BTAF1 RNA polymerase II, B-TFIID transcription factor-associated

Overview
NameBTAF1 RNA polymerase II, B-TFIID transcription factor-associated
Smed IDSMED30028815
Length (bp)6167
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated (SMED30028815) t-SNE clustered cells

Violin plots show distribution of expression levels for BTAF1 RNA polymerase II, B-TFIID transcription factor-associated (SMED30028815) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated (SMED30028815) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BTAF1 RNA polymerase II, B-TFIID transcription factor-associated (SMED30028815) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028815

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30028815h1SMcG0005739 SmedASXL_017363SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30028815h1SMcG0002269 Contig4608uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028815h1SMcG0002269 Contig4608newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028815h1SMcG0005739 Contig4608uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028815h1SMcG0005739 Contig4608newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028815h1SMcG0005740 Contig13664newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028815h1SMcG0005740 Contig13664uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028815h1SMcG0005739 Contig13664newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028815h1SMcG0005739 Contig13664uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30028815h1SMcG0005739 dd_Smed_v4_3088_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028815h1SMcG0005739 Contig55049uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028815h1SMcG0005739 Contig55049newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30028815h1SMcG0005739 dd_Smed_v4_3088_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Human
Match: BTAF1 (B-TFIID TATA-box binding protein associated factor 1 [Source:HGNC Symbol;Acc:HGNC:17307])

HSP 1 Score: 534.258 bits (1375), Expect = 3.414e-157
Identity = 321/732 (43.85%), Postives = 460/732 (62.84%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-------EYSRAP-STCPP--SLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSY----KENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVD-KMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GAIE +  V      G++PY   I ++++PV L  ++   D +R +AT  F+ L+ L+PLE+   D   ++    Q + +   FL+ LL+ K +  Y     + +A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG       EY+R+  + C P  SL+VCPPTLT HW  E  KF  +    N + Y G P  R  + + + R+ +++ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA++ LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY CT+SPLQ++LY    +S+A  D D  E V  +      E   +    H FQ + YLR +CNHP+L LT  HP ++T   +LA  N  L DI  + KL AL+QL+LDCG+G +G+  E   E SVVA +R+L+FCQ   M+++V+  +++  +P  T+LRLDGS+P   R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N+ + SM T+ +L++   + +   +    S +GK  +              KS+L  +S       ++D  ++YD EY+L++F+
Sbjct: 1164 GAIEALACVMEQLDVGIVPY---IVLLVVPV-LGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPNMSAELIQLKAKERHFLEQLLDGKKLENYKIPVPI-NAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCHRAQEYARSKLAECMPLPSLVVCPPTLTGHWVDEVGKF-CSREYLNPLHYTGPPTERIRLQHQVKRHNLIVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAVKQLTANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVD--ETVSSATLSEETEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEFKTTAEKLAVQNSSLHDIQHAPKLSALKQLLLDCGLG-NGSTSESGTE-SVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASM--------------KSILENLSD------LWD-QEQYDSEYSLENFM 1845          

HSP 2 Score: 181.8 bits (460), Expect = 5.449e-45
Identity = 225/821 (27.41%), Postives = 374/821 (45.55%), Query Frame = 2
Query:   86 SRLDKLFELLESNHQNI-RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVP-------GTSESNVTN--VSNLINLENLNLHDILKIGTRLYSRDFKDLD-------EANTNQNINRDE--LARHLGF------------LIPDE---------CEIKNLITVKDCELVES--------KSENK---MSVELAVMKSM------ENSPKKPVKRPHEEVQDV-----NEPGTKMKC-VEKIGNETER-ERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYSDLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEA------HSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFIFHEAGIRNILISI-----IAQI---HLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSLSPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLI 2314
            SRLD+LF LL++    + R AAA Q+G++   +   ++ LL+K+L Y +   W  RIAA  AV  I  N   W P        TSES++ +   +  +N +  ++  +L+ G  L      + +       E +  + I R    L + LG             L  DE           +    T++  EL++S        + +NK   M+   A  +S       E S       P E+ + +     N+     K  ++ I + +   E   EWP   FCEEL  +L++  WE+RHGA T LRE++++ G          S+ ++    H+ + E++V+RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV+  H+    V    + LL LL  ++W V HG LLG+KY LA R D++  LLP +   I   L+ + DDDVR  A A+L+P+      + V +  +++  +   LWD L    D T S  T +++ LL  L     + Y Q +   +     ++L   + R+ W + +++    +++VR  RA L+++   + T  ++ +   +         I   C + +        H VW + +     Q +   +C  +  W+C  MQP+ L          D  +     A A     G      +++  + + YI G ++ + D   A RD +V+RAR+ A +LL  LC      + G+  +   I     + Q+   HL  + A+QR   ++++  W      A++         +Q +LL  L E +YY EI   F +M   C+ LI
Sbjct:    4 SRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELNNLLSKVLIYLRSANWDTRIAAGQAVEAIVKNVPEWNPVPRTRQEPTSESSMEDSPTTERLNFDRFDICRLLQHGASLLGSAGAEFEVQDEKSGEVDPKERIARQRKLLQKKLGLNMGEAIGMSTEELFNDEDLDYTPTSASFVNKQPTLQAAELIDSEFRAGMSNRQKNKAKRMAKLFAKQRSRDAVETNEKSNDSTDGEPEEKRRKIANVVINQSANDSKVLIDNIPDSSSLIEETNEWPLESFCEELCNDLFNPSWEVRHGAGTGLREILKAHGKS--GGKMGDSTLEEMIQQHQEWLEDLVIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVVLKHMNETGVHKTVDVLLKLLTQEQWEVRHGGLLGIKYALAVRQDVINTLLPKVLTRIIEGLQ-DLDDDVRAVAAASLVPVV----ESLVYLQTQKVPFIINTLWDALLELDDLTAS--TNSIMTLLSSL-----LTYPQVQQCSIQ----QSLTVLVPRV-WPFLHHT----ISSVR--RAALETLFTLLSTQDQNSSSWLIPILPDMLRHIFQFCVLESSQEILDLIHKVWMELLSKASVQYVVAAACPWMGAWLCLMMQPSHLPI--------DLNMLLEVKARAKEKTGGKVRQGQSQNKEVLQEYIAGADTIMED--PATRDFVVMRARMMAAKLLGALCCCIC--DPGVNVVTQEIKPAESLGQLLLFHLNSKSALQRISVALVICEW-----AALQKECKAVTLAVQPRLLDILSEHLYYDEIAVPFTRMQNECKQLI 782          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Human
Match: BTAF1 (B-TFIID TATA-box binding protein associated factor 1 [Source:HGNC Symbol;Acc:HGNC:17307])

HSP 1 Score: 533.872 bits (1374), Expect = 4.778e-157
Identity = 321/732 (43.85%), Postives = 460/732 (62.84%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-------EYSRAP-STCPP--SLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSY----KENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVD-KMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GAIE +  V      G++PY   I ++++PV L  ++   D +R +AT  F+ L+ L+PLE+   D   ++    Q + +   FL+ LL+ K +  Y     + +A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG       EY+R+  + C P  SL+VCPPTLT HW  E  KF  +    N + Y G P  R  + + + R+ +++ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA++ LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY CT+SPLQ++LY    +S+A  D D  E V  +      E   +    H FQ + YLR +CNHP+L LT  HP ++T   +LA  N  L DI  + KL AL+QL+LDCG+G +G+  E   E SVVA +R+L+FCQ   M+++V+  +++  +P  T+LRLDGS+P   R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N+ + SM T+ +L++   + +   +    S +GK  +              KS+L  +S       ++D  ++YD EY+L++F+
Sbjct: 1164 GAIEALACVMEQLDVGIVPY---IVLLVVPV-LGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPNMSAELIQLKAKERHFLEQLLDGKKLENYKIPVPI-NAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCHRAQEYARSKLAECMPLPSLVVCPPTLTGHWVDEVGKF-CSREYLNPLHYTGPPTERIRLQHQVKRHNLIVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAVKQLTANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVD--ETVSSATLSEETEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEFKTTAEKLAVQNSSLHDIQHAPKLSALKQLLLDCGLG-NGSTSESGTE-SVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASM--------------KSILENLSD------LWD-QEQYDSEYSLENFM 1845          

HSP 2 Score: 171.785 bits (434), Expect = 7.400e-42
Identity = 217/803 (27.02%), Postives = 362/803 (45.08%), Query Frame = 2
Query:  137 RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVP-------GTSESNVTN--VSNLINLENLNLHDILKIGTRLYSRDFKDLD-------EANTNQNINRDE--LARHLGF------------LIPDE---------CEIKNLITVKDCELVES--------KSENK---MSVELAVMKSM------ENSPKKPVKRPHEEVQDV-----NEPGTKMKC-VEKIGNETER-ERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYSDLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEA------HSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFIFHEAGIRNILISI-----IAQI---HLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSLSPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLI 2314
            R AAA Q+G++   +   ++ LL+K+L Y +   W  RIAA  AV  I  N   W P        TSES++ +   +  +N +  ++  +L+ G  L      + +       E +  + I R    L + LG             L  DE           +    T++  EL++S        + +NK   M+   A  +S       E S       P E+ + +     N+     K  ++ I + +   E   EWP   FCEEL  +L++  WE+RHGA T LRE++++ G          S+ ++    H+ + E++V+RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV+  H+    V    + LL LL  ++W V HG LLG+KY LA R D++  LLP +   I   L+ + DDDVR  A A+L+P+      + V +  +++  +   LWD L    D T S  T +++ LL  L     + Y Q +   +     ++L   + R+ W + +++    +++VR  RA L+++   + T  ++ +   +         I   C + +        H VW + +     Q +   +C  +  W+C  MQP+ L          D  +     A A     G      +++  + + YI G ++ + D   A RD +V+RAR+ A +LL  LC      + G+  +   I     + Q+   HL  + A+QR   ++++  W      A++         +Q +LL  L E +YY EI   F +M   C+ LI
Sbjct:   22 RKAAAQQLGEVVKLHPHELNNLLSKVLIYLRSANWDTRIAAGQAVEAIVKNVPEWNPVPRTRQEPTSESSMEDSPTTERLNFDRFDICRLLQHGASLLGSAGAEFEVQDEKSGEVDPKERIARQRKLLQKKLGLNMGEAIGMSTEELFNDEDLDYTPTSASFVNKQPTLQAAELIDSEFRAGMSNRQKNKAKRMAKLFAKQRSRDAVETNEKSNDSTDGEPEEKRRKIANVVINQSANDSKVLIDNIPDSSSLIEETNEWPLESFCEELCNDLFNPSWEVRHGAGTGLREILKAHGKS--GGKMGDSTLEEMIQQHQEWLEDLVIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVVLKHMNETGVHKTVDVLLKLLTQEQWEVRHGGLLGIKYALAVRQDVINTLLPKVLTRIIEGLQ-DLDDDVRAVAAASLVPVV----ESLVYLQTQKVPFIINTLWDALLELDDLTAS--TNSIMTLLSSL-----LTYPQVQQCSIQ----QSLTVLVPRV-WPFLHHT----ISSVR--RAALETLFTLLSTQDQNSSSWLIPILPDMLRHIFQFCVLESSQEILDLIHKVWMELLSKASVQYVVAAACPWMGAWLCLMMQPSHLPI--------DLNMLLEVKARAKEKTGGKVRQGQSQNKEVLQEYIAGADTIMED--PATRDFVVMRARMMAAKLLGALCCCIC--DPGVNVVTQEIKPAESLGQLLLFHLNSKSALQRISVALVICEW-----AALQKECKAVTLAVQPRLLDILSEHLYYDEIAVPFTRMQNECKQLI 782          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 233.417 bits (594), Expect = 7.436e-61
Identity = 185/573 (32.29%), Postives = 286/573 (49.91%), Query Frame = 2
Query: 3683 KLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-EYSRAPSTCP--------PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMY----RQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQEL--PPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASA 5356
            KL +YQ+ GV WL  L+     G+L D+MGLGKT+Q I  +AG  YS+  +           P++IVCP T+   W +EF  +    P F   +   T  Y     + I +    + ++ITSY  +R   + ++R                     W+YV+LDEGH IRN  + V +A +     HR++L+G+P+QN + ELWSLFDF+ PG LGT   F  ++   +   G ++   V  +       +L   + P++LRR+K DV   L  P K  Q   C ++  Q ++Y + ++S+              Y+    +N     F  +  LR +CNHP L       L      EL  +         SGK++ +  L+                +       R+L+F QS +M+++++  +R +  K T+L++DG+     RQ ++ +++ D SI + LLTT +GGLG+NLT AN V+  + DWNP  D QA +RA RIGQK  V VYRL+TA +IEEKI + Q FK+FL N V+ KD  Q     + ++ E+    +   +QS   SA
Sbjct:  506 KLFKYQQTGVRWLWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSKIRTRGSNYRFEGLGPTVIVCPTTVMHQWVKEFHTWW---PPFRVAILHETGSYTHKKEKLIRDVAHCHGILITSYSYIRLMQDDISRYD-------------------WHYVILDEGHKIRNPNAAVTLACKQFRTPHRIILSGSPMQNNLRELWSLFDFIFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFVDSKEV------------YR---ILNGEMQIFSGLIALRKICNHPDLFSGGPKNLKGLPDDELEEDQ--FGYWKRSGKMIVVESLL----------------KIWHKQGQRVLLFSQSRQMLDILEVFLRAQ--KYTYLKMDGTTTIASRQPLITRYNEDTSIFVFLLTTRVGGLGVNLTGANRVVIYDPDWNPSTDTQARERAWRIGQKKQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVL-KDPKQRRFFKSNDLYELFTLTSPDASQSTETSA 1020          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Human
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:HGNC Symbol;Acc:HGNC:11100])

HSP 1 Score: 228.024 bits (580), Expect = 3.501e-60
Identity = 177/529 (33.46%), Postives = 273/529 (51.61%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIA--GEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASN-RLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFS-CDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFK 5230
            +V+  L+QYQ +G+ WL  L    L+G+LAD+MGLGKT+Q I +I    E+ R      P LI+ P +   +W  EF K+    P    + Y G+P  R+     L   ++ V++T+Y+ +  D ++LA+                     W Y+++DEGH ++N+  K+  V      A  RL+LTGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G KVD   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ  LY H M+++    TD  E   K       +        T+  LR +CNHP +        +   +       Q LD    SGK   L +++                   + A+N ++L+FCQ   +M +++        K  +LRLDG+  A+DR  +++ F+   +   I LL+T  GGLGLNL SA+ VI  + DWNP +DLQA DRAHRIGQ++ V V RL T  S+EEKI+   ++K
Sbjct:  245 MVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRING---PFLIIVPLSTLSNWAYEFDKWA---PSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIR-------------------WKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPF----AMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRH-MQAKGVLLTDGSEKDKKGKGGTKTL------MNTIMQLRKICNHPYM-FQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRIL-----------------PKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFK--YLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYK 717          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Human
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:HGNC Symbol;Acc:HGNC:11100])

HSP 1 Score: 228.024 bits (580), Expect = 4.981e-60
Identity = 177/529 (33.46%), Postives = 273/529 (51.61%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIA--GEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASN-RLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFS-CDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFK 5230
            +V+  L+QYQ +G+ WL  L    L+G+LAD+MGLGKT+Q I +I    E+ R      P LI+ P +   +W  EF K+    P    + Y G+P  R+     L   ++ V++T+Y+ +  D ++LA+                     W Y+++DEGH ++N+  K+  V      A  RL+LTGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G KVD   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ  LY H M+++    TD  E   K       +        T+  LR +CNHP +        +   +       Q LD    SGK   L +++                   + A+N ++L+FCQ   +M +++        K  +LRLDG+  A+DR  +++ F+   +   I LL+T  GGLGLNL SA+ VI  + DWNP +DLQA DRAHRIGQ++ V V RL T  S+EEKI+   ++K
Sbjct:  178 MVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRING---PFLIIVPLSTLSNWAYEFDKWA---PSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIR-------------------WKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPF----AMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRH-MQAKGVLLTDGSEKDKKGKGGTKTL------MNTIMQLRKICNHPYM-FQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRIL-----------------PKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFK--YLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYK 650          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Celegans
Match: btf-1 (BTAF (TBP-associated factor) homolog [Source:UniProtKB/TrEMBL;Acc:G5EF07])

HSP 1 Score: 326.635 bits (836), Expect = 4.959e-90
Identity = 234/683 (34.26%), Postives = 355/683 (51.98%), Query Frame = 2
Query: 3437 AVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQY---NAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPST----CPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSR---YQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLY----THCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTS----SHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETS---VVASNRLLVFCQSIKMMELV-DKMIRNEIPKA-THLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGS 5416
            A ++ PV+   L    + +R  A   F  L+ ++ LE+    +  ++     ++ ++ +F++ L +P  + +    +      ++ LR+YQ EG+ W+ FL  YGLHG+LADDMGLGKTLQ +C IA    R   +    C  SLIVCP TL  HW  E+ +F                  R     +L+R    ++ + +YD L++   +                       VWNY+VLDEGH++RN K +       L  + RL+L+GTP+QN   +LWSLF +LMPG LG+  +F  ++ + + +       + D +AG+ A+  LH+ VLPF++RR+K +VL+ELP K +QDY C ++  Q  +Y      C  SQ   D     LV                  T+  LR + +H  L   +      P Y  L + LAA          SGK+ AL+QL+++C +  +   E E  E     V + +R L+FCQ     +LV D +   E     +HL LDGSVPA DR ++V +F+ D +ID+L+LTT +GG+GLNLT A+ VIF++HDWNPM+DLQA+DRAHR+GQ   V VYRLIT  ++EEK+M+L +FK   A A++  DN  M +M T  ++ +   + +   + P       +K   S     E  L S
Sbjct: 1016 ATLLAPVIFPLLADQCETVRDAAGEAFRRLIPVITLENPDFSIEGMSQELLAKKSEYSNFINVLGSPSSLPRVIRADIRGGFDTSMLREYQLEGITWIRFLRTYGLHGILADDMGLGKTLQTMCSIALSVDRDEMSEFHRC--SLIVCPRTLVDHWCLEWNRFFPQ---------------RVPASKNLTRCHGAEICVIAYDELKTAYMM---------------------DRVWNYIVLDEGHVMRNSKLRAWKFASQLVGKSRLILSGTPVQNSPADLWSLFAWLMPGYLGSEKQFRSQFLKKIMKCRLPKANEADLKAGSAAISQLHKLVLPFVMRRLKTEVLKELPEKNVQDYECELTEDQKEIYRFVVDRCTSSQE--DVGLSSLV------------------TLITLRKLTDHTKLVHDTLAKIGAPQY-ILSKALAAK---------SGKMEALKQLLIECEICKNPDEEVEQPEDLGGLVASGHRALIFCQWKTSAKLVSDALKSGEFGSVVSHLVLDGSVPAGDRMKMVNRFNEDKTIDVLILTTHVGGVGLNLTGADTVIFLDHDWNPMKDLQAIDRAHRLGQTRNVNVYRLITQGTVEEKVMSLAKFKLNTAQALIGADNTSMMTMETGELMNMFTLDGDEAKKKPGGGEPAAKKSKKSTGAPEEVDLAS 1630          

HSP 2 Score: 54.6842 bits (130), Expect = 9.167e-7
Identity = 80/336 (23.81%), Postives = 148/336 (44.05%), Query Frame = 2
Query:   77 NMASRLDKLFELLESNHQNIRNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGTSESNVTNVSNLINLENLNLHDILKIGTRLYSRDFKDLDEANTNQNINRDELARHLGFLIPDECEIKNLITVKDCELVESKSENKMSVELAVMKSMENSPKKPVKRPHEEVQDVNEPGTKM---KCVEKI-------GN---ETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDE-MVAPVRESCAQALGVISVHLTR 1042
            + ++RL +L  LLE+ + N+RN AA   G+LS  ++ ++   L K   +A  ++W  R++A  A++    NA  +    +E + ++VS   N+ ++ + ++L+    L S D   L ++  ++  N+                       K  E+V+   E   +  ++  K + +      +  H+ + + ++P T     + V KI       GN     ER++     ++    EL+  + + +W  RHG A  +                 I+ST      +E   + I+  L+  L LD+ +DF+S     APVRE CAQAL    VH+ R
Sbjct:    4 DTSARLLQLDPLLEAKNPNVRNEAAAAFGKLSILSE-DVKNSLKK---HAASQLWETRVSAGKALQATLQNAPEFERLKNEED-SSVSE--NVRSIVVMNVLRSFKPLLSDDESALKKSEKDRGNNQ-----------------------KQREIVDQHLEYNRATGISSTKFLSDD-----EFLHQGISEPDQPSTSKELDEVVTKIEIFDEENGNCDDGIERQKK----FLKVLRELVNLVAEKQWYARHGGAIAI---------------CQIASTSYDRLSYELI-DTILYLLIHVLILDKFNDFISGRNATAPVREQCAQAL----VHMLR 280          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Celegans
Match: isw-1 (Chromatin-remodeling complex ATPase chain isw-1 [Source:UniProtKB/Swiss-Prot;Acc:P41877])

