKNQKEDCNISNFSEFQTADSGIVSDQSSLQDHPH
TKPLSDKSTTTNFTESSSFAILAKSRPSPLYQNINNNNINNTNQKRINFA
QNLSAINENSITSPNPIGLHSNVIDYGPIHPYMKVPNYHRDQHSDAYATV
ASTSDDDTKSNMSDLFIPIRRSTKKSKETQINYSDNDFYPTELKWERTPS
KILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPT
DINFKIKKLLILLGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNI
KNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVK
FKEFVLSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISY
IVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNS
LMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQIT
SRSVSVLSRYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDNTSA
TIRSYDLITKTFPSCSIHHNFVTDC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000141dorsal region of the whole animal
PLANA:0002032epidermal cell
PLANA:0003503ventral epidermis progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR036047F-box-like_dom_sf
IPR001810F-box_dom
IPR006553Leu-rich_rpt_Cys-con_subtyp
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
Vocabulary: biological process
TermDefinition
GO:0000086G2/M transition of mitotic cell cycle
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0008283cell proliferation
GO:0016567protein ubiquitination
GO:0031146SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0051301cell division
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0019005SCF ubiquitin ligase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001810F-box domainSMARTSM00256fbox_2coord: 198..238
e-value: 3.6E-6
score: 36.5
IPR001810F-box domainPFAMPF12937F-box-likecoord: 199..240
e-value: 1.5E-10
score: 40.8
IPR001810F-box domainPROSITEPS50181FBOXcoord: 192..238
score: 11.22
IPR006553Leucine-rich repeat, cysteine-containing subtypeSMARTSM00367LRR_CC_2coord: 323..346
e-value: 200.0
score: 4.4
coord: 485..510
e-value: 24.0
score: 11.6
coord: 405..430
e-value: 0.082
score: 22.0
coord: 458..483
e-value: 1.9E-4
score: 30.8
coord: 432..457
e-value: 6.8E-5
score: 32.3
coord: 511..536
e-value: 0.0047
score: 26.1
coord: 271..296
e-value: 110.0
score: 6.5
coord: 379..404
e-value: 1.0
score: 18.4
coord: 353..378
e-value: 17.0
score: 12.7
coord: 297..322
e-value: 0.0041
score: 26.4
NoneNo IPR availableGENE3DG3DSA:1.20.1280.50coord: 190..239
e-value: 4.5E-12
score: 47.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 39..61
NoneNo IPR availablePANTHERPTHR13382MITOCHONDRIAL ATP SYNTHASE COUPLING FACTOR Bcoord: 356..504
coord: 434..569
coord: 248..426
NoneNo IPR availableSUPERFAMILYSSF52047RNI-likecoord: 264..571
IPR001611Leucine-rich repeatPFAMPF13516LRR_6coord: 432..455
e-value: 0.16
score: 12.1
coord: 457..481
e-value: 0.0087
score: 16.0
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 350..571
e-value: 8.2E-40
score: 138.5
coord: 257..349
e-value: 4.2E-11
score: 43.8
IPR036047F-box-like domain superfamilySUPERFAMILYSSF81383F-box domaincoord: 199..254