HSP 1 Score: 233.032 bits (593), Expect = 4.182e-62
Identity = 173/536 (32.28%), Postives = 267/536 (49.81%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL---SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSL--GLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSC-DAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSK 5260
            + + ++R YQ  G+NWL  L    ++G+LAD+MGLGKTLQ I +I G      +   P L++ P +   +W  EFKK+    P  N +V +G    R  +   +    ++ V  T+Y+     M L  +    +                W Y+++DE H I+N KSK++   R L + +RL++TGTP+QN + ELW+L +FL+P +  +  +F+  +      N + SG        T  ++ LH+ + PF+LRR+K DV + L PK        +S +Q   YT  +      D D +    K       + + R     MH LR   NHP L  G     P            +Q L  ++ SGK+V L +L++      S                R+L+F Q  +M++L++           + RLDGS P +DR   +E ++  D+   I +LTT  GGLG+NL +A++VI  + DWNP  DLQAMDRAHRIGQK  V V+RLIT  +++E+I+   E K  L N V+ +
Sbjct:  127 IENGEMRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMI-GYMKHYKNKASPHLVIVPKSTLQNWANEFKKWC---PSINAVVLIGDEAARNQVLRDVILPQKFDVCCTTYE-----MMLKVKTQLKKLN--------------WRYIIIDEAHRIKNEKSKLSETVRELNSENRLLITGTPLQNNLHELWALLNFLLPDIFTSSDDFDSWFS-----NDAMSG-------NTDLVQRLHKVLQPFLLRRIKSDVEKSLLPKKEVKVYVGLSKMQREWYTKVL----MKDIDIINGAGK-------VEKARLMNILMH-LRKCVNHPYLFDGAEPGPPF---------TTDQHL--VDNSGKMVVLDKLLMKFKEQGS----------------RVLIFSQFSRMLDLLEDFCW--WRHYEYCRLDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGLGINLATADVVIIYDSDWNPQSDLQAMDRAHRIGQKKQVRVFRLITENTVDERIIEKAEAKLRLDNIVIQQ 586          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Celegans
Match: pqn-15 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:P91094])

HSP 1 Score: 223.016 bits (567), Expect = 7.788e-58
Identity = 183/555 (32.97%), Postives = 284/555 (51.17%), Query Frame = 2
Query: 3677 SAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL---SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA--VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTL--MRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSC-DAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVV--SKDNNQMASMNTENILE 5305
            S KL+ YQ +G+ W+  L    L+G+LAD+MGLGKT+Q I  I         T  P L++ P +   +W  EF K+  N+   + I Y G P   + +F  +    ++ V++T+++ +  +  LL              G L      W Y+++DEGH ++N   K+   + TR  C R RL++TGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G KV+   E   L +  LH+ + PF+LRR+K +V  ELP K+     C MS LQ  LY H  +           L+D   K N+     R+   TM +LR +CNHP L   +     R     R ++A    +D   +SGKL  L +++                       +R+L+F Q   MM +V+  +        +LRLDGS    +R  +++KF+  ++   + +L+T  GGLGLNL +A+ VI  + DWNP +D+QA DRAHRIGQK  V V+RLITA S+EEKI+    +K  +   V+   K +N+        ILE
Sbjct: 1198 SLKLKPYQIKGLEWMVSLFNNNLNGILADEMGLGKTIQTIAFIT-YLMEIKKTSGPFLVIVPLSTVPNWQNEFDKWAANV---HLIAYKG-PKETRKVFEPIIKSGKFNVLLTTFEYVIREKALL--------------GKLR-----WKYMIIDEGHRLKNQHCKLTEMLNTRFQCQR-RLLITGTPLQNKLPELWALLNFLLPSIFSSCSTFEQWFNAPF----ATTGEKVELTQEETMLIIRRLHKVLRPFLLRRLKKEVESELPDKMEFVVRCDMSALQKVLYKHMQKGL---------LLDG--KTNTGSKSLRN---TMIHLRKLCNHPFL-FENVEESCRNFWDARFISA----VDLYRVSGKLELLSRILPKL----------------QATGHRVLMFFQMTSMMTIVEDFLAGGT--IQYLRLDGSTKPDERGALLDKFNAPNSEYFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKAEVRVFRLITANSVEEKILAAARYKLNVDEKVIQAGKFDNRSTGAERREILE 1686          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Celegans
Match: swsn-4 (SWI/SNF nucleosome remodeling complex component; SWI2/SNF2-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF53])

HSP 1 Score: 221.09 bits (562), Expect = 1.456e-57
Identity = 165/523 (31.55%), Postives = 266/523 (50.86%), Query Frame = 2
Query: 3686 LRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSR--YQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALC-ARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQC--LDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSC-DAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFK 5230
            L+ YQ +G+ W+  L    L+G+LAD+MGLGKT+Q I ++            P L++ P +   +W  EF K+    P   TI+Y GT   R+ +   + +  + V++T+Y+ +  +  LL +                     W Y+++DEGH ++N+  K+ +       A+HRL+LTGTP+QN++ ELW+L +FL+P +  +C  F + +        + +G KV+   E   L +  LH+ + PF+LRR+K +V  +LP K      C  S LQ  +Y H  +           L+D      +     R    T+ +LR +CNHP L      P      R     N+    D + ++GKL  L +++    +  +G              +R+L+F Q   MM + +  +     + T+LRLDGS    +R  ++ +F+  ++ + + +L+T  GGLGLNL +A+ VI  + DWNP +D+QA DRAHRIGQK  V V RLITA S+EEKI+    +K
Sbjct:  533 LKPYQIKGLEWMVSLYNNNLNGILADEMGLGKTIQTISLVTY-LMEVKQNNGPYLVIVPLSTLSNWQNEFAKWA---PSVTTIIYKGTKDARRRVEGQIRKGAFNVLMTTYEYVIKEKALLGKIR-------------------WKYMIIDEGHRLKNHNCKLTLMLNGFFHAQHRLLLTGTPLQNKLPELWALLNFLLPSIFSSCGTFEQWFNAPF----ATTGEKVELNQEETMLIIRRLHKVLRPFLLRRLKKEVESQLPDKTEYVIKCDQSALQKVIYRHMQKGL---------LLDAKMSSGA-----RSLMNTVVHLRKLCNHPFL-----FPNIEDSCRAYWKVNEVNGTDLMRVAGKLELLDRIL--PKLKATG--------------HRILMFFQMTSMMNIFEDFLN--FRRYTYLRLDGSTKPDERGDLLTQFNAPNSDLFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKKEVRVLRLITANSVEEKILAAARYK 991          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Celegans
Match: chd-1 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O17909])

HSP 1 Score: 206.838 bits (525), Expect = 3.672e-53
Identity = 164/537 (30.54%), Postives = 265/537 (49.35%), Query Frame = 2
Query: 3683 KLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFN--------SLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKE-NSAINQHRHGFQTM-HYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSC-DAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSK 5260
            KLR YQ EG+NW+ +    G   +LAD+MGLGKT+Q+I ++A  + R      P L+V P +    W +EF ++    P+ N +VY+G  + R  I             +   ++T+Y+ L  D   L+                   S  W  +++DE H ++N +S +  +       H+L++TGTP+QN + ELW+L  F+MP       EF   +                +E+    +  LH+++ PF+LRRVK DV + LPPK  Q     M+  Q + Y                ++ K+Y+E +  +    +GF  +   L+  CNH SL     H +Y      L    Q L  +  SGKL+ L +L+  C +   G              +R+L+F Q + M++++ + +  ++ +    RLDGS+ A  R+Q ++ ++   ++    LL+T  GGLG+NL +A+ VI  + DWNP  DLQAM RAHRIGQ  TV +YRL+T  S+EE+I+   + K  L + V+ +
Sbjct:  404 KLRDYQLEGLNWMVYAWCKGNSSILADEMGLGKTIQSISLLASLFHRY-DLAGPYLVVVPLSTMAAWQKEFAQWA---PEMNLVVYMGDVVSRDMIRQYEWFVGGTKKMKINAILTTYEILLKDKAFLS-------------------SIDWAALLVDEAHRLKNDESLLYKSLTQFRFNHKLLITGTPLQNSLKELWALLHFIMPEKFDCWEEFETAH----------------NESNHKGISALHKKLEPFLLRRVKKDVEKSLPPKTEQILRVDMTAHQKQFYKW--------------ILTKNYRELSKGVKGSINGFVNLVMELKKCCNHASLTRQYDH-IYDDAQGRL----QQL--LKSSGKLILLDKLL--CRLKDKG--------------HRVLIFSQMVMMLDILQEYL--QLRRFPSQRLDGSMRADLRKQALDHYNAPGSTDFAFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMSRAHRIGQTKTVNIYRLVTKGSVEEEIVERAKRKLVLDHLVIQR 862          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Fly
Match: Hel89B (gene:FBgn0022787 transcript:FBtr0301715)

HSP 1 Score: 513.842 bits (1322), Expect = 4.008e-150
Identity = 322/729 (44.17%), Postives = 446/729 (61.18%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY---SRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL-SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGR-VLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSA------INQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GAIE I  V       ++PY   I ++++P+ L  ++ P + +R ++TH F+ L+ L+PL+     L   +   Q ++ +   FLD L NPK I  Y     + S +LR YQ+ G+NWL FLN+Y LHG+L DDMGLGKTLQ IC++AG++     A     PSL++CPPTLT HW  E +KFL        + Y G P+ R+ + + + ++  +V+ SYDT+R D++  +   F                   NY VLDEGH+I+N K+K + A + L A HRL+L+GTPIQN V ELWSLFDFLMPG LGT  +F +R+ R +L    + S  K + EAG LA+E LHRQVLPF+LRRVK+DVL++LPPKI QD +C +SPLQLRLY      +  ++    + +DK    +SA      ++   H FQ + YL+ VCNHP L L  S  L + +  +LA +N  LDDI  S KL AL+QL+LDCG+GV         +T  V+ +R L+FCQ   M+++V++ ++R  +P  T+LRLDGSVPA  RQ IV  F+ D SID+LLLTT +GGLGLNLT A+ VIFVEHDWNPM+DLQAMDRAHRIGQK  V VYRLIT  S+EEKIM LQ+FK   AN VVS +N  + +M T  I ++ N   +   +S      G   V  + SGG    +   +++  + +  S         +Y++EY+L +FV
Sbjct: 1250 GAIEAIERVVSRLQIKVVPY---IVLLVVPL-LGAMSDPDESVRLLSTHCFANLVQLMPLDGKTEQLK--SDPLQARKTRDREFLDYLFNPKSIPNYKVPVPI-SVELRCYQQAGINWLWFLNKYNLHGILCDDMGLGKTLQTICILAGDHMHRQTANLANLPSLVICPPTLTGHWVYEVEKFLDQGSVLRPLHYYGFPVGREKLRSDIGTKCNLVVASYDTVRKDIDFFSGIHF-------------------NYCVLDEGHIIKNGKTKSSKAIKRLKANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKQFVQRFSRPILSSRDAKSSAK-EQEAGVLAMEALHRQVLPFLLRRVKEDVLKDLPPKITQDLLCELSPLQLRLY------EDFSNKHLKDCLDKLGDSSSASMVTENLSAKTHIFQALRYLQNVCNHPKLVLRQSEELTK-VTSQLALSNSSLDDIEHSAKLPALKQLLLDCGIGV---------QTESVSQHRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTANTVVSAENASLQTMGTSQIFDLFNGGKDKGAES------GSSAVQGTASGG----MSMNTIIENLPELWSEH-------QYEEEYDLGNFV 1918          

HSP 2 Score: 120.553 bits (301), Expect = 1.199e-26
Identity = 71/154 (46.10%), Postives = 98/154 (63.64%), Query Frame = 2
Query:  725 WPWVDFCEELLKNLWDAKWEIRHGAATCLRELI--RSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNH-DEWRVNHXXXXXXXXXXXXRMDLVEVLLP 1177
            WP  +FC  L  +L+ AKWE+RHGAAT LRELI   +QG+      A + + ++    H R+ E+  +RLLC L LD+  DFVSD++VAPVRE+CAQ LG +   +    V+ + N LL L+ H +EW V HG LLGLKY+   R +L+ + LP
Sbjct:  324 WPLENFCSRLFIDLFHAKWEVRHGAATALRELINQHAQGA----GKAVLQTREQMDEAHSRWLEDAALRLLCVLCLDRFGDFVSDQVVAPVRETCAQVLGTLVKEMEASKVQRIVNILLQLIQHKNEWDVRHGGLLGLKYVFVVREELLPIYLP 473          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Fly
Match: Hel89B (gene:FBgn0022787 transcript:FBtr0344471)

HSP 1 Score: 513.842 bits (1322), Expect = 4.008e-150
Identity = 322/729 (44.17%), Postives = 446/729 (61.18%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY---SRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL-SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGR-VLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSA------INQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GAIE I  V       ++PY   I ++++P+ L  ++ P + +R ++TH F+ L+ L+PL+     L   +   Q ++ +   FLD L NPK I  Y     + S +LR YQ+ G+NWL FLN+Y LHG+L DDMGLGKTLQ IC++AG++     A     PSL++CPPTLT HW  E +KFL        + Y G P+ R+ + + + ++  +V+ SYDT+R D++  +   F                   NY VLDEGH+I+N K+K + A + L A HRL+L+GTPIQN V ELWSLFDFLMPG LGT  +F +R+ R +L    + S  K + EAG LA+E LHRQVLPF+LRRVK+DVL++LPPKI QD +C +SPLQLRLY      +  ++    + +DK    +SA      ++   H FQ + YL+ VCNHP L L  S  L + +  +LA +N  LDDI  S KL AL+QL+LDCG+GV         +T  V+ +R L+FCQ   M+++V++ ++R  +P  T+LRLDGSVPA  RQ IV  F+ D SID+LLLTT +GGLGLNLT A+ VIFVEHDWNPM+DLQAMDRAHRIGQK  V VYRLIT  S+EEKIM LQ+FK   AN VVS +N  + +M T  I ++ N   +   +S      G   V  + SGG    +   +++  + +  S         +Y++EY+L +FV
Sbjct: 1250 GAIEAIERVVSRLQIKVVPY---IVLLVVPL-LGAMSDPDESVRLLSTHCFANLVQLMPLDGKTEQLK--SDPLQARKTRDREFLDYLFNPKSIPNYKVPVPI-SVELRCYQQAGINWLWFLNKYNLHGILCDDMGLGKTLQTICILAGDHMHRQTANLANLPSLVICPPTLTGHWVYEVEKFLDQGSVLRPLHYYGFPVGREKLRSDIGTKCNLVVASYDTVRKDIDFFSGIHF-------------------NYCVLDEGHIIKNGKTKSSKAIKRLKANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKQFVQRFSRPILSSRDAKSSAK-EQEAGVLAMEALHRQVLPFLLRRVKEDVLKDLPPKITQDLLCELSPLQLRLY------EDFSNKHLKDCLDKLGDSSSASMVTENLSAKTHIFQALRYLQNVCNHPKLVLRQSEELTK-VTSQLALSNSSLDDIEHSAKLPALKQLLLDCGIGV---------QTESVSQHRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTANTVVSAENASLQTMGTSQIFDLFNGGKDKGAES------GSSAVQGTASGG----MSMNTIIENLPELWSEH-------QYEEEYDLGNFV 1918          

HSP 2 Score: 120.553 bits (301), Expect = 1.199e-26
Identity = 71/154 (46.10%), Postives = 98/154 (63.64%), Query Frame = 2
Query:  725 WPWVDFCEELLKNLWDAKWEIRHGAATCLRELI--RSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNH-DEWRVNHXXXXXXXXXXXXRMDLVEVLLP 1177
            WP  +FC  L  +L+ AKWE+RHGAAT LRELI   +QG+      A + + ++    H R+ E+  +RLLC L LD+  DFVSD++VAPVRE+CAQ LG +   +    V+ + N LL L+ H +EW V HG LLGLKY+   R +L+ + LP
Sbjct:  324 WPLENFCSRLFIDLFHAKWEVRHGAATALRELINQHAQGA----GKAVLQTREQMDEAHSRWLEDAALRLLCVLCLDRFGDFVSDQVVAPVRETCAQVLGTLVKEMEASKVQRIVNILLQLIQHKNEWDVRHGGLLGLKYVFVVREELLPIYLP 473          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0333580)

HSP 1 Score: 233.417 bits (594), Expect = 3.737e-61
Identity = 175/550 (31.82%), Postives = 282/550 (51.27%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSL---------------GLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASN-RLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXX-XXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVV 5254
            +V+  L++YQ +G+ WL  L    L+G+LAD+MGLGKT+Q I ++     R      P LI+ P +   +W  EF+K+    P    + Y G+P  R+ + N +  +++ V++T+Y+ +  D  +LA+                     W Y+++DEGH ++N+  K+  V      A +RL+LTGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G KV+   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ  LY H M+S+    TD  E          A+        T+  LR +CNHP +               G+ S   LYR                 +SGK   L +++                   + A+N R+L+FCQ  + M +++  +     +  +LRLDG+  A+DR +++ KF+   S   + LL+T  GGLGLNL +A+ V+  + DWNP +DLQA DRAHRIGQ++ V V RL+T  S+EE+I+    +K  +   V+
Sbjct:  772 MVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRK-KVMGPYLIIVPLSTLPNWVLEFEKW---APAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQ-------------------WKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPF----ATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKH-MQSKGVLLTDGSEKGKHGKGGAKAL------MNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGVVSGPDLYR-----------------VSGKFELLDRIL-----------------PKLKATNHRVLLFCQMTQCMTIIEDYLGWR--QFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVI 1251          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075526)

HSP 1 Score: 233.417 bits (594), Expect = 3.881e-61
Identity = 175/550 (31.82%), Postives = 282/550 (51.27%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSL---------------GLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASN-RLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXX-XXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVV 5254
            +V+  L++YQ +G+ WL  L    L+G+LAD+MGLGKT+Q I ++     R      P LI+ P +   +W  EF+K+    P    + Y G+P  R+ + N +  +++ V++T+Y+ +  D  +LA+                     W Y+++DEGH ++N+  K+  V      A +RL+LTGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G KV+   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ  LY H M+S+    TD  E          A+        T+  LR +CNHP +               G+ S   LYR                 +SGK   L +++                   + A+N R+L+FCQ  + M +++  +     +  +LRLDG+  A+DR +++ KF+   S   + LL+T  GGLGLNL +A+ V+  + DWNP +DLQA DRAHRIGQ++ V V RL+T  S+EE+I+    +K  +   V+
Sbjct:  768 MVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRK-KVMGPYLIIVPLSTLPNWVLEFEKW---APAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQ-------------------WKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPF----ATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKH-MQSKGVLLTDGSEKGKHGKGGAKAL------MNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGVVSGPDLYR-----------------VSGKFELLDRIL-----------------PKLKATNHRVLLFCQMTQCMTIIEDYLGWR--QFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVI 1247          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075525)

HSP 1 Score: 233.417 bits (594), Expect = 3.881e-61
Identity = 175/550 (31.82%), Postives = 282/550 (51.27%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSL---------------GLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASN-RLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXX-XXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVV 5254
            +V+  L++YQ +G+ WL  L    L+G+LAD+MGLGKT+Q I ++     R      P LI+ P +   +W  EF+K+    P    + Y G+P  R+ + N +  +++ V++T+Y+ +  D  +LA+                     W Y+++DEGH ++N+  K+  V      A +RL+LTGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G KV+   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ  LY H M+S+    TD  E          A+        T+  LR +CNHP +               G+ S   LYR                 +SGK   L +++                   + A+N R+L+FCQ  + M +++  +     +  +LRLDG+  A+DR +++ KF+   S   + LL+T  GGLGLNL +A+ V+  + DWNP +DLQA DRAHRIGQ++ V V RL+T  S+EE+I+    +K  +   V+
Sbjct:  768 MVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRK-KVMGPYLIIVPLSTLPNWVLEFEKW---APAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQ-------------------WKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPF----ATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKH-MQSKGVLLTDGSEKGKHGKGGAKAL------MNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGVVSGPDLYR-----------------VSGKFELLDRIL-----------------PKLKATNHRVLLFCQMTQCMTIIEDYLGWR--QFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVI 1247          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Zebrafish
Match: btaf1 (BTAF1 RNA polymerase II, B-TFIID transcription factor-associated [Source:ZFIN;Acc:ZDB-GENE-021025-1])

HSP 1 Score: 530.406 bits (1365), Expect = 4.917e-156
Identity = 309/665 (46.47%), Postives = 434/665 (65.26%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTP--ARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-------EYSR--APSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFV--ELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMN 5314
            GAIE +  V       ++PY   I ++++PV L  ++ P D +R +AT  F+ L+ LLPLE+   D   ++    RQ+ R++H  FL+ LL+ + +  Y     +  A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG       EY+R  AP +CP PS++VCPPTLT HW  E  KF  +    N + Y G P  R  + + + ++ +++ SYD +R+D+       F                   NY +LDEGH+I+N K+K++ A + L A +RL+L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+KDDVLQ+LPPKI+QDY C +SPLQ++LY    +S+A  + D V      +  +E   +    H FQ + YLR +CNHP+L LT  HP Y+ +  +L+  +  L DI  + KL AL+QL+LDCG+G +GA +   +  +VVA +R+L+FCQ   M+++V++ +++ ++P  T+LRLDGSV A  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N  + SM TE +L +  
Sbjct: 1170 GAIEALACVMEQLDVDIVPY---IVLLVVPV-LGRMSDPCDSVRFMATQCFATLIRLLPLEAGIPDPPSMSEDLIRQKARERH--FLEQLLDGRKLENYKIPVPI-KAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHFLRAQEYTRTKAPDSCPLPSIVVCPPTLTGHWVDEVGKF-CSKEFLNPLHYTGPPTERARLQHQVKKHNLIVASYDVVRNDVEFFRDIKF-------------------NYCILDEGHVIKNGKTKLSKAIKQLTANYRLILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDAKSSSREQEAGVLAMEALHRQVLPFLLRRMKDDVLQDLPPKIIQDYYCNLSPLQVQLYEDFAKSRAKVNVDDVISTASTQEDEEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEYKHITEQLSTQHSSLRDIQHAPKLSALKQLLLDCGLGSAGASDSGTE--AVVAQHRVLIFCQLKSMLDIVEQDLLKPQLPGVTYLRLDGSVQAGLRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMTIANTVISQENASLQSMGTEQLLNLFT 1805          

HSP 2 Score: 181.415 bits (459), Expect = 5.352e-45
Identity = 231/837 (27.60%), Postives = 365/837 (43.61%), Query Frame = 2
Query:   89 RLDKLFELLESNHQNI-RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGTSESNVTNVSNL---------INLENLNLHDILKIGTRLYSRDFKDLD-------EANTNQNI--NRDELARHLGFLIPDEC--EIKNLITVKDCELVESKSENKMS-------------------VELAVMKSMENSPKKPVKR-----PHEEVQDVN-----------EPGTKMK-----CVEKIGNETE------------RERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISST-DKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYS-DLVRLAAVRTCRAVL----QSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFI---FHEAGIRNILISIIAQI---HLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSL--SPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLILIYIEREI 2338
            RL++LF LL++    + R AAA Q+G +   +   ++ LL+K+L Y +   W  RIAA  AV  I  N   W P     +     +L         ++    ++  +LK G  L      + +       E +  + +   R +L + LG  +      + + L   +D E   + S N+                     ++      M N  K   KR       +  +DV+           EP  K +      +E+  N+++             E   EWP   FC+EL  +L++  WEIRHGA T LRE+++  G+        + ST ++    H+ + E++V+RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV   H+    V +  + LL LL  D+W V HG LLG+KY LA R DL+  LLP +   I+  L+ + DDDVR  A AAL+P+        V +   ++  +   LW+ L    D T S  T +++ LL  L     V   Q   Q       ++L   + R+ W +  ++   VR AA+ T   +L    QS  + +  I++      +L  + Q  +++ N ++      VW + +   P+Q +   SC  +  W+C  MQ   +   P  +L         A   A      + E          + YIGG E+   +   A RD +V RARL A +LL  LC        + + +       +AQ+   HL  + A+QR   SM++  W            +C L  S +Q +LL  L E +YY EI   F +M   C+ LI +  +  I
Sbjct:    1 RLERLFILLDTGTTPVTRKAAAQQLGDVVKLHPHELNNLLSKVLTYLRSPNWDTRIAAGQAVEAIVKNIPEWNPSPKPKDEVCAEDLSPEDVSTDRLSFYRFDISRLLKHGASLLGSAGAEFELQDDKSGETDPKERLARQRKQLQKKLGLDMGAAIGMDTEELFNDEDLEDACASSTNRTQPGKSLGCHFSRNHLPAAELIDSEFRPGMSNRQKNKAKRMAKLVAKQRSRDVDSNEKSNDSFEGEPEEKRRKTTNVVIEQPANDSKVLIDNVPDNSSLFEETQEWPLESFCDELCNDLFNPSWEIRHGAGTGLREVLKCHGA---GGGKTVGSTAEQMERQHQEWLEDLVIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVALRHMENSGVAMTVDILLKLLTEDQWEVRHGGLLGIKYALAVRQDLIAELLPRVLPAITEGLR-DLDDDVRAVAAAALIPVV----DGLVQLQPAKVPFIVDTLWNALLELDDLTAS--TNSIMTLLSSLLTYPQV--RQCSTQ-------QSLTVLVPRV-WPFLRHTIASVRRAALDTLFTLLSKADQSCAVWLNPIMQD-----MLRHIFQSCILESNQEILELIQKVWRELLRQAPQQYVVAASCPWMGAWLCLMMQAPHIPIDPNMLLEVKARFKEKAAGKARQGSVPVKET--------VQEYIGGAETVTEE--PATRDYVVTRARLMAAKLLGALCSCICDPRLNSSSLELRPAESLAQLLLFHLNSKSALQRIAVSMVICEWAGLQ-------KECELLSSVVQPRLLVILSEQLYYDEIAIPFTRMQNECKQLIALLADAHI 795          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Zebrafish
Match: btaf1 (BTAF1 RNA polymerase II, B-TFIID transcription factor-associated [Source:ZFIN;Acc:ZDB-GENE-021025-1])

HSP 1 Score: 530.406 bits (1365), Expect = 4.982e-156
Identity = 309/665 (46.47%), Postives = 434/665 (65.26%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTP--ARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-------EYSR--APSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFV--ELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMN 5314
            GAIE +  V       ++PY   I ++++PV L  ++ P D +R +AT  F+ L+ LLPLE+   D   ++    RQ+ R++H  FL+ LL+ + +  Y     +  A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG       EY+R  AP +CP PS++VCPPTLT HW  E  KF  +    N + Y G P  R  + + + ++ +++ SYD +R+D+       F                   NY +LDEGH+I+N K+K++ A + L A +RL+L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+KDDVLQ+LPPKI+QDY C +SPLQ++LY    +S+A  + D V      +  +E   +    H FQ + YLR +CNHP+L LT  HP Y+ +  +L+  +  L DI  + KL AL+QL+LDCG+G +GA +   +  +VVA +R+L+FCQ   M+++V++ +++ ++P  T+LRLDGSV A  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N  + SM TE +L +  
Sbjct: 1171 GAIEALACVMEQLDVDIVPY---IVLLVVPV-LGRMSDPCDSVRFMATQCFATLIRLLPLEAGIPDPPSMSEDLIRQKARERH--FLEQLLDGRKLENYKIPVPI-KAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHFLRAQEYTRTKAPDSCPLPSIVVCPPTLTGHWVDEVGKF-CSKEFLNPLHYTGPPTERARLQHQVKKHNLIVASYDVVRNDVEFFRDIKF-------------------NYCILDEGHVIKNGKTKLSKAIKQLTANYRLILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDAKSSSREQEAGVLAMEALHRQVLPFLLRRMKDDVLQDLPPKIIQDYYCNLSPLQVQLYEDFAKSRAKVNVDDVISTASTQEDEEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEYKHITEQLSTQHSSLRDIQHAPKLSALKQLLLDCGLGSAGASDSGTE--AVVAQHRVLIFCQLKSMLDIVEQDLLKPQLPGVTYLRLDGSVQAGLRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMTIANTVISQENASLQSMGTEQLLNLFT 1806          

HSP 2 Score: 181.415 bits (459), Expect = 5.133e-45
Identity = 231/837 (27.60%), Postives = 365/837 (43.61%), Query Frame = 2
Query:   89 RLDKLFELLESNHQNI-RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGTSESNVTNVSNL---------INLENLNLHDILKIGTRLYSRDFKDLD-------EANTNQNI--NRDELARHLGFLIPDEC--EIKNLITVKDCELVESKSENKMS-------------------VELAVMKSMENSPKKPVKR-----PHEEVQDVN-----------EPGTKMK-----CVEKIGNETE------------RERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISST-DKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYS-DLVRLAAVRTCRAVL----QSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFI---FHEAGIRNILISIIAQI---HLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSL--SPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLILIYIEREI 2338
            RL++LF LL++    + R AAA Q+G +   +   ++ LL+K+L Y +   W  RIAA  AV  I  N   W P     +     +L         ++    ++  +LK G  L      + +       E +  + +   R +L + LG  +      + + L   +D E   + S N+                     ++      M N  K   KR       +  +DV+           EP  K +      +E+  N+++             E   EWP   FC+EL  +L++  WEIRHGA T LRE+++  G+        + ST ++    H+ + E++V+RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV   H+    V +  + LL LL  D+W V HG LLG+KY LA R DL+  LLP +   I+  L+ + DDDVR  A AAL+P+        V +   ++  +   LW+ L    D T S  T +++ LL  L     V   Q   Q       ++L   + R+ W +  ++   VR AA+ T   +L    QS  + +  I++      +L  + Q  +++ N ++      VW + +   P+Q +   SC  +  W+C  MQ   +   P  +L         A   A      + E          + YIGG E+   +   A RD +V RARL A +LL  LC        + + +       +AQ+   HL  + A+QR   SM++  W            +C L  S +Q +LL  L E +YY EI   F +M   C+ LI +  +  I
Sbjct:    2 RLERLFILLDTGTTPVTRKAAAQQLGDVVKLHPHELNNLLSKVLTYLRSPNWDTRIAAGQAVEAIVKNIPEWNPSPKPKDEVCAEDLSPEDVSTDRLSFYRFDISRLLKHGASLLGSAGAEFELQDDKSGETDPKERLARQRKQLQKKLGLDMGAAIGMDTEELFNDEDLEDACASSTNRTQPGKSLGCHFSRNHLPAAELIDSEFRPGMSNRQKNKAKRMAKLVAKQRSRDVDSNEKSNDSFEGEPEEKRRKTTNVVIEQPANDSKVLIDNVPDNSSLFEETQEWPLESFCDELCNDLFNPSWEIRHGAGTGLREVLKCHGA---GGGKTVGSTAEQMERQHQEWLEDLVIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVALRHMENSGVAMTVDILLKLLTEDQWEVRHGGLLGIKYALAVRQDLIAELLPRVLPAITEGLR-DLDDDVRAVAAAALIPVV----DGLVQLQPAKVPFIVDTLWNALLELDDLTAS--TNSIMTLLSSLLTYPQV--RQCSTQ-------QSLTVLVPRV-WPFLRHTIASVRRAALDTLFTLLSKADQSCAVWLNPIMQD-----MLRHIFQSCILESNQEILELIQKVWRELLRQAPQQYVVAASCPWMGAWLCLMMQAPHIPIDPNMLLEVKARFKEKAAGKARQGSVPVKET--------VQEYIGGAETVTEE--PATRDYVVTRARLMAAKLLGALCSCICDPRLNSSSLELRPAESLAQLLLFHLNSKSALQRIAVSMVICEWAGLQ-------KECELLSSVVQPRLLVILSEQLYYDEIAIPFTRMQNECKQLIALLADAHI 796          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Zebrafish
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 234.187 bits (596), Expect = 2.156e-61
Identity = 188/618 (30.42%), Postives = 292/618 (47.25%), Query Frame = 2
Query: 3683 KLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-EYSRAPSTCP--------PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMY----RQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQ--ELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKA----------DSGER 5461
            KL +YQ+ GV W+  L+     G+L D+MGLGKT+Q I  +AG  YS+  +           P++IVCP T+   W +EF  +    P F   V   T  +     + I   ++ + ++ITSY  +R   + + R                     W+YV+LDEGH IRN  + V  A +     HR +L+G+P+QN + ELWSLFDF+ PG LGT   F  ++   +   G  +   V  +       +L   + P++LRR+K DV     LP K  Q   C ++  Q ++Y   ++S+                    +N     F  +  LR +CNHP L  T    L R +  +     +       SGK++ +  L+                       +R+L+F QS +M+E+++  ++      ++L++DG+     RQ ++ +F+ +  I + +LTT +GGLG+NLT AN V+  + DWNP  D QA +RA RIGQK  V VYRL+TA +IEEKI + Q FK+FL N V+ KD  Q     + +I E+        T S P  + G +        G++ Q+  +   S  S+           DSG R
Sbjct:  482 KLFKYQQTGVRWMWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSKLKTRGSNYRYAGLGPTVIVCPATVMHQWVKEFHTWW---PPFRVAVLHDTGSFTSKKEKLIPEIVASHGILITSYSYIRIMQDYIQRYD-------------------WHYVILDEGHKIRNPNAGVTTACKQFRTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYANASPVQVQTAYKCACVLRDTINPYLLRRMKADVKANLSLPDKNEQVLFCRLTEDQRQVYQTFLDSKEVYQI---------------LNGDMQVFSGLIALRKICNHPDL-FTGGPRLLRGIPHDQLTEEEHFGYWKRSGKMIVVESLL----------------RLWHKQGHRVLLFTQSRQMLEILEVFVKEN--GFSYLKMDGTTTIASRQPLIAQFNQNKDIFVFILTTRVGGLGVNLTGANRVVIYDPDWNPSTDTQARERAWRIGQKQQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVL-KDPKQRRFFKSNDIYELF-------TLSSPDGSQGTETSAIFAGTGSDVQVPKRHKTSSPSQGTTRPSLSHSTDSGNR 1035          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Zebrafish
Match: SMARCA4 (transcription activator BRG1-like [Source:NCBI gene;Acc:100535713])

HSP 1 Score: 231.106 bits (588), Expect = 2.576e-60
Identity = 180/534 (33.71%), Postives = 276/534 (51.69%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIA--GEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANN---QCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASN-RLLVFCQSIKMMELVDKMI--RNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXX-XXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFK 5230
            +++ +L+QYQ +G+ WL  L    L+G+LAD+MGLGKT+Q I +I    EY R      P LI+ P +   +W  EF K+    P    + Y G+P  R+     L   ++ V++T+Y+ +  D  +LA+                     W Y+++DEGH ++N+  K+  V      A  R++LTGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G KVD   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ  LY H M+++    TD  E   K       +        T+  LR +CNHP +       +  T    L  +    Q LD    SGK   L +++                   + A+N ++L+FCQ   +M +++     RN      +LRLDG+  A+DR  +++ F+  AS   + LL+T  GGLGLNL SA+ VI  + DWNP +DLQA DRAHRIGQ + V V RL T  S+EEKI+   ++K
Sbjct:  702 LINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEYKRLNG---PYLIIVPLSTLSNWVYEFDKWA---PSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKQILAKIR-------------------WKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPF----AMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRH-MQAKGVLLTDGSEKDKKGKGGTKTL------MNTIMQLRKICNHPYM----FQQIEETFSEHLGFSGGIVQGLDLYRASGKFEVLDRIL-----------------PKLRATNHKVLLFCQMTSLMTIMEDYFAYRN----FKYLRLDGTTKAEDRGMLLKTFNDPASQYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQLNEVRVLRLCTVNSVEEKILAAAKYK 1174          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Zebrafish
Match: smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5964])

HSP 1 Score: 227.639 bits (579), Expect = 2.803e-59
Identity = 176/542 (32.47%), Postives = 281/542 (51.85%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIA--GEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINL---SGKLVALRQLILDCGVGVSGAGEEELDETSVVASN-RLLVFCQSIKMMELVDKMI--RNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXX-XXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVV 5254
            +++  L+QYQ +G+ W+  L    L+G+LAD+MGLGKT+Q I +I    E+ R      P LI+ P +   +W  E  K+    P    I Y GTP  R+ +   L   ++ V+IT+Y+ +  D ++LA+                     W Y+++DEGH ++N+  K+  V      A  RL+LTGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G +VD   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS +Q  LY H M+ +    TD  E   K       +        T+  L+ +CNHP +       +  +    L   N  +   +L   SGK   L +++                   + A+N R+L+FCQ   +M +++     RN +    +LRLDG+  ++DR  +++KF+ + S   I LL+T  GGLGLNL +A+ V+  + DWNP +DLQA DRAHRIGQ++ V V RL T  S+EEKI+   ++K  +   V+
Sbjct:  721 LINGTLKQYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEHKRLNG---PYLIIVPLSTLSNWVYELDKW---APSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKHILAKIR-------------------WKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPF----AMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRH-MQGKGILLTDGSEKDKKGKGGAKTL------MNTIMQLKKICNHPYM----FQHIEESFAEHLGFPNGIISGPDLYRASGKFELLDRIL-----------------PKLKATNHRVLLFCQMTSLMTILEDYFGYRNFL----YLRLDGTTKSEDRAMLLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVI 1201          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Xenopus
Match: BTAF1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:100038214])

HSP 1 Score: 521.546 bits (1342), Expect = 5.393e-153
Identity = 309/728 (42.45%), Postives = 454/728 (62.36%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAP--------STCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENS--AINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GA+E +  +      G++PY   I ++++PV L  ++   D +R +AT  F+ L+ L+PLE+   D   ++    + + +  +FL+ LL+ K +  Y     +  A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG++ +          +     L VCPPTLT HW  E  KF  +    N + Y G P  R  + + + ++ +V+ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C++SPLQ++LY    +S+A TD D         +EN    +    H FQ + YLR +CNHP+L LT+ HP Y+ +  +L   N  L DI  + KL AL+QL+LDCG+G  G  E   +  +VVA +R+L+FCQ   M+++V++ +++  +P  T+LRLDG++PA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N  + SM T+ +L++   + +  ++   A+   K+   SS+          KS+L  + +  + E       +YD E++LD+F+
Sbjct: 1139 GAMEALACIMEQLDVGIVPY---IVLLVVPV-LGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPSMSEELIKLKARERNFLEQLLDGKKLENYTIPVPI-KAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCQRIFQKINLRIACLGLRLFVCPPTLTGHWVDEVGKF-CSKEYLNPLHYTGPPTERARLQHQVKKHNMVVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAVKQLSANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCSLSPLQVQLYEDFAKSRAKTDIDETVSTTSLIEENEKPKVKATGHVFQALQYLRKLCNHPALVLTTQHPEYKKISEQLGVQNSSLRDIQHAPKLSALKQLLLDCGLGNGGTAESGTE--AVVAQHRILIFCQLKSMLDIVEQDLLKPHLPSVTYLRLDGTIPAGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTVISQENASLQSMGTDQLLDLFTLDKDGKSEKADAA---KESGKSSM----------KSILDGLGELWNQE-------QYDSEFSLDNFM 1819          

HSP 2 Score: 168.318 bits (425), Expect = 6.658e-41
Identity = 183/644 (28.42%), Postives = 292/644 (45.34%), Query Frame = 2
Query:   89 RLDKLFELLESNHQNI-RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGTS-------ESNVTNVSNL--INLENLNLHDILKIGTRLYSRDFKDLD-------EANTNQNINRDE--LARHLGFLIPDECEI--KNLITVKDCELVESKSE-NKMSVEL---AVMKSMENSPKKPVKR---------------------------PHEEVQDV-----NEPGTKMKCV--EKIGNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAAC--------HERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLY-----EKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYS-DLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARL 1801
            RLD+LF LL++    + R AAA Q+G++   +   ++ LL+K+L Y +   W  RIAA  AV  I  N   W P T        E +    S+L  ++ +  ++  +LK G  L      + +       E +  + I R    L R LG  +     +  + L   +D + + + +  NK + E      +  M N  K   KR                           P E+ + V     N+P T+ K +      N +  +   EWP   F EEL  +L++  WE+RHGA T LRE++++ G           S  K A C        H+ + E++ +RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV+  H+    V      LL LLN ++W V HG LLG+KY LA R DL+  LLP     I   L+ + DDDVR  A A+L+P+      + V +  +++  + + LWD L    D T S  T +++ LL  L      ++CNV               ++L   + R+ W +  ++   VR AA+ T   +L +        L    +  ++  + Q  +++ N ++    H VW + ++    Q +   +C  +  W+C  MQP+ +
Sbjct:    2 RLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELNNLLSKVLVYLRSPNWDTRIAAGQAVEAIVKNIPEWNPATRLKKEPGLEGSNEESSHLERLSFDRFDISRLLKHGASLLGSAGAEFEVQDDKTGEVDPKERIARQRKLLQRKLGLDMGAAIGMSTEELFNDEDLDYMPTTALLNKPAAEFIDSEFLPGMSNRQKNKAKRMAKLIAKQRSRDTIETNEKSSDSTDGEPEEKRRKVTNVVINQPATESKVLIDNVPDNSSPYDEINEWPLESFSEELCNDLFNPSWEVRHGAGTGLREILKAHGR----------SGGKIADCTLEEMKQQHQDWLEDLAIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVVLKHMNENGVHNTVKILLKLLNQEQWEVRHGGLLGIKYALAIRQDLINSLLPKALPAIVEGLQ-DLDDDVRAVAAASLVPV----VDSLVKLQFKQVPFIMSTLWDALLELDDLTAS--TNSIMTLLSSLLMYPQVQQCNV--------------QQSLTILVPRV-WPFLRHTISSVRKAALETLCTLLSTQDQNCSGWLT-PILQDMMRHIFQICILESNQEIIDLIHKVWQELLNKASVQYVVAAACPWMGAWLCLMMQPSHI 612          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Xenopus
Match: BTAF1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:100038214])

HSP 1 Score: 500.745 bits (1288), Expect = 1.390e-146
Identity = 300/722 (41.55%), Postives = 446/722 (61.77%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY--SRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENS--AINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GA+E +  +      G++PY   I ++++PV L  ++   D +R +AT  F+ L+ L+PLE+   D   ++    + + +  +FL+ LL+ K +  Y     +  A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG++     P         C P  ++   +E+          N + Y G P  R  + + + ++ +V+ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C++SPLQ++LY    +S+A TD D         +EN    +    H FQ + YLR +CNHP+L LT+ HP Y+ +  +L   N  L DI  + KL AL+QL+LDCG+G  G  E   +  +VVA +R+L+FCQ   M+++V++ +++  +P  T+LRLDG++PA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N  + SM T+ +L++   + +  ++   A+   K+   SS+          KS+L  + +  + E       +YD E++LD+F+
Sbjct: 1031 GAMEALACIMEQLDVGIVPY---IVLLVVPV-LGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPSMSEELIKLKARERNFLEQLLDGKKLENYTIPVPI-KAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCLKNIPKNKSAD---CMPRPSLFCSKEY---------LNPLHYTGPPTERARLQHQVKKHNMVVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAVKQLSANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCSLSPLQVQLYEDFAKSRAKTDIDETVSTTSLIEENEKPKVKATGHVFQALQYLRKLCNHPALVLTTQHPEYKKISEQLGVQNSSLRDIQHAPKLSALKQLLLDCGLGNGGTAESGTE--AVVAQHRILIFCQLKSMLDIVEQDLLKPHLPSVTYLRLDGTIPAGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTVISQENASLQSMGTDQLLDLFTLDKDGKSEKADAA---KESGKSSM----------KSILDGLGELWNQE-------QYDSEFSLDNFM 1694          

HSP 2 Score: 143.28 bits (360), Expect = 2.976e-33
Identity = 126/400 (31.50%), Postives = 199/400 (49.75%), Query Frame = 2
Query:  650 VNEPGTKMKCV--EKIGNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAAC--------HERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLY-----EKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYS-DLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARL 1801
            +N+P T+ K +      N +  +   EWP   F EEL  +L++  WE+RHGA T LRE++++ G           S  K A C        H+ + E++ +RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV+  H+    V      LL LLN ++W V HG LLG+KY LA R DL+  LLP     I   L+ + DDDVR  A A+L+P+      + V +  +++  + + LWD L    D T S  T +++ LL  L      ++CNV               ++L   + R+ W +  ++   VR AA+ T   +L +        L    +  ++  + Q  +++ N ++    H VW + ++    Q +   +C  +  W+C  MQP+ +
Sbjct:  122 INQPATESKVLIDNVPDNSSPYDEINEWPLESFSEELCNDLFNPSWEVRHGAGTGLREILKAHGR----------SGGKIADCTLEEMKQQHQDWLEDLAIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVVLKHMNENGVHNTVKILLKLLNQEQWEVRHGGLLGIKYALAIRQDLINSLLPKALPAIVEGLQ-DLDDDVRAVAAASLVPVV----DSLVKLQFKQVPFIMSTLWDALLELDDLTAS--TNSIMTLLSSLLMYPQVQQCNV--------------QQSLTILVPRV-WPFLRHTISSVRKAALETLCTLLSTQDQNCSGWLT-PILQDMMRHIFQICILESNQEIIDLIHKVWQELLNKASVQYVVAAACPWMGAWLCLMMQPSHI 488          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Xenopus
Match: BTAF1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:100038214])

HSP 1 Score: 501.516 bits (1290), Expect = 2.805e-146
Identity = 300/722 (41.55%), Postives = 446/722 (61.77%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY--SRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENS--AINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GA+E +  +      G++PY   I ++++PV L  ++   D +R +AT  F+ L+ L+PLE+   D   ++    + + +  +FL+ LL+ K +  Y     +  A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG++     P         C P  ++   +E+          N + Y G P  R  + + + ++ +V+ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C++SPLQ++LY    +S+A TD D         +EN    +    H FQ + YLR +CNHP+L LT+ HP Y+ +  +L   N  L DI  + KL AL+QL+LDCG+G  G  E   +  +VVA +R+L+FCQ   M+++V++ +++  +P  T+LRLDG++PA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N  + SM T+ +L++   + +  ++   A+   K+   SS+          KS+L  + +  + E       +YD E++LD+F+
Sbjct: 1128 GAMEALACIMEQLDVGIVPY---IVLLVVPV-LGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPSMSEELIKLKARERNFLEQLLDGKKLENYTIPVPI-KAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCLKNIPKNKSAD---CMPRPSLFCSKEY---------LNPLHYTGPPTERARLQHQVKKHNMVVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAVKQLSANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCSLSPLQVQLYEDFAKSRAKTDIDETVSTTSLIEENEKPKVKATGHVFQALQYLRKLCNHPALVLTTQHPEYKKISEQLGVQNSSLRDIQHAPKLSALKQLLLDCGLGNGGTAESGTE--AVVAQHRILIFCQLKSMLDIVEQDLLKPHLPSVTYLRLDGTIPAGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTVISQENASLQSMGTDQLLDLFTLDKDGKSEKADAA---KESGKSSM----------KSILDGLGELWNQE-------QYDSEFSLDNFM 1791          

HSP 2 Score: 167.933 bits (424), Expect = 8.481e-41
Identity = 187/648 (28.86%), Postives = 294/648 (45.37%), Query Frame = 2
Query:   86 SRLDKLFELLESNHQNI-RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGTS-------ESNVTNVSNL--INLENLNLHDILKIGTRLYSRDFKDLD-------EANTNQNINRDE--LARHLGF------------LIPDE-------CEIKNLITVKDCELVES--------KSENK---MSVELAVMKSM------ENSPKKPVKRPHEEVQDV-----NEPGTKMKCV--EKIGNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAAC--------HERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLY-----EKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYS-DLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARL 1801
            SRLD+LF LL++    + R AAA Q+G++   +   ++ LL+K+L Y +   W  RIAA  AV  I  N   W P T        E +    S+L  ++ +  ++  +LK G  L      + +       E +  + I R    L R LG             L  DE         + N       E ++S        + +NK   M+  +A  +S       E S       P E+ + V     N+P T+ K +      N +  +   EWP   F EEL  +L++  WE+RHGA T LRE++++ G           S  K A C        H+ + E++ +RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV+  H+    V      LL LLN ++W V HG LLG+KY LA R DL+  LLP     I   L+ + DDDVR  A A+L+P+      + V +  +++  + + LWD L    D T S  T +++ LL  L      ++CNV               ++L   + R+ W +  ++   VR AA+ T   +L +        L    +  ++  + Q  +++ N ++    H VW + ++    Q +   +C  +  W+C  MQP+ +
Sbjct:    4 SRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELNNLLSKVLVYLRSPNWDTRIAAGQAVEAIVKNIPEWNPATRLKKEPGLEGSNEESSHLERLSFDRFDISRLLKHGASLLGSAGAEFEVQDDKTGEVDPKERIARQRKLLQRKLGLDMGAAIGMSTEELFNDEDLDYMPTTALLNKPVSMPSEFIDSEFLPGMSNRQKNKAKRMAKLIAKQRSRDTIETNEKSSDSTDGEPEEKRRKVTNVVINQPATESKVLIDNVPDNSSPYDEINEWPLESFSEELCNDLFNPSWEVRHGAGTGLREILKAHGR----------SGGKIADCTLEEMKQQHQDWLEDLAIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVVLKHMNENGVHNTVKILLKLLNQEQWEVRHGGLLGIKYALAIRQDLINSLLPKALPAIVEGLQ-DLDDDVRAVAAASLVPVV----DSLVKLQFKQVPFIMSTLWDALLELDDLTAS--TNSIMTLLSSLLMYPQVQQCNV--------------QQSLTILVPRV-WPFLRHTISSVRKAALETLCTLLSTQDQNCSGWLT-PILQDMMRHIFQICILESNQEIIDLIHKVWQELLNKASVQYVVAAACPWMGAWLCLMMQPSHI 618          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Xenopus
Match: BTAF1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:100038214])

HSP 1 Score: 501.13 bits (1289), Expect = 3.252e-146
Identity = 300/722 (41.55%), Postives = 446/722 (61.77%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY--SRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENS--AINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GA+E +  +      G++PY   I ++++PV L  ++   D +R +AT  F+ L+ L+PLE+   D   ++    + + +  +FL+ LL+ K +  Y     +  A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG++     P         C P  ++   +E+          N + Y G P  R  + + + ++ +V+ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C++SPLQ++LY    +S+A TD D         +EN    +    H FQ + YLR +CNHP+L LT+ HP Y+ +  +L   N  L DI  + KL AL+QL+LDCG+G  G  E   +  +VVA +R+L+FCQ   M+++V++ +++  +P  T+LRLDG++PA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N  + SM T+ +L++   + +  ++   A+   K+   SS+          KS+L  + +  + E       +YD E++LD+F+
Sbjct: 1109 GAMEALACIMEQLDVGIVPY---IVLLVVPV-LGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPSMSEELIKLKARERNFLEQLLDGKKLENYTIPVPI-KAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCLKNIPKNKSAD---CMPRPSLFCSKEY---------LNPLHYTGPPTERARLQHQVKKHNMVVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAVKQLSANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCSLSPLQVQLYEDFAKSRAKTDIDETVSTTSLIEENEKPKVKATGHVFQALQYLRKLCNHPALVLTTQHPEYKKISEQLGVQNSSLRDIQHAPKLSALKQLLLDCGLGNGGTAESGTE--AVVAQHRILIFCQLKSMLDIVEQDLLKPHLPSVTYLRLDGTIPAGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTVISQENASLQSMGTDQLLDLFTLDKDGKSEKADAA---KESGKSSM----------KSILDGLGELWNQE-------QYDSEFSLDNFM 1772          

HSP 2 Score: 171.4 bits (433), Expect = 7.968e-42
Identity = 172/599 (28.71%), Postives = 283/599 (47.25%), Query Frame = 2
Query:   86 SRLDKLFELLESNHQNI-RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGT--------SESNVTNVSNLINLE-NLNLHDILKIGTRLYSRDFKDLDEANTNQNINRDELARHLGFLIPDECEIKNLITVKDCELV-ESKSENKMSVELAVMKSMENSPKKPVKRPHEEVQDVNEPGTKMKCV--EKIGNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAAC--------HERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLY-----EKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYS-DLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARL 1801
            SRLD+LF LL++    + R AAA Q+G++   +   ++ LL+K+L Y +   W  RIAA  AV  I  N   W P T         +  +     L+  +  L++   + + T     D +DLD   T   +N+          +P     +     +  +L+ + +S + +        S +  P++  ++    V  +N+P T+ K +      N +  +   EWP   F EEL  +L++  WE+RHGA T LRE++++ G           S  K A C        H+ + E++ +RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV+  H+    V      LL LLN ++W V HG LLG+KY LA R DL+  LLP     I   L+ + DDDVR  A A+L+P+      + V +  +++  + + LWD L    D T S  T +++ LL  L      ++CNV               ++L   + R+ W +  ++   VR AA+ T   +L +        L    +  ++  + Q  +++ N ++    H VW + ++    Q +   +C  +  W+C  MQP+ +
Sbjct:    4 SRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELNNLLSKVLVYLRSPNWDTRIAAGQAVEAIVKNIPEWNPATRLKKGEVDPKERIARQRKLLQRKLGLDMGAAIGMSTEELFND-EDLDYMPTTALLNKPAAEFIDSEFLPGMSNRQKNKAKRMAKLIAKQRSRDTIETNEKSSDSTDGEPEEKRRKVTNVV--INQPATESKVLIDNVPDNSSPYDEINEWPLESFSEELCNDLFNPSWEVRHGAGTGLREILKAHGR----------SGGKIADCTLEEMKQQHQDWLEDLAIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVVLKHMNENGVHNTVKILLKLLNQEQWEVRHGGLLGIKYALAIRQDLINSLLPKALPAIVEGLQ-DLDDDVRAVAAASLVPVV----DSLVKLQFKQVPFIMSTLWDALLELDDLTAS--TNSIMTLLSSLLMYPQVQQCNV--------------QQSLTILVPRV-WPFLRHTISSVRKAALETLCTLLSTQDQNCSGWLT-PILQDMMRHIFQICILESNQEIIDLIHKVWQELLNKASVQYVVAAACPWMGAWLCLMMQPSHI 566          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Xenopus
Match: BTAF1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:100038214])

HSP 1 Score: 501.901 bits (1291), Expect = 3.524e-146
Identity = 300/722 (41.55%), Postives = 446/722 (61.77%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY--SRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENS--AINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GA+E +  +      G++PY   I ++++PV L  ++   D +R +AT  F+ L+ L+PLE+   D   ++    + + +  +FL+ LL+ K +  Y     +  A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG++     P         C P  ++   +E+          N + Y G P  R  + + + ++ +V+ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C++SPLQ++LY    +S+A TD D         +EN    +    H FQ + YLR +CNHP+L LT+ HP Y+ +  +L   N  L DI  + KL AL+QL+LDCG+G  G  E   +  +VVA +R+L+FCQ   M+++V++ +++  +P  T+LRLDG++PA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N  + SM T+ +L++   + +  ++   A+   K+   SS+          KS+L  + +  + E       +YD E++LD+F+
Sbjct: 1155 GAMEALACIMEQLDVGIVPY---IVLLVVPV-LGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPSMSEELIKLKARERNFLEQLLDGKKLENYTIPVPI-KAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCLKNIPKNKSAD---CMPRPSLFCSKEY---------LNPLHYTGPPTERARLQHQVKKHNMVVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAVKQLSANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCSLSPLQVQLYEDFAKSRAKTDIDETVSTTSLIEENEKPKVKATGHVFQALQYLRKLCNHPALVLTTQHPEYKKISEQLGVQNSSLRDIQHAPKLSALKQLLLDCGLGNGGTAESGTE--AVVAQHRILIFCQLKSMLDIVEQDLLKPHLPSVTYLRLDGTIPAGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTVISQENASLQSMGTDQLLDLFTLDKDGKSEKADAA---KESGKSSM----------KSILDGLGELWNQE-------QYDSEFSLDNFM 1818          

HSP 2 Score: 170.244 bits (430), Expect = 1.973e-41
Identity = 184/645 (28.53%), Postives = 293/645 (45.43%), Query Frame = 2
Query:   86 SRLDKLFELLESNHQNI-RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGTS-------ESNVTNVSNL--INLENLNLHDILKIGTRLYSRDFKDLD-------EANTNQNINRDE--LARHLGFLIPDECEI--KNLITVKDCELVESKSE-NKMSVEL---AVMKSMENSPKKPVKR---------------------------PHEEVQDV-----NEPGTKMKCV--EKIGNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAAC--------HERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLY-----EKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYS-DLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARL 1801
            SRLD+LF LL++    + R AAA Q+G++   +   ++ LL+K+L Y +   W  RIAA  AV  I  N   W P T        E +    S+L  ++ +  ++  +LK G  L      + +       E +  + I R    L R LG  +     +  + L   +D + + + +  NK + E      +  M N  K   KR                           P E+ + V     N+P T+ K +      N +  +   EWP   F EEL  +L++  WE+RHGA T LRE++++ G           S  K A C        H+ + E++ +RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV+  H+    V      LL LLN ++W V HG LLG+KY LA R DL+  LLP     I   L+ + DDDVR  A A+L+P+      + V +  +++  + + LWD L    D T S  T +++ LL  L      ++CNV               ++L   + R+ W +  ++   VR AA+ T   +L +        L    +  ++  + Q  +++ N ++    H VW + ++    Q +   +C  +  W+C  MQP+ +
Sbjct:    4 SRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELNNLLSKVLVYLRSPNWDTRIAAGQAVEAIVKNIPEWNPATRLKKEPGLEGSNEESSHLERLSFDRFDISRLLKHGASLLGSAGAEFEVQDDKTGEVDPKERIARQRKLLQRKLGLDMGAAIGMSTEELFNDEDLDYMPTTALLNKPAAEFIDSEFLPGMSNRQKNKAKRMAKLIAKQRSRDTIETNEKSSDSTDGEPEEKRRKVTNVVINQPATESKVLIDNVPDNSSPYDEINEWPLESFSEELCNDLFNPSWEVRHGAGTGLREILKAHGR----------SGGKIADCTLEEMKQQHQDWLEDLAIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVVLKHMNENGVHNTVKILLKLLNQEQWEVRHGGLLGIKYALAIRQDLINSLLPKALPAIVEGLQ-DLDDDVRAVAAASLVPV----VDSLVKLQFKQVPFIMSTLWDALLELDDLTAS--TNSIMTLLSSLLMYPQVQQCNV--------------QQSLTILVPRV-WPFLRHTISSVRKAALETLCTLLSTQDQNCSGWLT-PILQDMMRHIFQICILESNQEIIDLIHKVWQELLNKASVQYVVAAACPWMGAWLCLMMQPSHI 615          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Mouse
Match: Btaf1 (B-TFIID TATA-box binding protein associated factor 1 [Source:MGI Symbol;Acc:MGI:2147538])

HSP 1 Score: 535.798 bits (1379), Expect = 6.822e-158
Identity = 321/732 (43.85%), Postives = 460/732 (62.84%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-------EYSRAP-STCPP--SLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSY----KENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVD-KMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GAIE +  V      G++PY   I ++++PV L  ++   D +R +AT  F+ L+ L+PLE+   D   ++    Q + +   FL+ LL+ K +  Y     + +A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG       EY+R+  + C P  SL+VCPPTLT HW  E  KF  +    N + Y G P  R  + + + R+ +++ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA++ LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY CT+SPLQ++LY    +S+A  D D  E V  +      E   +    H FQ + YLR +CNHP+L LT  HP +++   +L   N  L DI  + KL AL+QL+LDCG+G +G+  E   E SVVA +R+L+FCQ   M+++V+  +++  +P  T+LRLDGS+P   R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N+ + SM T+ +L++   + +   +   +S +GK  +              KSVL  +S       ++D  ++YD EYNL++F+
Sbjct: 1163 GAIEALACVMEQLDVGIVPY---IVLLVVPV-LGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPNMSEELIQLKAKERHFLEQLLDGKKLENYKIPVPI-NAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCQRAQEYARSKLAECMPLPSLVVCPPTLTGHWVDEVGKF-CSREYLNPLHYTGPPTERIRLQHQVKRHNLIVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAVKQLTANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVD--ETVSSAALSEETEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEFKSTTEKLTVQNSSLHDIQHAPKLSALKQLLLDCGLG-NGSSTESGTE-SVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADSSTSGKASM--------------KSVLENLSD------LWDA-EQYDSEYNLETFM 1844          

HSP 2 Score: 181.415 bits (459), Expect = 5.705e-45
Identity = 227/820 (27.68%), Postives = 374/820 (45.61%), Query Frame = 2
Query:   86 SRLDKLFELLESNHQNI-RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLW--VPGT----SESNV--TNVSNLINLENLNLHDILKIGTRLYSRDFKDLD-------EANTNQNINRDE--LARHLGF------------LIPDE---------CEIKNLITVKDCELVES--------KSENK---MSVELAVMKSM------ENSPKKPVKRPHEEVQDV-----NEPGTKMKCVEKIGNETER----ERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYSDLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEA------HSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFIFHEAGIRNILIS---IIAQI---HLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSLSPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLI 2314
            SRLD+LF LL++    + R AAA Q+G++   +   ++ LL+K+L Y +   W  RIAA  AV  I  N   W  VP T    +ES++  ++ ++ +N +  ++  +L+ G  L      + +       E +  + I R    L + LG             L  DE           +    T++  EL++S        + +NK   M+   A  +S       E S       P E+ + V     N+  +  K +  I N  E     E   EWP   FCEEL  +L++  WE+RHGA T LRE++++ G          S+ ++    H+ + E++V+RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV+  H+    V    + LL LL  ++W V HG LLG+KY LA R D++  LLP +   I   L+ + DDDVR  A A+L+P+      + V +  +++ ++   LWD L    D T S  T +++ LL  +     + Y Q +   +     ++L   + R+ W + +++    +++VR  RA L+++   + T  E+ +   +         I   C + +        H VW + +     Q L   +C  +  W+C  MQP+ L          D  +     A A     G       ++  + + YI G ++ + D   A RD +V+RAR+ A +LL  LC         + N  I     + Q+   +L  + A+QR   ++++  W      A++         +Q +LL  L E +YY EI   F +M   C+  I
Sbjct:    4 SRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELNNLLSKVLIYLRSTNWDTRIAAGQAVEAIVKNVPEWNPVPRTKQEPTESSMEDSSTTDRLNFDRFDICRLLQHGASLLGSAGAEFEVQDEKSGEVDPKERIARQRKLLQKKLGLNMGEAIGMSTEELFNDEDLDYTPTSAALVNKQSTLQAAELIDSEFRAGMSNRQKNKAKRMAKLFAKQRSRDAVETNEKSNDSTDGEPEEKRRKVANVVINQTASDSKVL--IDNVPESSSLIEETNEWPLESFCEELCNDLFNPSWEVRHGAGTGLREILKAHGKS--GGKMGDSTLEEMIQQHQEWLEDLVIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVVLKHMNETGVHKTVDVLLKLLTQEQWEVRHGGLLGIKYALAVRQDVINTLLPKVLTRIIEGLQ-DLDDDVRAVAAASLVPV----VESLVYLQTQKVPSIINTLWDSLLELDDLTAS--TNSIMTLLSSM-----LTYPQVQQCSIQ----QSLTVLVPRV-WPFLHHT----ISSVR--RAALETLFTLLSTQDENSSSWLIPILSDMLRHIFQFCVLESSQEILDLIHKVWMELLSKASVQYLVAAACPWMSAWLCLMMQPSHLPI--------DLNMLLEVKARAKEKTGGKVRQGQIQNKEVLQEYIAGADTIMED--PATRDFVVMRARMMAAKLLGALCCYICDPSVNMVNQEIKPADSLGQLLLFYLNSKSALQRISVALVICEW-----AALQKECKAVTLAVQPRLLDILSEHLYYDEIAVPFTRMQNECKQFI 781          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Mouse
Match: Ercc6 (excision repair cross-complementing rodent repair deficiency, complementation group 6 [Source:MGI Symbol;Acc:MGI:1100494])

HSP 1 Score: 238.039 bits (606), Expect = 1.708e-62
Identity = 191/591 (32.32%), Postives = 296/591 (50.08%), Query Frame = 2
Query: 3683 KLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-EYSRAPSTCP--------PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMY----RQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQ--ELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQL 5410
            KL +YQ+ GV WL  L+     G+L D+MGLGKT+Q I  +AG  YS+  +           P++IVCP T+   W +EF  +    P F   V   T  Y     + I + +  + V+ITSY  +R   + ++R                   + W+YV+LDEGH IRN  + V +A +     HR++L+G+P+QN + ELWSLFDF+ PG LGT   F  ++   +   G ++   V  +       +L   + P++LRR+K DV     LP K  Q   C ++  Q ++Y + ++S+A             Y+    +N     F  +  LR +CNHP   L S  P   +   E     +       SGK++ +  L+                +       R+L+F QS +M+ +++  +R    K ++L++DG+     RQ ++ K++ D SI + LLTT +GGLG+NLT AN VI  + DWNP  D QA +RA RIGQK  V VYRL+TA +IEEKI + Q FK+FL N V+ KD  Q     + ++ E+        T + P ++ G +   S++  GT + +
Sbjct:  502 KLFKYQQTGVRWLWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSKIRTRGSNYRFEGLGPTIIVCPTTVMHQWVKEFHTWW---PPFRVAVLHETGSYTHKKERLIRDIVYCHGVLITSYSYIRLMQDDISR-------------------HDWHYVILDEGHKIRNPNAAVTLACKQFRTPHRIILSGSPMQNNLRELWSLFDFIFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFIDSKAV------------YR---ILNGENQIFSGLVALRKICNHPD--LFSGGPKNASGPPEDELEEEQFGHWRRSGKMIVVESLL----------------KIWHRQGQRVLLFSQSRQMLHILEVFLRAH--KYSYLKMDGTTTIASRQPLITKYNEDTSIFVFLLTTRVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQKKQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVL-KDPKQRRFFKSNDLYELF-------TLTSPDASQGTE--TSAIFAGTGSSI 1025          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Mouse
Match: Smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:MGI Symbol;Acc:MGI:99603])

HSP 1 Score: 229.565 bits (584), Expect = 6.564e-60
Identity = 176/542 (32.47%), Postives = 283/542 (52.21%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIA--GEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINL---SGKLVALRQLILDCGVGVSGAGEEELDETSVVASN-RLLVFCQSIKMMELVDK--MIRNEIPKATHLRLDGSVPAKDRQQIVEKFS-CDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVV 5254
            +++  L+ YQ +G+ W+  L    L+G+LAD+MGLGKT+Q I +I    E+ R      P LI+ P +   +W  EF K+    P    I Y GTP  R+ +   L   ++ V++T+Y+ +  D ++LA+                     W Y+++DEGH ++N+  K+  V      A  R++LTGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G +VD   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ  LY H M+++    TD  E   K       +        T+  LR +CNHP +     H +  +    L  +N  ++   L   SGK   L +++                   + A+N R+L+FCQ   +M +++     RN +    +LRLDG+  ++DR  +++KF+   +   I LL+T  GGLGLNL +A+ V+  + DWNP +DLQA DRAHRIGQ++ V V RL T  S+EEKI+   ++K  +   V+
Sbjct:  730 LINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNG---PYLIIVPLSTLSNWTYEFDKWA---PSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIR-------------------WKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPF----AMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRH-MQAKGILLTDGSEKDKKGKGGAKTL------MNTIMQLRKICNHPYM---FQH-IEESFAEHLGYSNGVINGAELYRASGKFELLDRIL-----------------PKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFL----YLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVI 1210          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Mouse
Match: Smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:MGI Symbol;Acc:MGI:99603])

HSP 1 Score: 229.565 bits (584), Expect = 7.211e-60
Identity = 175/534 (32.77%), Postives = 280/534 (52.43%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIA--GEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINL---SGKLVALRQLILDCGVGVSGAGEEELDETSVVASN-RLLVFCQSIKMMELVDK--MIRNEIPKATHLRLDGSVPAKDRQQIVEKFS-CDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFK 5230
            +++  L+ YQ +G+ W+  L    L+G+LAD+MGLGKT+Q I +I    E+ R      P LI+ P +   +W  EF K+    P    I Y GTP  R+ +   L   ++ V++T+Y+ +  D ++LA+                     W Y+++DEGH ++N+  K+  V      A  R++LTGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G +VD   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ  LY H M+++    TD  E   K       +        T+  LR +CNHP +     H +  +    L  +N  ++   L   SGK   L +++                   + A+N R+L+FCQ   +M +++     RN +    +LRLDG+  ++DR  +++KF+   +   I LL+T  GGLGLNL +A+ V+  + DWNP +DLQA DRAHRIGQ++ V V RL T  S+EEKI+   ++K
Sbjct:  730 LINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNG---PYLIIVPLSTLSNWTYEFDKWA---PSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIR-------------------WKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPF----AMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRH-MQAKGILLTDGSEKDKKGKGGAKTL------MNTIMQLRKICNHPYM---FQH-IEESFAEHLGYSNGVINGAELYRASGKFELLDRIL-----------------PKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFL----YLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYK 1202          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Mouse
Match: Smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:MGI Symbol;Acc:MGI:99603])

HSP 1 Score: 229.565 bits (584), Expect = 8.969e-60
Identity = 175/534 (32.77%), Postives = 280/534 (52.43%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIA--GEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINL---SGKLVALRQLILDCGVGVSGAGEEELDETSVVASN-RLLVFCQSIKMMELVDK--MIRNEIPKATHLRLDGSVPAKDRQQIVEKFS-CDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFK 5230
            +++  L+ YQ +G+ W+  L    L+G+LAD+MGLGKT+Q I +I    E+ R      P LI+ P +   +W  EF K+    P    I Y GTP  R+ +   L   ++ V++T+Y+ +  D ++LA+                     W Y+++DEGH ++N+  K+  V      A  R++LTGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G +VD   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ  LY H M+++    TD  E   K       +        T+  LR +CNHP +     H +  +    L  +N  ++   L   SGK   L +++                   + A+N R+L+FCQ   +M +++     RN +    +LRLDG+  ++DR  +++KF+   +   I LL+T  GGLGLNL +A+ V+  + DWNP +DLQA DRAHRIGQ++ V V RL T  S+EEKI+   ++K
Sbjct:  730 LINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNG---PYLIIVPLSTLSNWTYEFDKWA---PSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIR-------------------WKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPF----AMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRH-MQAKGILLTDGSEKDKKGKGGAKTL------MNTIMQLRKICNHPYM---FQH-IEESFAEHLGYSNGVINGAELYRASGKFELLDRIL-----------------PKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFL----YLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYK 1202          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. UniProt/SwissProt
Match: sp|O14981|BTAF1_HUMAN (TATA-binding protein-associated factor 172 OS=Homo sapiens OX=9606 GN=BTAF1 PE=1 SV=2)

HSP 1 Score: 534.258 bits (1375), Expect = 1.639e-156
Identity = 321/732 (43.85%), Postives = 460/732 (62.84%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-------EYSRAP-STCPP--SLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSY----KENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVD-KMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GAIE +  V      G++PY   I ++++PV L  ++   D +R +AT  F+ L+ L+PLE+   D   ++    Q + +   FL+ LL+ K +  Y     + +A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG       EY+R+  + C P  SL+VCPPTLT HW  E  KF  +    N + Y G P  R  + + + R+ +++ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA++ LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY CT+SPLQ++LY    +S+A  D D  E V  +      E   +    H FQ + YLR +CNHP+L LT  HP ++T   +LA  N  L DI  + KL AL+QL+LDCG+G +G+  E   E SVVA +R+L+FCQ   M+++V+  +++  +P  T+LRLDGS+P   R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N+ + SM T+ +L++   + +   +    S +GK  +              KS+L  +S       ++D  ++YD EY+L++F+
Sbjct: 1164 GAIEALACVMEQLDVGIVPY---IVLLVVPV-LGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPNMSAELIQLKAKERHFLEQLLDGKKLENYKIPVPI-NAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCHRAQEYARSKLAECMPLPSLVVCPPTLTGHWVDEVGKF-CSREYLNPLHYTGPPTERIRLQHQVKRHNLIVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAVKQLTANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVD--ETVSSATLSEETEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEFKTTAEKLAVQNSSLHDIQHAPKLSALKQLLLDCGLG-NGSTSESGTE-SVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASM--------------KSILENLSD------LWD-QEQYDSEYSLENFM 1845          

HSP 2 Score: 171.4 bits (433), Expect = 3.834e-41
Identity = 217/803 (27.02%), Postives = 362/803 (45.08%), Query Frame = 2
Query:  137 RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVP-------GTSESNVTN--VSNLINLENLNLHDILKIGTRLYSRDFKDLD-------EANTNQNINRDE--LARHLGF------------LIPDE---------CEIKNLITVKDCELVES--------KSENK---MSVELAVMKSM------ENSPKKPVKRPHEEVQDV-----NEPGTKMKC-VEKIGNETER-ERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYSDLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEA------HSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFIFHEAGIRNILISI-----IAQI---HLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSLSPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLI 2314
            R AAA Q+G++   +   ++ LL+K+L Y +   W  RIAA  AV  I  N   W P        TSES++ +   +  +N +  ++  +L+ G  L      + +       E +  + I R    L + LG             L  DE           +    T++  EL++S        + +NK   M+   A  +S       E S       P E+ + +     N+     K  ++ I + +   E   EWP   FCEEL  +L++  WE+RHGA T LRE++++ G          S+ ++    H+ + E++V+RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV+  H+    V    + LL LL  ++W V HG LLG+KY LA R D++  LLP +   I   L+ + DDDVR  A A+L+P+      + V +  +++  +   LWD L    D T S  T +++ LL  L     + Y Q +   +     ++L   + R+ W + +++    +++VR  RA L+++   + T  ++ +   +         I   C + +        H VW + +     Q +   +C  +  W+C  MQP+ L          D  +     A A     G      +++  + + YI G ++ + D   A RD +V+RAR+ A +LL  LC      + G+  +   I     + Q+   HL  + A+QR   ++++  W      A++         +Q +LL  L E +YY EI   F +M   C+ LI
Sbjct:   22 RKAAAQQLGEVVKLHPHELNNLLSKVLIYLRSANWDTRIAAGQAVEAIVKNVPEWNPVPRTRQEPTSESSMEDSPTTERLNFDRFDICRLLQHGASLLGSAGAEFEVQDEKSGEVDPKERIARQRKLLQKKLGLNMGEAIGMSTEELFNDEDLDYTPTSASFVNKQPTLQAAELIDSEFRAGMSNRQKNKAKRMAKLFAKQRSRDAVETNEKSNDSTDGEPEEKRRKIANVVINQSANDSKVLIDNIPDSSSLIEETNEWPLESFCEELCNDLFNPSWEVRHGAGTGLREILKAHGKS--GGKMGDSTLEEMIQQHQEWLEDLVIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVVLKHMNETGVHKTVDVLLKLLTQEQWEVRHGGLLGIKYALAVRQDVINTLLPKVLTRIIEGLQ-DLDDDVRAVAAASLVPVV----ESLVYLQTQKVPFIINTLWDALLELDDLTAS--TNSIMTLLSSL-----LTYPQVQQCSIQ----QSLTVLVPRV-WPFLHHT----ISSVR--RAALETLFTLLSTQDQNSSSWLIPILPDMLRHIFQFCVLESSQEILDLIHKVWMELLSKASVQYVVAAACPWMGAWLCLMMQPSHLPI--------DLNMLLEVKARAKEKTGGKVRQGQSQNKEVLQEYIAGADTIMED--PATRDFVVMRARMMAAKLLGALCCCIC--DPGVNVVTQEIKPAESLGQLLLFHLNSKSALQRISVALVICEW-----AALQKECKAVTLAVQPRLLDILSEHLYYDEIAVPFTRMQNECKQLI 782          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. UniProt/SwissProt
Match: sp|B0XPE7|MOT1_ASPFC (TATA-binding protein-associated factor mot1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mot1 PE=1 SV=1)

HSP 1 Score: 510.76 bits (1314), Expect = 3.363e-148
Identity = 308/728 (42.31%), Postives = 441/728 (60.58%), Query Frame = 2
Query: 3374 GAIELIYLVCH---SGLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY---------SRAPSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNE-IPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GA+E IY + H    G+LPY   +  +++PV L  ++   + +R +AT  F+ L+ L+PLE+   D   L+    + R +   F+  +L+ + + ++    ++  A+LR YQ+EGVNWL FLNRY LHG+L DDMGLGKTLQ IC++A ++         ++ P     PSLIVCPP+L+ HW QE K++    P  N + Y+G P  R  + ++L    +V+TSYD  R+D  +L                   N   WNY VLDEGHLI+N K+K  +A + L + HRL+L+GTPIQN V ELWSLFDFLMPG LGT   F  R+ + +  +  +     + EAG LA+E LH+QVLPF+LRR+K++VL +LPPKI+Q+Y C  S LQ +L+    + +     D V   +K+ KE        H FQ + Y+R +CN P+L +   H  Y  + + LAA +  + D+  + KL ALR L++DCG+GV    E +L   S V+ +R L+FCQ  +M+++V   + N+ +P    LRLDGSV A  RQ IV +F+ D S D+LLLTTS+GGLGLNLT A+ VIFVEHDWNP +D+QAMDRAHRIGQK  V VYRLIT  ++EEKI+NLQ FK  +A+ VV++ N  + +M+T+ +L++ N      T   P+ A G +  +  + G  + + G K  L      D GE   D   +Y +EYNLDSF+
Sbjct: 1202 GAVECIYHLIHVMEDGILPY---VIFLVVPV-LGRMSDSDNEVRLLATTSFATLVKLVPLEAGIPDPPGLSEELLKGRDRERQFMAQMLDVRKVEEFKIPVAI-KAELRPYQQEGVNWLAFLNRYNLHGILCDDMGLGKTLQTICIVASDHHMRAEEFARTQKPEVRKLPSLIVCPPSLSGHWQQELKQYA---PFLNCVAYVGPPAERSRLQSALPNADIVVTSYDICRNDNEVL-------------------NPINWNYCVLDEGHLIKNPKAKATIAVKRLLSNHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKVFLDRFAKPIAASRFSKSSSKEQEAGALAIEALHKQVLPFLLRRLKEEVLNDLPPKIIQNYYCDPSELQRKLFEDFTKKEQKALQDKVGSTEKADKE--------HIFQALQYMRRLCNSPALVVKEGHKQYNEVQQYLAAKHSNIRDVAHAPKLSALRDLLIDCGIGVDSPSEGDLSGASYVSPHRALIFCQMKEMLDIVQSEVFNKLLPSVQFLRLDGSVEATRRQDIVNRFNTDPSYDVLLLTTSVGGLGLNLTGADTVIFVEHDWNPQKDIQAMDRAHRIGQKKVVNVYRLITRGTLEEKILNLQRFKIDVASTVVNQQNAGLGTMDTDQLLDLFNLGETAETAEKPSDAAGNEVDMVDIDGNVKEK-GKKGWLD-----DLGELWDD--RQYQEEYNLDSFL 1886          

HSP 2 Score: 97.0561 bits (240), Expect = 1.751e-18
Identity = 104/351 (29.63%), Postives = 171/351 (48.72%), Query Frame = 2
Query:  701 TERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDE-------WRVNHXXXXXXXXXXXXRMDLV---EVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYSDLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSL 1723
            TE   N  WP+   C+ L+ +L+D  WEIRHGAA  LRE+IR QG+          S  +    + ++ +++  RLLC L LD+  D++SD +VAP+RE+  Q LG +   L  R V  +   L  ++   +       W V HG ++GL+YL+A R DL+     L+  + + +   L G+ DDDVR  + A L+P+        V      L TL T +WD L+  +    S +T +V+ LL +L     V+     +   A +   +  + + RL+    +    VR A +R     LQ  G      ++  T+      + Q +L++ N  V  ++  VW++ ++SL
Sbjct:  311 TEEGPNPNWPFELMCDILMVDLFDPNWEIRHGAAMALREVIRIQGAGA--GRVQGKSRAENDILNRKWLDDLACRLLCVLMLDRFGDYISDNVVAPIRETVGQTLGALLSQLPSRSVISVYKCLYRIIMQTDLGLERPIWEVCHGGMIGLRYLVAVRKDLLIKDSKLMDGVLEAVMKGL-GDYDDDVRAVSAATLVPI----AEEFVKTRQSTLGTLMTIVWDCLS-NLQDDLSASTGSVMDLLAKLCTFQEVLDAMKAN--AAVNPESSFGKLVPRLYPFLRHTITSVRSAVLRALMTFLQLEGEGTDEWVDGKTV----RLIFQNLLVERNEGVLKQSLQVWSELLNSL 647          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. UniProt/SwissProt
Match: sp|Q4WJI7|MOT1_ASPFU (TATA-binding protein-associated factor mot1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mot1 PE=1 SV=1)

HSP 1 Score: 510.375 bits (1313), Expect = 4.382e-148
Identity = 308/728 (42.31%), Postives = 441/728 (60.58%), Query Frame = 2
Query: 3374 GAIELIYLVCH---SGLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY---------SRAPSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNE-IPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GA+E IY + H    G+LPY   +  +++PV L  ++   + +R +AT  F+ L+ L+PLE+   D   L+    + R +   F+  +L+ + + ++    ++  A+LR YQ+EGVNWL FLNRY LHG+L DDMGLGKTLQ IC++A ++         ++ P     PSLIVCPP+L+ HW QE K++    P  N + Y+G P  R  + ++L    +V+TSYD  R+D  +L                   N   WNY VLDEGHLI+N K+K  +A + L + HRL+L+GTPIQN V ELWSLFDFLMPG LGT   F  R+ + +  +  +     + EAG LA+E LH+QVLPF+LRR+K++VL +LPPKI+Q+Y C  S LQ +L+    + +     D V   +K+ KE        H FQ + Y+R +CN P+L +   H  Y  + + LAA +  + D+  + KL ALR L++DCG+GV    E +L   S V+ +R L+FCQ  +M+++V   + N+ +P    LRLDGSV A  RQ IV +F+ D S D+LLLTTS+GGLGLNLT A+ VIFVEHDWNP +D+QAMDRAHRIGQK  V VYRLIT  ++EEKI+NLQ FK  +A+ VV++ N  + +M+T+ +L++ N      T   P+ A G +  +  + G  + + G K  L      D GE   D   +Y +EYNLDSF+
Sbjct: 1202 GAVECIYHLIHVMEDGILPY---VIFLVVPV-LGRMSDSDNEVRLLATTSFATLVKLVPLEAGIPDPPGLSEELLKGRDRERQFMAQMLDVRKVEEFKIPVAI-KAELRPYQQEGVNWLAFLNRYNLHGILCDDMGLGKTLQTICIVASDHHMRAEEFARTQKPEVRKLPSLIVCPPSLSGHWQQELKQYA---PFLNCVAYVGPPAERSRLQSALPNADIVVTSYDICRNDNEVL-------------------NPINWNYCVLDEGHLIKNPKAKATIAVKRLLSNHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKVFLDRFAKPIAASRFSKSSSKEQEAGALAIEALHKQVLPFLLRRLKEEVLNDLPPKIIQNYYCDPSELQRKLFEDFTKKEQKALQDKVGSTEKADKE--------HIFQALQYMRRLCNSPALVVKEGHKQYNEVQQYLAAKHSNIRDVAHAPKLSALRDLLIDCGIGVDSPSEGDLSGASYVSPHRALIFCQMKEMLDIVQSEVFNKLLPSVQFLRLDGSVEATRRQDIVNRFNTDPSYDVLLLTTSVGGLGLNLTGADTVIFVEHDWNPQKDIQAMDRAHRIGQKKVVNVYRLITRGTLEEKILNLQRFKIDVASTVVNQQNAGLGTMDTDQLLDLFNLGETAETAEKPSDAAGNEVDMVDIDGNVKEK-GKKGWLD-----DLGELWDD--RQYQEEYNLDSFL 1886          

HSP 2 Score: 96.6709 bits (239), Expect = 2.003e-18
Identity = 104/351 (29.63%), Postives = 171/351 (48.72%), Query Frame = 2
Query:  701 TERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDE-------WRVNHXXXXXXXXXXXXRMDLV---EVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYSDLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSL 1723
            TE   N  WP+   C+ L+ +L+D  WEIRHGAA  LRE+IR QG+          S  +    + ++ +++  RLLC L LD+  D++SD +VAP+RE+  Q LG +   L  R V  +   L  ++   +       W V HG ++GL+YL+A R DL+     L+  + + +   L G+ DDDVR  + A L+P+        V      L TL T +WD L+  +    S +T +V+ LL +L     V+     +   A +   +  + + RL+    +    VR A +R     LQ  G      ++  T+      + Q +L++ N  V  ++  VW++ ++SL
Sbjct:  311 TEEGPNPNWPFELMCDILMVDLFDPNWEIRHGAAMALREVIRIQGAGA--GRVQGKSRAENDILNRKWLDDLACRLLCVLMLDRFGDYISDNVVAPIRETVGQTLGALLSQLPSRSVISVYKCLYRIIMQTDLGLERPIWEVCHGGMIGLRYLVAVRKDLLIKDSKLMDGVLEAVMKGL-GDYDDDVRAVSAATLVPI----AEEFVKTRQSTLGTLMTIVWDCLS-NLQDDLSASTGSVMDLLAKLCTFQEVLDAMKAN--AAVNPESSFGKLVPRLYPFLRHTITSVRSAVLRALMTFLQLEGEGTDEWVDGKTV----RLIFQNLLVERNEGVLKQSLQVWSELLNSL 647          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. UniProt/SwissProt
Match: sp|P32333|MOT1_YEAST (TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MOT1 PE=1 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 1.358e-147
Identity = 308/740 (41.62%), Postives = 449/740 (60.68%), Query Frame = 2
Query: 3374 GAIELIY---LVCHSGLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG---------EYSRA-PSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETS----------VVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGE--RVYDCLDEYDQEYNLDSFV 5515
            G+ ELIY   L   + +LPY   +  +I+P+ L  ++   + +R +AT  F+ ++ L+PLE+  AD   L       R++   F+  +++P     +    ++  A LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ IC+IA          E +R+  S   PSLI+CPP+LT HW  EF ++    P    +VY G P  R  +   LS   +++TSYD  R+D+ +L                   N   +NY VLDEGH+I+N +SK+A A + + A HRL+LTGTPIQN V ELWSLFDFLMPG LGT   F  R+ + +  + ++     + EAG LALE LH+QVLPFMLRR+K+DVL +LPPKI+QDY C +  LQ +LY    + Q         +V+K  + +   +  +H FQ + Y+R +CNHP+L L+ +HP    +   L      L DI  + KL ALR L+ +CG+     GEE++D+ +          V++ +R L+FCQ   M+++V+  + +  +P  T++RLDGS+  +DRQ++V KF+ D SID LLLTT +GGLGLNLT A+ VIFVEHDWNPM DLQAMDRAHRIGQK  V VYR+IT  ++EEKIM LQ+FK  +A+ VV++ N+ +ASM+T  +L++ + + N  +Q      NG     S  + G E  + +++ L+  +K   GE   ++D   +Y++EYNLD+F+
Sbjct: 1170 GSTELIYHLSLSMETDVLPY---VIFLIVPL-LGRMSDSNEDVRNLATTTFASIIKLVPLEAGIADPKGLPEELVASRERERDFIQQMMDPSKAKPFKLPIAI-KATLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRKEDYEKTRSVESRALPSLIICPPSLTGHWENEFDQYA---PFLKVVVYAGGPTVRLTLRPQLSDADIIVTSYDVARNDLAVL-------------------NKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANHRLILTGTPIQNNVLELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELGDLQKQLYMDFTKKQK-------NVVEKDIENSEIADGKQHIFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGLDLHDIINAPKLSALRTLLFECGI-----GEEDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLDMVENDLFKKYMPSVTYMRLDGSIDPRDRQKVVRKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLFDPD-NVTSQDNEEKNNGD----SQAAKGME-DIANETGLTGKAKEALGELKELWDP-SQYEEEYNLDTFI 1863          

HSP 2 Score: 95.1301 bits (235), Expect = 5.865e-18
Identity = 141/556 (25.36%), Postives = 231/556 (41.55%), Query Frame = 2
Query:   86 SRLDKLFELLESNH-QNIRNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLW-------VPGTS---------------------ESNVTNVSNLI-------NLENLNLHDILKIGTRLYSRDFKDLD-----EANTNQNINRDELARHLGFLIPDECEIKNLITVKDCELVESKSENKMSVELAVMK------SMENSPKKPVKRPHEEVQDV--------------------NEPGTKMKCVEK--------------IGNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDE---------WRVNHXXXXXXXXXXXXRMD------LVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERL---YEKCNVVYNQSEDQP 1456
            SRLD+   L+E+   Q +RN AA Q+G L+  +  +I +LL+++ P+   K W  R+ A+ AV  I  +A  W       V GT+                     E+   N  NL+       +L +  L++ILK G  L +    D +     + N  +    D++ +    L   +   +N             + NK S  +  M       S +N+PK PV      V                       N+   K++  E+              +  + E      W +    E LL NL    WEIRHGAA  LREL++     +     N    +     + R  E++  RLL    LD+  D+V D +VAPVRES AQ L  + +HL   L   + N L  L+  D          W   HG LLG++Y ++ + +      L+E ++ I+   ++       DDDV+  A + L P+     S  V ++N  ++ L T +W +LA R+D   S +  +++ LL +L    E  +++ N++ + P
Sbjct:    6 SRLDRQVILIETGSTQVVRNMAADQMGDLAKQHPEDILSLLSRVYPFLLVKKWETRVTAARAVGGIVAHAPSWDPNESDLVGGTNEGSPLDNAQVKLEHEMKIKLEEATQNNQLNLLQEDHHLSSLSDWKLNEILKSGKVLLASSMNDYNVLGKADDNIRKQAKTDDIKQETSMLNASDKANEN-----------KSNANKKSARMLAMARRKKKMSAKNTPKHPVDITESSVSKTLLNGKNMTNSAASLATSPTSNQLNPKLEITEQADESKLMIESTVRPLLEQHEIVAGLVWQFQGIYELLLDNLMSENWEIRHGAALGLRELVKKHAYGVSRVKGNTREENNLR--NSRSLEDLASRLLTVFALDRFGDYVYDTVVAPVRESVAQTLAALLIHLDSTLSIKIFNCLEQLVLQDPLQTGLPNKIWEATHGGLLGIRYFVSIKTNFLFAHGLLENVVRIVLYGLN-----QSDDDVQSVAASILTPI----TSEFVKLNNSTIEILVTTIWSLLA-RLDDDISSSVGSIMDLLAKLCDHQEVLDILKNKALEHP 538          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. UniProt/SwissProt
Match: sp|O43065|MOT1_SCHPO (Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mot1 PE=1 SV=4)

HSP 1 Score: 504.212 bits (1297), Expect = 1.046e-145
Identity = 321/735 (43.67%), Postives = 442/735 (60.14%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGE-YSR----APSTCP-----PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRL---YTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDE--TSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDE--YDQEYNLDSFV 5515
            GAIE IY V       +LPY   I  +I+P++    +A  D +R +AT  F+ L+ L+PLE+   D   L       R++   FL+ +LNP  +  ++    + SA LR+YQ+EGVNWL FLN+Y LHG+L DDMGLGKTLQ IC++A + Y+R      S  P     PSLIVCP TL  HW QE   +    P      Y+G P  R  I + + +  VV+TSYD  R+D++ L +                     WNY VLDEGH+I+N ++K+  A ++L + HRL+L+GTPIQN V ELWSLFDFLMPG LGT   F  R+ R +  +        + E GTLALE +H+QVLPFMLRR+K+DVL +LPPKI+QDY C MS LQ +L   +   +      + D  E    + K+ S   Q  H FQ + Y+R +CNHP+L LT  HP    ++++LA  N  L D+  + KL AL QL+ DCG+G S      +D   T+ V+ +R+L+FCQ   M+++V+K +++  +P  T++RLDGSV    RQ+ V KF+ D SID+LLLTT +GGLGLNLT A+ VIFVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT   +EEKIM LQ FK  +A+ VV++ N  ++S+ T+ IL++ N  A+            +Q+ V ++    E++  +   LS  SK  + E + +  DE  YD E+NLD F+
Sbjct: 1256 GAIECIYHVVQRLGVRILPY---ILYLIIPLLGRMSDADQD-VRVLATTSFATLVKLVPLEAGLPDPPDLPQYLLDSREKERKFLEQMLNPSKVEAFSIPVPI-SADLRKYQQEGVNWLAFLNKYELHGILCDDMGLGKTLQTICIVASDHYNRQKLFEESGSPKFAHVPSLIVCPSTLAGHWQQELSTYA---PFLKVSAYVGPPAERAKIRSKMKKSDVVVTSYDICRNDVDELVKID-------------------WNYCVLDEGHVIKNARAKLTKAVKSLRSYHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKTFQERFVRPIAASRDAKSSSKERERGTLALEAIHKQVLPFMLRRLKEDVLADLPPKIIQDYYCDMSDLQRKLLNDFVSQLNINEELEDDETEKTQGTRKKKS---QKAHIFQALQYMRKLCNHPALILTEKHPKRNAIVKQLAKENSGLHDLKHAPKLTALGQLLRDCGLGNSSVNSNGIDSALTNAVSEHRVLIFCQLKDMLDMVEKDLLQATMPDVTYMRLDGSVEPTKRQEAVTKFNNDPSIDVLLLTTHVGGLGLNLTGADTVIFVEHDWNPMRDLQAMDRAHRIGQKKVVNVYRLITRGCLEEKIMGLQRFKMNVASTVVNQQNAGLSSIGTDQILDLFNTTAD------------EQQTVQNID-KEESEDAAGRGLSGTSKK-ALEGLPEMWDESQYD-EFNLDGFI 1945          

HSP 2 Score: 79.337 bits (194), Expect = 4.655e-13
Identity = 41/124 (33.06%), Postives = 71/124 (57.26%), Query Frame = 2
Query:  725 WPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDE 1096
            WP+    E LL +++D  WEIRHGA   LRE+IR  G     +    S  +     ++++ ++++ R+ C   LD+  D+++D++VAP+RES +Q LGV  +++    V  +   L SL+  +E
Sbjct:  359 WPFETLVELLLIDMFDPSWEIRHGACMGLREIIRYAG-FGYGRVVGKSEAEN-EQLNKKYFDDLLCRIACVFALDRFGDYLADQVVAPIRESVSQVLGVALIYVPNDSVFSMYKVLHSLVFQNE 480          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. TrEMBL
Match: A0A0T6B0J0 (HEAT domain-containing protein (Fragment) OS=Oryctes borbonicus OX=1629725 GN=AMK59_6016 PE=4 SV=1)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 565/1673 (33.77%), Postives = 842/1673 (50.33%), Query Frame = 2
Query:  623 KRPHEEVQDVNEPGTKMKCVE-KIGNET------ERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANIS---STDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTS-----GATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYSDLVRLAAVRTCRAVLQSIG-IKVGTIL--EHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFID--SLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILT--EFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFIFHEAGI---RNILISI-----IAQIHLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSLSP--LQSQLLTALEEPIYYQEILSQFKQMHKACRDLILIYIEREIPLPPSIMNAVGPNASPVSIALNISQCQSLISSEMCSLCPPESMTTFSCATAAVDTCAQQHATLCRLVD--------------IAVGRALLQWGWXXXXXXXXXXXXXSAVRSETCVTLQTEACIALAQLVVDHNSQTRLLAPVTKLVKNLIQYQSEAIDSLATMQ--PHEVEQGEIVAIYKTSQLGREAFPRQEDNG--------TAVAID------NDVM----IKLRGSRLALEKIYSRFVSSSESDLDHSF-LMEIIYHAXXXXXXXXXXXXRDRHHDNNSILVALRAMNTCLPFIKHASNRFQKISLACYAQSVFQSGLSHIDPIIRHWSARVLAMLVMPQSAADNXXXXXXXXXXXXXXXXXXXXXMTLNEKLCYGAIELIYLVCHSGLLPYRLAIAVIILPVVLACLNAPFDP---LRRVATHVFSXXXXXXXX-----ESSGADLSILTPARQQQRK---QHLS--------------------FLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYS---------RAPSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMN 5314
            ++  E + +  EP  K   VE K+ +ET      +   + +WP   FC++L ++L+ + WE RHGAAT LRE++   G     K A  S   + D+    H+ + +++ +RLLC L LD+  DFVSD +VAPVRE+CAQ L  +   +  +      N LL LLN + W   HG LLGLKYLLA R D+V  LL   +  I   L  +  DDV   A +AL+P+        V +  + ++ + T LWD+LA + +  ++     G   A+L L E           Q+   P      + L+E + +L W + ++S     ++VR  +A LQ++G +  G  +  E   +   L  + QRVL++  C V   A  VWN+ I    L E LLA  +C  +  W+C +MQP R+ Y P   +         A +      +G++  D    H +T  + YIGG E+       A R+   ++ R  A ++L  L    I    G+   ++I + +     I  +HL+ + A+QR +A +++A W         +L+  ++ P  L+  L   L E +Y+ EI + F ++ +  +D I +    ++P           N   V   L + Q + L  +E+      + +  F      +D+  ++   L   V                A+  A + +  LP KLTP++KPL+ ++R E    LQ  A   LA L+     + R   P  K++ NL  +     +   T+   P  V QG +    +     + A+ R    G        T + ++      +DV     I+ RG+ LA  +I S F +     L   + LM     A +     +      +  D   +L  L+ M  C   I H   R      +     V    LSH    +RH SAR LA      S           +  +++   L  L  T NE    GA+E I  +  +     +  I   ++ +V+  L    D    +R + TH F+ L+ L+PL     E  G  LS+L   R+++R+   Q LS                    FL  LL+P  I  Y      + A+LR YQ+ GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG++          RAP   P PSL++CPPTLT HW  E +KFL +      + Y G+P+ R+ +     +Y +++ SYD +R D+   +                      WNY++LDEGH+I+N K++ ++A + L A+HRL+L+GTPIQN V ELWSLFDFLMPG LGT  +F  RY R +  +        + EAG LA+E LHRQVLPF+LRR+K+DVL +LPPKI QDY C +S LQ RLY     SQA      +E    +    S++  + H FQ + YL+ VCNHP L LT SHP Y  +  +L      L++I+ S KL AL QL+ DCG+GV+     EL    V+  +R LVFCQ   M+ +++  + +  +P  T+LRLDGSVPA  RQ +V +F+ D SID+LLLTT +GGLGLNLT A+ VIFVEHDWNPM+DLQAMDRAHRIGQ+  V VYRLIT  ++EEKIM LQ+FK   AN V+S +N+++ +M TE +L++ +
Sbjct:  148 QKSREPIDEEYEPDKKKNRVEDKVKDETALTIDIDNGDSGDWPLEMFCDQLSQDLFSSSWEARHGAATALREILTVHG-----KGAGKSVYLTADQIIEYHQAWLDDMAIRLLCVLALDKFGDFVSDSVVAPVRETCAQCLCAVLKLMNEKGCNTALNILLQLLNQEGWEARHGGLLGLKYLLAVREDMVHALLTGAFPSIMKGL-SDPVDDVGAVAASALIPI----VEKLVKLVPKSIELVVTKLWDLLAEQDELASACNSFMGLLAAILSLPE----------AQTLLPP------QPLSEVVPKL-WPFLSHST----SSVR--KATLQTLGTLTDGNTMQWEAQLLQDALRHVYQRVLVEPLCDVRRLAELVWNKLIKHAGLVELLLA--TCPFVSAWLCLSMQPIRIPYDPNLFIF--------AKSQRKQKVEGINSFD----HTVTPVKLYIGGSET----TPLATRETNAIKVRCMAARMLGLLSCYVIQKAPGVDYTKDIEVPLDCYIKILMVHLQSKSALQRMMAGLVIAEW--------ASLDAETICPELLKQILHKCLSECVYFDEIAASFTKLAQETKDFIAMLKHYKVP--------TDVNGDSV---LTLDQMKLLTGTEV-----QQVLLRFKLKQKILDSLEERRRGLHDSVSQTSQDQYMLSVSTLAALSGATVMFKALPEKLTPVVKPLMESIRREGDEQLQHIAAKRLAYLL--DQCRLRNSCPNDKILTNLCMFLRGDPEFTPTISKIPENVCQGIVTLDNQQRNAEKAAYRRSNSTGRGPGRPPATDIPLEELFKENDDVQKSNHIQRRGATLAFTEIVSYFGNELPEKLPKMWSLMVGQLTATVDPENFNVQALVGKKDDAEQLLWMLQVMEVCALHI-HPDLREMLFDNSLKRFCVL---LSHPYKAVRHLSARCLAAFAKIDSVP---------VMELIVSKVLPMLGATTNETDRQGAVEAIACIVEA----LQFDIVPYVVLLVVPLLGRMSDQNQCVRLMGTHSFATLVQLMPLDGGIPEPPGLKLSVLCAKREKEREFLSQLLSPEPPGLKLSVLCAKREKEREFLSQLLSPSSIPDYQIPVP-IDAELRTYQQAGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHYHREQNYKLIRAPDCAPLPSLVICPPTLTGHWTYEVEKFL-SRKYLRPLQYNGSPVEREKLRYRFDKYNLIVASYDIVRKDIIFFSHIK-------------------WNYIILDEGHVIKNGKTRTSIAIKQLIAQHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKQFTARYSRPILASRDPKCSSKEQEAGALAMEALHRQVLPFLLRRMKEDVLDDLPPKITQDYYCELSTLQERLYDDFSRSQAHQT---LEESLSTGATASSMQGNTHIFQALRYLQNVCNHPKLVLTPSHPQYNKISLQLQNEGTLLENIHHSAKLPALMQLLQDCGIGVTETQSTEL----VINQHRALVFCQLKAMLNIIENDLFKKHMPGVTYLRLDGSVPASQRQVLVTRFNNDPSIDVLLLTTQVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQRKVVNVYRLITRSTLEEKIMGLQKFKVQTANTVISGENSRLETMATEQLLDLFS 1698          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. TrEMBL
Match: A0A2D4HIG3 (Uncharacterized protein (Fragment) OS=Micrurus lemniscatus lemniscatus OX=129467 PE=4 SV=1)

HSP 1 Score: 532.717 bits (1371), Expect = 3.017e-164
Identity = 320/732 (43.72%), Postives = 458/732 (62.57%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-------EYSR---APSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTD----FVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVD-KMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GAIE +  +      G++PY   I ++++PV L  ++   D +R +AT  F+ L+ L+PLE+   D   ++    + + +   FL+ LL+ K +  Y      + A+LR+YQ+EGVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG       EY+R   A S   PSL+VCPPTLT HW  E  KF  +    N + Y G P  R  +   + R+ +++ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C +S LQ++LY    +S+A  D D       L +++  E   +    H FQ + YLR +CNHP+L LT+ HP ++ +  +L A N  L DI  + KL AL+QL+LDCG+G  G+ E   +  ++VA +R+L+FCQ   M+++V+  +++  +P  T+LRLDGS+PA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPM+DLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N  + SM T+ +L++   + +  T+        K    +SVSG T      KSVL  + +      ++D  D+YD EY+L+ F+
Sbjct:   47 GAIEALGAIMEQLDVGIIPY---IVLLVVPV-LGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPNMSEDLIKIKAKERHFLEQLLDGKKLENYKIP-VPIKAELRKYQQEGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHYLRAQEYARTKVADSIPLPSLVVCPPTLTGHWVDEVGKF-CSKEFLNPLHYTGPPTERARLQQHVKRHNLIVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAIKQLAANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCILSSLQVQLYEDFAKSRAKCDVDETVSAASLTEET--EKPKLKATGHVFQALQYLRKLCNHPALVLTAHHPEHKRITEKLGAENSSLHDIQHAPKLSALKQLLLDCGLGNGGSPESGTE--TIVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPAGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMKDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENTSLQSMGTDQLLDLFTLDKDGKTE--------KSDGATSVSGKTSM----KSVLENLGE------LWD-QDQYDSEYSLEKFM 730          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. TrEMBL
Match: Q59HB6 (BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1)

HSP 1 Score: 529.635 bits (1363), Expect = 1.050e-163
Identity = 316/717 (44.07%), Postives = 454/717 (63.32%), Query Frame = 2
Query: 3410 GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-------EYSRAP-STCPP--SLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSY----KENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVD-KMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            G++PY   I ++++PV L  ++   D +R +AT  F+ L+ L+PLE+   D   ++    Q + +   FL+ LL+ K +  Y      ++A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG       EY+R+  + C P  SL+VCPPTLT HW  E  KF  +    N + Y G P  R  + + + R+ +++ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA++ LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY CT+SPLQ++LY    +S+A  D D  E V  +      E   +    H FQ + YLR +CNHP+L LT  HP ++T   +LA  N  L DI  + KL AL+QL+LDCG+G +G+  E   E SVVA +R+L+FCQ   M+++V+  +++  +P  T+LRLDGS+P   R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N+ + SM T+ +L++   + +   +    S +GK  +              KS+L  +S       ++D  ++YD EY+L++F+
Sbjct:   29 GIVPY---IVLLVVPV-LGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPNMSAELIQLKAKERHFLEQLLDGKKLENYKIP-VPINAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCHRAQEYARSKLAECMPLPSLVVCPPTLTGHWVDEVGKF-CSREYLNPLHYTGPPTERIRLQHQVKRHNLIVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAVKQLTANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVD--ETVSSATLSEETEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEFKTTAEKLAVQNSSLHDIQHAPKLSALKQLLLDCGLG-NGSTSESGTE-SVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASM--------------KSILENLSD------LWD-QEQYDSEYSLENFM 695          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. TrEMBL
Match: Q8N6J1 (BTAF1 protein (Fragment) OS=Homo sapiens OX=9606 GN=BTAF1 PE=2 SV=1)

HSP 1 Score: 528.865 bits (1361), Expect = 1.085e-163
Identity = 316/717 (44.07%), Postives = 454/717 (63.32%), Query Frame = 2
Query: 3410 GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-------EYSRAP-STCPP--SLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSY----KENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVD-KMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            G++PY   I ++++PV L  ++   D +R +AT  F+ L+ L+PLE+   D   ++    Q + +   FL+ LL+ K +  Y      ++A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG       EY+R+  + C P  SL+VCPPTLT HW  E  KF  +    N + Y G P  R  + + + R+ +++ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA++ LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY CT+SPLQ++LY    +S+A  D D  E V  +      E   +    H FQ + YLR +CNHP+L LT  HP ++T   +LA  N  L DI  + KL AL+QL+LDCG+G +G+  E   E SVVA +R+L+FCQ   M+++V+  +++  +P  T+LRLDGS+P   R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S++N+ + SM T+ +L++   + +   +    S +GK  +              KS+L  +S       ++D  ++YD EY+L++F+
Sbjct:   10 GIVPY---IVLLVVPV-LGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPNMSAELIQLKAKERHFLEQLLDGKKLENYKIP-VPINAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCHRAQEYARSKLAECMPLPSLVVCPPTLTGHWVDEVGKF-CSREYLNPLHYTGPPTERIRLQHQVKRHNLIVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAVKQLTANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVD--ETVSSATLSEETEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEFKTTAEKLAVQNSSLHDIQHAPKLSALKQLLLDCGLG-NGSTSESGTE-SVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASM--------------KSILENLSD------LWD-QEQYDSEYSLENFM 676          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. TrEMBL
Match: V4B6I6 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_229634 PE=4 SV=1)

HSP 1 Score: 538.495 bits (1386), Expect = 1.901e-163
Identity = 324/719 (45.06%), Postives = 447/719 (62.17%), Query Frame = 2
Query: 3410 GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGE-YSR--------APSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDT-DFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGV-----SGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
             +LPY   I ++++PV L C+    +P+R +ATH F+ ++ LLPLE+   D   +      +R +   FL+ LL+      Y+    +  A+LR+YQ++GVNWLGFLN+Y LHG+L DDMGLGKTLQ+IC++A + Y R         P  CP PSL+VCPPTL  HW  E  KF+ N    N ++Y G P  R  +   + ++ +++ SYD +R+D+      TF                  WNY +LDEGH+IRN K+K++ A + L   HRL+L+GTPIQN V +LWSLFDFLMPG LGT  +F  RYG+ + Q+        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C +SPLQ+ LY    +SQ   D  D V   D S K++       H FQ + YLR VCNHPSL LT+SHP Y  +M  L  +   + DI  + KL AL+QL+ DCG+GV     SG       +  VV  +R+L+FCQ   M+ +V++ +I+ E+P  T+LRLDG VPA  R  IV++F+ D SID+LLLTT +GGLGLNLT A+ VIFVEHDWNPM+DLQAMDRAHRIGQK  V VYRL+T  ++EEKIM LQ+FK  +AN V+S+DN+ + SM T+ +L +   +             G+  V S+ S     +   K++L      +S E ++D   +YD EY+L++F+
Sbjct:  291 NILPY---IVLLVVPV-LGCMCDQNEPVRLMATHCFAQMIRLLPLEAGIPDPPEMKGDLANRRDKERKFLEQLLDGSKSEDYDITVDI-KAELRKYQQDGVNWLGFLNKYKLHGILCDDMGLGKTLQSICILATDHYERQKQYQKENTPDCCPLPSLVVCPPTLVGHWVYEINKFVDN-DLLNPLMYAGPPSERIRLQKKVKKHNLIVASYDVVRNDIEFFT--TFR-----------------WNYCILDEGHIIRNGKTKLSKAVKQLLCNHRLILSGTPIQNNVLDLWSLFDFLMPGFLGTEKQFQARYGKPILQSRDGKSTTKEQEAGALAMEALHRQVLPFILRRLKEDVLQDLPPKIIQDYYCDLSPLQVELYEDFAKSQVKNDIEDDVVSEDSSGKKSQG---STHVFQALQYLRKVCNHPSLVLTTSHPKYDMIMSRLKHDKSSIHDIQHAPKLTALKQLLNDCGIGVGSSNTSGTSNILGTDVPVVNQHRVLLFCQLKSMLNIVEQDLIKREMPSVTYLRLDGGVPATSRHDIVQRFNNDPSIDMLLLTTHVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLVTRGTLEEKIMGLQKFKLNIANTVISQDNSNLQSMATDQLLHLFTLD---------DMKKGESSVPSTSSDKPVKKESMKTIL------ESLEGLWD-EPQYDTEYDLNNFM 965          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Cavefish
Match: btaf1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:103037828])

HSP 1 Score: 533.102 bits (1372), Expect = 5.813e-157
Identity = 322/733 (43.93%), Postives = 464/733 (63.30%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTP--ARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY---------SRAPSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFV--ELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMN-KEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GAIE +  V       ++PY   I ++++PV L  ++ P D +R +AT  F+ L+ LLPLE+   D   ++    RQ+ R++H  FL+ LL+ + +  Y     +  A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG++         ++A  +CP PS++VCPPTLT HW  E  KF       N + Y G P  R  + + + ++ +V+ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C +SPLQ++LY    +S+A    D V    V +  +E   +    H FQ + YLR +CNHP+L LT  HP ++ +  +L++ +  L DI  + KL AL+QL+LDCG+G   AG  +    +VVA +R+L+FCQ   M+++V++ +++ ++P  T+LRLDGSVPA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S+DN+ + SM T+ +L +    + +   +S  AS++GK  + S + G     LG                ++D   +Y+ EY+LDSF+
Sbjct: 1170 GAIEAMACVMEQLDVDIVPY---IVLLVVPV-LGRMSDPSDSVRFMATQCFATLIRLLPLEAGIPDPPSMSDDLIRQKARERH--FLEQLLDGRKLENYKIPVPI-KAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHYLRAQEYTKTKAADSCPLPSIVVCPPTLTGHWVDEVGKFCTK-EYLNPLHYTGPPTERARLQHQVKKHNLVVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAIKQLAANYRVILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDAKSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCNLSPLQVQLYEDFAKSRAKVSVDDVISTAVKEEEEEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEHKRISEQLSSQHSSLRDIQHAPKLSALKQLLLDCGLG--SAGSSDGGTEAVVAQHRVLIFCQLKSMLDIVEQDLLKPQLPSVTYLRLDGSVPAGLRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTVISQDNSSLQSMGTDQLLNLFTLDKDDKAEKSEVASSSGKASMKSVLDG-----LGD---------------LWD-QQQYEAEYDLDSFM 1852          

HSP 2 Score: 179.104 bits (453), Expect = 1.906e-44
Identity = 197/658 (29.94%), Postives = 313/658 (47.57%), Query Frame = 2
Query:  593 SMENSPKKPVKRPHEEVQDVNEPGTKMKC-VEKI-GNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANI--SSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYS-DLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFIFHEAGIRNILI---SIIAQI---HLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSL--SPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLILIYIEREIPLPPSIMNAVGPNASPVSIALNISQCQSLISSEMCSLCPPESMTTFSCATAAVDTCAQQHATL 2527
            S E  P++  ++    V  +++P T+ K  ++ +  N +  E   EWP   FCEEL  +L++  WEIRHGA T LRE+++  G+        +  S++++ A  H+ + E++V+RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV   H+T   V +  + LL LL  D+W V HG LLG+KY LA R +L+  LLP +   I+  L+ + DDDVR  A AAL+P+        V +   ++  +   LWD L    D T S  T +++ LL  L     + Y Q     M     ++L   + R+ W +  ++   VR AA+ T   +L S   + G +  +  +  +L  + Q  +++ N ++      VW + +   P+Q +   SC  +  W+C  MQ + +          D  +     A +     G     G +     + YIGG ++   D     RD +V RARL A +LL  LC+     +       I     +AQ+   HL  + A+QR   +M+L  W           N+C +  S +Q +LL  L E +YY EI   F +M   C+ LI +  +  I +   I ++V            I Q   L++            T FS ATA+++  ++Q   L
Sbjct:  245 SFEGEPEEKRRKTTNVV--IDQPATENKVLIDNVPDNSSLLEETQEWPLESFCEELCNDLFNPSWEIRHGAGTGLREVLKCHGT----GGGKLVGSTSEQLAQQHQEWMEDLVIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVALRHMTDSGVAMTVDVLLKLLTEDQWEVRHGGLLGIKYALAVRQNLISELLPRVLPAITEGLQ-DLDDDVRAVAAAALIPVV----DGLVHLQPAKVPFIVNTLWDALLELDDLTAS--TNSIMTLLSSL-----LTYPQVLQCSMQ----QSLTVLVPRV-WPFLRHTIASVRRAALETLFTLL-SKADQSGAVWLNPILQDMLRHIFQSCILESNQEILDLIQKVWGELLRQAPQQYVVAASCPWMGAWICLMMQASHIPI--------DLNMLLEVKARSKEKASGKPRQGGTQVKEAVQEYIGGADTITED--QGTRDYVVTRARLMAAKLLGALCRCICDPQLNSSTQEIRPAESLAQLLLFHLNSKSALQRIAVAMVLCEWAFVQ-------NECEIVSSVVQPRLLAILSEQLYYDEIAIPFTRMQNECKQLISLLADAHIDVRERINSSV----------FTIDQANELVT------------TIFSDATASLNLKSRQFQPL 839          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Cavefish
Match: btaf1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:103037828])

HSP 1 Score: 524.628 bits (1350), Expect = 1.555e-154
Identity = 305/665 (45.86%), Postives = 434/665 (65.26%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTP--ARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY---------SRAPSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFV--ELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMN 5314
            GAIE +  V       ++PY   I ++++PV L  ++ P D +R +AT  F+ L+ LLPLE+   D   ++    RQ+ R++H  FL+ LL+ + +  Y     +  A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG++         ++A  +CP PS++VCPPTLT HW  E  KF       N + Y G P  R  + + + ++ +V+ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C +SPLQ++LY    +S+A    D V    V +  +E   +    H FQ + YLR +CNHP+L LT  HP ++ +  +L++ +  L DI  + KL AL+QL+LDCG+G   AG  +    +VVA +R+L+FCQ   M+++V++ +++ ++P  T+LRLDGSVPA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S+DN+ + SM T+ +L +  
Sbjct: 1120 GAIEAMACVMEQLDVDIVPY---IVLLVVPV-LGRMSDPSDSVRFMATQCFATLIRLLPLEAGIPDPPSMSDDLIRQKARERH--FLEQLLDGRKLENYKIPVPI-KAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHYLRAQEYTKTKAADSCPLPSIVVCPPTLTGHWVDEVGKFCTK-EYLNPLHYTGPPTERARLQHQVKKHNLVVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAIKQLAANYRVILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDAKSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCNLSPLQVQLYEDFAKSRAKVSVDDVISTAVKEEEEEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEHKRISEQLSSQHSSLRDIQHAPKLSALKQLLLDCGLG--SAGSSDGGTEAVVAQHRVLIFCQLKSMLDIVEQDLLKPQLPSVTYLRLDGSVPAGLRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTVISQDNSSLQSMGTDQLLNLFT 1755          

HSP 2 Score: 141.354 bits (355), Expect = 6.088e-33
Identity = 107/277 (38.63%), Postives = 159/277 (57.40%), Query Frame = 2
Query:  593 SMENSPKKPVKRPHEEVQDVNEPGTKMKC-VEKI-GNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANI--SSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERL 1411
            S E  P++  ++    V  +++P T+ K  ++ +  N +  E   EWP   FCEEL  +L++  WEIRHGA T LRE+++  G+        +  S++++ A  H+ + E++V+RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV   H+T   V +  + LL LL  D+W V HG LLG+KY LA R +L+  LLP +   I+  L+ + DDDVR  A AAL+P+        V +   ++  +   LWD L    D T S  T +++ LL  L
Sbjct:  245 SFEGEPEEKRRKTTNVV--IDQPATENKVLIDNVPDNSSLLEETQEWPLESFCEELCNDLFNPSWEIRHGAGTGLREVLKCHGT----GGGKLVGSTSEQLAQQHQEWMEDLVIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVALRHMTDSGVAMTVDVLLKLLTEDQWEVRHGGLLGIKYALAVRQNLISELLPRVLPAITEGLQ-DLDDDVRAVAAAALIPVV----DGLVHLQPAKVPFIVNTLWDALLELDDLTAS--TNSIMTLLSSL 508          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Cavefish
Match: btaf1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:103037828])

HSP 1 Score: 520.39 bits (1339), Expect = 3.106e-153
Identity = 298/658 (45.29%), Postives = 424/658 (64.44%), Query Frame = 2
Query: 3584 RQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY---------SRAPSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFV--ELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMN-KEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            RQ+ R++H  FL+ LL+ + +  Y     +  A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG++         ++A  +CP PS++VCPPTLT HW  E  KF       N + Y G P  R  + + + ++ +V+ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A +R++L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C +SPLQ++LY    +S+A    D V    V +  +E   +    H FQ + YLR +CNHP+L LT  HP ++ +  +L++ +  L DI  + KL AL+QL+LDCG+G   AG  +    +VVA +R+L+FCQ   M+++V++ +++ ++P  T+LRLDGSVPA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+S+DN+ + SM T+ +L +    + +   +S  AS++GK  + S + G     LG                ++D   +Y+ EY+LDSF+
Sbjct: 1138 RQKARERH--FLEQLLDGRKLENYKIPVPI-KAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHYLRAQEYTKTKAADSCPLPSIVVCPPTLTGHWVDEVGKFCTK-EYLNPLHYTGPPTERARLQHQVKKHNLVVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHVIKNGKTKLSKAIKQLAANYRVILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDAKSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCNLSPLQVQLYEDFAKSRAKVSVDDVISTAVKEEEEEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEHKRISEQLSSQHSSLRDIQHAPKLSALKQLLLDCGLG--SAGSSDGGTEAVVAQHRVLIFCQLKSMLDIVEQDLLKPQLPSVTYLRLDGSVPAGLRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTVISQDNSSLQSMGTDQLLNLFTLDKDDKAEKSEVASSSGKASMKSVLDG-----LGD---------------LWD-QQQYEAEYDLDSFM 1749          

HSP 2 Score: 153.68 bits (387), Expect = 1.238e-36
Identity = 224/811 (27.62%), Postives = 354/811 (43.65%), Query Frame = 2
Query:  191 ISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLW--VPGTSESNVTNVSNLINLE-------NLNLHDILKIGTRLYSRDFKDLD---EANTNQNINRDELARHLGFLI-----PDECEIKNLITVKDCELVESKSENKMSVELAVMKSMENSPKKPVKRPHEEVQDVNEPGTKMKCVEKIGNETERERNTEWPWVDFCE----ELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANI--SSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYS-DLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFIFHEAGIRNILI---SIIAQI---HLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSL--SPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLILIYIEREIPLPPSIMNAVGPNASPVSIALNISQCQSLISSEMCSLCPPESMTTFSCATAAVDTCAQQHATL 2527
            ++ LLAK+L Y +   W  RIAA  AV  I  N   W   P   E  V     L            L++   + + T     D +DLD    +N N+         H   LI     P     +     +  +LV  +    +        S E  P++  ++    V  +++P T+ K +  I N  +     E    + CE    E    +     +IRHGA T LRE+++  G+        +  S++++ A  H+ + E++V+RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV   H+T   V +  + LL LL  D+W V HG LLG+KY LA R +L+  LLP +   I+  L+ + DDDVR  A AAL+P+        V +   ++  +   LWD L    D T S  T +++ LL  L     + Y Q     M     ++L   + R+ W +  ++   VR AA+ T   +L S   + G +  +  +  +L  + Q  +++ N ++      VW + +   P+Q +   SC  +  W+C  MQ + +          D  +     A +     G     G +     + YIGG ++   D     RD +V RARL A +LL  LC+     +       I     +AQ+   HL  + A+QR   +M+L  W           N+C +  S +Q +LL  L E +YY EI   F +M   C+ LI +  +  I +   I ++V            I Q   L++            T FS ATA+++  ++Q   L
Sbjct:   40 LNNLLAKVLLYLRSPNWDTRIAAGQAVEAIVKNIPEWNPSPKPKEGEVDPKERLARQRKLLQKKLGLDMGAAIGMDTEELFND-EDLDYTCASNANRCKQPTSSLWHAAELIDSEFRPGMSNRQRNKAKRMAKLVAKQRSRDLDPNEKSNDSFEGEPEEKRRKTTNVV--IDQPATENKVL--IDNVPDNSSLLE----EVCEHNMSEFKTRVCIFGLQIRHGAGTGLREVLKCHGT----GGGKLVGSTSEQLAQQHQEWMEDLVIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVALRHMTDSGVAMTVDVLLKLLTEDQWEVRHGGLLGIKYALAVRQNLISELLPRVLPAITEGLQ-DLDDDVRAVAAAALIPVV----DGLVHLQPAKVPFIVNTLWDALLELDDLTAS--TNSIMTLLSSL-----LTYPQVLQCSMQ----QSLTVLVPRV-WPFLRHTIASVRRAALETLFTLL-SKADQSGAVWLNPILQDMLRHIFQSCILESNQEILDLIQKVWGELLRQAPQQYVVAASCPWMGAWICLMMQASHIPI--------DLNMLLEVKARSKEKASGKPRQGGTQVKEAVQEYIGGADTITED--QGTRDYVVTRARLMAAKLLGALCRCICDPQLNSSTQEIRPAESLAQLLLFHLNSKSALQRIAVAMVLCEWAFVQ-------NECEIVSSVVQPRLLAILSEQLYYDEIAIPFTRMQNECKQLISLLADAHIDVRERINSSV----------FTIDQANELVT------------TIFSDATASLNLKSRQFQPL 780          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Cavefish
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 229.18 bits (583), Expect = 7.043e-60
Identity = 185/591 (31.30%), Postives = 285/591 (48.22%), Query Frame = 2
Query: 3683 KLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-EYSRAPSTCP--------PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMY----RQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQE--LPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQL 5410
            KL +YQ+ GV W+  L+     G+L D+MGLGKT+Q I  +AG  YS+  +           P++IVCP T+   W +EF  +    P F   V   T  +     + I    + + ++ITSY  +R   + + +                     W+YV+LDEGH IRN  + V VA +     HR +L+G+P+QN + ELWSLFDF+ PG LGT   F  ++   +   G ++   V  +       +L   + P++LRR+K DV     LP K  Q   C ++  Q ++Y   ++S+                    +N     F  +  LR +CNHP L  +    L + +  E  +  +       SGKL+ +  L+                       +R+L+F QS +M+E+++  +R      + L++DG+     RQ ++ +++ D  I + LLTT +GGLG+NLT AN VI  + DWNP  D QA +RA RIGQK  V VYRL+TA +IEEKI + Q FK+FL N V+ KD  Q     + +I E+        T S P  + G +        G++ Q+
Sbjct:  484 KLFKYQQTGVRWMWELHCQQAGGILGDEMGLGKTIQVIAFLAGLSYSKLRTRGSNYRYAGLGPTVIVCPATVMHQWVKEFHTWW---PPFRVAVLHETGSFTSKREKLIPEIAAGHGILITSYSYVRIMQDYIQKYD-------------------WHYVILDEGHKIRNPNAGVTVACKQFRTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVQTAYKCACVLRDSINPYLLRRMKADVKANLALPDKSEQVLFCRLTEDQRKVYQDFLDSKEVYQI---------------LNGDMQVFSGLIALRKICNHPDL-FSGGPRLLKGVPEEELSEEEHFGYWKRSGKLIVVESLL----------------RLWYKQGHRVLLFTQSRQMLEILEVFVRGN--GYSFLKMDGTTTIASRQPLIARYNED--IFVFLLTTKVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQKQQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVL-KDPKQRRFFKSNDIYELF-------TLSSPDGSQGTETSAIFAGTGSDVQI 1008          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Cavefish
Match: ENSAMXT00000011579.2 (pep primary_assembly:Astyanax_mexicanus-2.0:13:20062390:20090563:-1 gene:ENSAMXG00000011238.2 transcript:ENSAMXT00000011579.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.254 bits (578), Expect = 2.054e-59
Identity = 177/542 (32.66%), Postives = 279/542 (51.48%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIA--GEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANN---QCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASN-RLLVFCQSIKMMELVDKMI--RNEIPKATHLRLDGSVPAKDRQQIVEKFS-CDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVV 5254
            +++ +L+QYQ +G+ WL  L    L+G+LAD+MGLGKT+Q I +I    EY R      P LI+ P +   +W  EF K+    P    + Y G+P  R+     L   ++ V++T+Y+ +  D  +LA+                     W Y+++DEGH ++N+  K+  V      A  R++LTGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G KVD   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ  LY H M+++    TD  E   K       +        T+  LR +CNHP +       +  +    L  +    Q  D    SGK   L +++                   + A+N ++L+FCQ   +M +++     RN      +LRLDG+  A+DR  +++ F+  ++   I LL+T  GGLGLNL SA+ V+  + DWNP +DLQA DRAHRIGQ++ V V RL T  S+EEKI+   ++K  +   V+
Sbjct:  686 LINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEYKRLNG---PYLIIVPLSTLSNWVYEFDKWA---PSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKQVLAKIR-------------------WKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPF----AMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRH-MQAKGVLLTDGSEKDKKGKGGTKTL------MNTIMQLRKICNHPYM----FQQIEESFSEHLGFSGGIVQGADLYRASGKFEVLDRIL-----------------PKLRATNHKVLLFCQMTTLMTIMEDYFAYRN----FKYLRLDGTTKAEDRGMLLKTFNDPESQYFIFLLSTRAGGLGLNLQSADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVI 1166          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Sea Lamprey
Match: btaf1 (BTAF1 RNA polymerase II, B-TFIID transcription factor-associated [Source:ZFIN;Acc:ZDB-GENE-021025-1])

HSP 1 Score: 511.916 bits (1317), Expect = 1.714e-150
Identity = 327/734 (44.55%), Postives = 451/734 (61.44%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-------EYSR---APSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDF-NTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNV-WNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHR---HGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEE-ELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GAIE +  V  +    ++PY   + ++++PV +  ++     +R +AT  F+ L+ L+PLE+   D   ++     Q+ +   FL+ LL+   +  Y A    + A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG       EY R   A     PS++VCPPTLT HW  E  KF     +F N + Y G P  R  +   +  + +V+ SYD +R+D++                       N+ WNY +LDEGH+I+N K+K++ A + L A HRL+L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C++SPLQ+RLY     SQA  D D      K   E S   + +   H FQ + YLR +CNHP+L LT  HP ++ +  ELA +   L DI  + KL AL+QL+LDCG+G  G     +    +VVA +R+L+FCQ   M+++V+  ++R ++P  T+LRLDGSVPA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V+++DN  + SM TE +L++   E             G     +  SGG   +   KSVL  +        ++D  ++YD EYNLDSF+
Sbjct: 1156 GAIEALACVMDALDVDIVPY---MVLLVVPV-MGRMSDQTGSVRLMATQCFATLIRLMPLEAGIPDPPFMSQELASQKVRERHFLEQLLDGSKLDNY-AIPVPIHAELRKYQQDGVNWLSFLNKYKLHGILCDDMGLGKTLQSICILAGDHYLRAQEYERTQAADCATLPSMVVCPPTLTGHWVDEVHKFCPR--EFLNPLHYTGPPSERIRLQRYIKNHNLVVASYDVVRNDIDFF--------------------KNIKWNYCILDEGHMIKNGKTKLSKAVKQLTANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEHQFAARYGKPILASRDARSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCSLSPLQVRLYEDFARSQAKHDLDDTISSGKLSSEPSDKTKLKATGHVFQALQYLRKLCNHPALVLTLQHPEFQRICEELATHGSSLRDIQHAPKLSALKQLLLDCGLGGGGGAGGVDSGPEAVVAQHRVLIFCQLKSMLDMVENDLLRPQLPAVTYLRLDGSVPAGQRHSIVARFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKLSIANTVINQDNASLQSMGTEQLLDLFTLE-----------KQGGLSEDAPSSGGASKKETIKSVLENLGD------LWD-QEQYDSEYNLDSFI 1844          

HSP 2 Score: 186.422 bits (472), Expect = 2.282e-47
Identity = 222/827 (26.84%), Postives = 357/827 (43.17%), Query Frame = 2
Query:   89 RLDKLFELLESNHQNI-RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVP---------GTSESNVTNVSNLINLENLNLHDILKIGTRLYSRDFKDLD-EANTNQNINRDE--------LARHLGFLIPDECEIKNLITVKDCELVESKSENKMS----------VELAVMKSMENSPKKPVKR--------PHEEVQDV--------NEPGTKMKCV--------EKIGNETERERN------TEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQG-SIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNY-SDLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFIFHEAGIRNILI---SIIAQI---HLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSLSPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLILIYIEREIPLPPSIMNAV 2368
            RLD+LF LL++    + R AAA Q+G++   +   +  LLAK++ Y +   W  RIAA  AV  I  N   W P            +S  +   + +     ++  +LK G  L      + D + + + N++  E        L + LG  +     +       D +L  S S    +          +E      M N  K   KR           E  DV         EP  K + V        +K+  ET  E +       EWP+  FCEEL  +L+   WE+RHGAAT LRE++++ G S   P +A +   ++    H+++ E++ +RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV+  H+    V      LL LL  ++W V HG LLGLKY LA R DL+E LLP     +   L+   DD    AA A +         + V +  E++  +   LWD L    D T S  T +++ LL  L     V  N  +         ++    + R+ W +  + S  VR AA+ T   +L +   +  ++     +  ++  + Q  +++ +  +      VW + +   P Q +   +C  +  W+C  MQP+ +   P  ++            A       +    G     +   YI G E+   D +S  RD  V+R RL   +LL  L          + +  I     +AQ+   +L  + A+QR   S++++ W  DH      ++D     ++ +L   L E +YY EI   F +M   C+ L+ + +E    + P + +AV
Sbjct:    5 RLDRLFILLDTGTTPVTRKAAAQQLGEVQRLHPHELHNLLAKVITYLRSPNWDTRIAAGQAVEAIARNVPEWNPLPKSKLEGEQGRQSPDSQDDDRLAFRRFDIARLLKHGASLLGSTGAEFDVQDDKSGNVDPKERIARQRKLLQKKLGLDVGSALGMNTHELFDDDDLNASSSSTNHTKPQPFNAVEIMESEFAHGMSNRQKNKAKRMAKLHAKQRSRENADVATTSDTVDGEPDEKKRKVAVEVPIVEDKVLLETLPENSCLFEEMNEWPFESFCEELCNDLFSPSWEVRHGAATGLREVLKAHGPSGGKPADATLEEIEE---QHQQWLEDLAIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVVLRHMRAEGVLGATRVLLQLLGQEQWEVRHGGLLGLKYTLAVRQDLIEALLPRTLPVVIEGLQDMDDDVRAVAAAALVP-----VVESLVQLHPEKIPVIMNTLWDSLLELDDLTAS--TNSIMTLLSSLLIYPAVRLNSMQ---------QSFTVLVPRV-WPFLRHNSSSVRKAALETLNTILSTQDSQSCSLWLTPILQDMMRFIYQVAILESSQDICYLVQKVWQELLAKAPLQYIVAAACPWMGAWLCLMMQPSHMPIDPNMLM---------ETRARAKDKCNVKARPGQPVREVRHEYIAGSETVHEDPTS--RDYHVMRTRLLNARLLGALSCCISHPSVNLASQEIRPAESLAQLLLFYLNSKSALQRIAVSLVISEW-ADHKQDCTTVSDA----VRPRLQAVLSEQLYYDEIAVPFTRMQTECKQLVSVLLEGGCDVRPRLASAV 795          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Sea Lamprey
Match: SMARCA2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:HGNC Symbol;Acc:HGNC:11098])

HSP 1 Score: 224.557 bits (571), Expect = 4.414e-59
Identity = 176/539 (32.65%), Postives = 277/539 (51.39%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIA--GEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANN---QCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFS-CDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVV 5254
            +V+  L+ YQ +G+ WL  L    L+G+LAD+MGLGKT+Q I +I    E+ R      P LI+ P +   +W  EF K+    P    I Y G+P+ R+     L   ++ V++T+Y+ +  D ++LA+                     W Y+++DEGH ++N+  K+  V      A  RL+LTGTP+QN++ ELW+L +FL+P +  +C+ F + +        + +G KVD   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ  LY H M+++    TD  E   K       +        T+  LR + NHP +     H +  +    L   N   Q  D    SGK   L +++                    V+++R+L+FCQ   +M +++           +LRLDG+  ++DR  +++ F+  ++   I LL+T  GGLGLNL +A+ VI  + DWNP +DLQA DRAHRIGQ++ V V RL T  S+EEKI+   ++K  +   V+
Sbjct:  731 LVNGSLKMYQVQGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNG---PFLIIVPLSTLSNWMMEFDKWG---PSVVKISYKGSPIARRAFMPQLRSGKFNVLLTTYEYIIKDKHVLAK-------------------LRWKYMIVDEGHRMKNHHCKLTQVLNTHYIAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPF----ALTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKVLYRH-MQAKGVLLTDGSEKDKKGKGGAKTL------MNTIVQLRKIANHPYM---FQH-IEESFAEHLGFPNSIVQGADLFRASGKFELLDRILPKL----------------RVSNHRVLLFCQMTSLMTIMEDYF--AFRSFRYLRLDGTTKSEDRSNLLKTFNEPNSPYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVI 1211          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 214.157 bits (544), Expect = 1.362e-58
Identity = 174/541 (32.16%), Postives = 267/541 (49.35%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYR----QCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHG-FQTMHYLRLVCNHPSL--GLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK--MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSC-DAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSK 5260
            V    +R YQ  G+NWL  L   G++G+LAD+MGLGKTLQ I ++   Y +     P P +++ P +   +W  EF++++   P    +  +G   +R    Q I   +  + V +TSY+ +                  + + S+    N W Y+V+DE H I+N KSK++   R     +RL+LTGTP+QN + ELWSL +FL+P +  +   F   +    + N     +++        +E LH  + PF+LRR+K DV + LPPK        +S +Q   YT  +      D D +         NSA    +      +  LR  CNHP L  G     P   T    +  N         SGK+V L +L+             +L E      +R+L+F Q  +MM++++   M R       + RLDG  P +DRQ  +  F+  D+S  + +L+T  GGLG+NL +A++VI  + DWNP  DLQAMDRAHRIGQK  V V+R IT  ++E++I+   E K  L + V+ +
Sbjct:  107 VKCGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLG--YMKHYRNIPGPHMVLVPKSTLHNWMAEFERWV---PSLRAVCLIGDKDHRVSASQPIVPPIE-WDVCVTSYEMI------------------IREKSVFKKFN-WRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADTFTSWF----DTNNCFGDQQL--------VERLHMVLRPFLLRRIKADVEKSLPPKKECKIYIGLSKMQREWYTKIL----MKDIDIL---------NSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPY--TTDTHIVIN---------SGKMVVLDKLL------------PKLHE----QGSRVLIFSQMTRMMDILEDYCMWRG----YEYCRLDGQTPHEDRQVSIASFNAPDSSKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKVVRVFRFITESTVEDRIVERAEMKLRLDSIVIQQ 566          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Sea Lamprey
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 208.764 bits (530), Expect = 3.591e-56
Identity = 182/570 (31.93%), Postives = 275/570 (48.25%), Query Frame = 2
Query: 3683 KLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIV------YLGTPMYRQC-IFNSLSRYQV---------VITSYDTLRSDMNLL-------ARPTFPRCGTDVTKGSLMA--NSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQEL--PPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIM 5311
            KL +YQ+ GV WL  L+     G+L D+MGLGKT+Q I  +AG   R      PSL+VCP T+   W +EF  +    P F   V      Y G    R+   F S S Y           V+ + D + + M+ +       A  T  RC    T+  ++A    + W        H  RN  +K+          HR++L+G+P+QN + ELWSLFDF+ PG LGT   F  ++   + Q G ++   V  +       +L   + PF+LRR+K DV   L  P K  Q        ++  L  +   SQ      + + +D S +    +N+ R  F  +  LR +CNHP L           L   L A +        SGKL+ +                E L        +R+L+F QS +M+++++K ++ E    +++++DG+     RQ +++KF+ D S+ + LLTT +GG+G+NLT AN VI  + DWNP  D QA +RA RIGQ   V +YRL++A +IEEKI + Q FK+FL N V+ KD  Q       ++ E+ 
Sbjct:   14 KLYKYQQTGVQWLWELHVKQAGGILGDEMGLGKTVQIIAFLAGLSHRYEG-LGPSLVVCPTTVMHQWVREFHTWW---PQFRVAVLHESGSYSGKKKVRRARFFYSYSTYSRAPLWKRPPPVLRASDGVAAIMHNMYIMFGGQASQTTFRC-LQFTRMLIIAIVFRSKWTCPRRAAHHPCRNADNKIFPNCFMFRTPHRIILSGSPVQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITQGGYSNASDVQVQTAYKCACVLRDTIKPFLLRRMKADVKVNLALPDKNEQ--------VKALLKYNFQRSQV-----YQKFLD-SREVQQVLNRERQVFTALITLRKICNHPDL-----------LTGGLNAEDDGFGYWRRSGKLLVV----------------EALLRMWRRQGHRVLLFTQSRQMLDILEKFVQGE--GYSYMKMDGTTSIATRQPLIDKFNKDESMFMFLLTTHVGGIGVNLTGANRVIIFDPDWNPSTDTQARERAWRIGQLRQVTIYRLVSAGTIEEKIYHRQIFKQFLTNRVL-KDPRQQRFFKANDLFELF 534          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Sea Lamprey
Match: ercc6l (excision repair cross-complementation group 6-like [Source:NCBI gene;Acc:100005291])

HSP 1 Score: 207.608 bits (527), Expect = 2.323e-55
Identity = 190/598 (31.77%), Postives = 290/598 (48.49%), Query Frame = 2
Query: 3653 YNAHHSVVSAKLRQYQEEGVNWLGFL---NRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQ-VVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPG-LLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLAL-----ELLHRQVLPFMLRRVKDDVL-QELPPKIMQD-----------------YMCTMS---PLQLRLYTHCMESQAATD----TDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHP---------SLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVP-AKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIM 5311
            +N +H +   +L  +Q EGV WL  L    R G  G+LADDMGLGKT+Q I  ++G +    S     L+V P TL   W  EF K+    P      + GT   R      + R Q VVITSY  L ++ + L+              +      +W+ ++LDEGH I+   +K A +  A+ A  R++LTGTP+QN + E+W+LFDF+  G LLGT   F   Y     +N     R+ D+  G  AL     E L   + P+ LRR K +V  +EL  K ++D                  M T++    L + +Y   ++ Q   D     D  EL+D +          R     +  L+ +C HP          LGL +    +R +  E   +N  L  I    K V  + LI + G      G   L E      +R LVF QS+KM++++D +++++  K   +R+DG++    +R++ V+ F  D++ ++ LLTT +GG+GL LT+AN V+ ++  WNP  D QA+DRA+RIGQ   VI+YRL+T  ++EEKI   Q FK+ L         N     + + + E+ 
Sbjct:   88 FNLYHEL-HNQLYSHQLEGVAWLYNLFKNKRKG--GILADDMGLGKTIQVISFLSGMFD--ASLFGHVLLVMPTTLMSIWISEFDKWA---PGITIREFYGTKSERTRNLQKVQRTQGVVITSYQLLVNNWHELS--------------TYQGQEFIWDAMILDEGHKIKTSSTKTAKSAHAIPAHFRMILTGTPVQNNLKEIWALFDFVCEGSLLGTSKTFKMEY-----ENPITKARQKDATVGEKALGTRMAENLQELIGPYFLRRTKAEVQSKELHAKQLRDNKENDPTVGNLDQRIQIEMPTLTRKNDLIVWVYLSPVQEQIYRDFQNLDDIKELLDST----------RSPLVALGILKKICVHPRLLPERACAQLGLITCEFFFR-IESEGLQSNWFLSSI----KNVPPKTLIEESGKLTFLIG---LLERLRQEGHRTLVFSQSLKMLDIIDHILKHQGFKV--MRIDGTITHITEREKRVQTFQKDSAFNVFLLTTQVGGVGLTLTAANRVVILDPSWNPATDAQAVDRAYRIGQTDNVIIYRLVTCGTMEEKIYRRQIFKESLIRQTTGDKKNPFRYFSQQELRELF 638          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Yeast
Match: MOT1 (Essential protein involved in regulation of transcription; removes Spt15p (TBP) from DNA via its C-terminal ATPase activity; may have a role in ensuring that soluble TBP is available to bind TATA-less promoters; forms a complex with TBP that binds TATA DNA with high affinity but with altered specificity; the Mot1p-Spt15p-DNA ternary complex contains unbent DNA; coregulates transcription with Spt16p through assembly of preinitiation complex and organization of nucleosomes [Source:SGD;Acc:S000006003])

HSP 1 Score: 508.834 bits (1309), Expect = 1.955e-149
Identity = 308/740 (41.62%), Postives = 449/740 (60.68%), Query Frame = 2
Query: 3374 GAIELIY---LVCHSGLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG---------EYSRA-PSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETS----------VVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGE--RVYDCLDEYDQEYNLDSFV 5515
            G+ ELIY   L   + +LPY   +  +I+P+ L  ++   + +R +AT  F+ ++ L+PLE+  AD   L       R++   F+  +++P     +    ++  A LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ IC+IA          E +R+  S   PSLI+CPP+LT HW  EF ++    P    +VY G P  R  +   LS   +++TSYD  R+D+ +L                   N   +NY VLDEGH+I+N +SK+A A + + A HRL+LTGTPIQN V ELWSLFDFLMPG LGT   F  R+ + +  + ++     + EAG LALE LH+QVLPFMLRR+K+DVL +LPPKI+QDY C +  LQ +LY    + Q         +V+K  + +   +  +H FQ + Y+R +CNHP+L L+ +HP    +   L      L DI  + KL ALR L+ +CG+     GEE++D+ +          V++ +R L+FCQ   M+++V+  + +  +P  T++RLDGS+  +DRQ++V KF+ D SID LLLTT +GGLGLNLT A+ VIFVEHDWNPM DLQAMDRAHRIGQK  V VYR+IT  ++EEKIM LQ+FK  +A+ VV++ N+ +ASM+T  +L++ + + N  +Q      NG     S  + G E  + +++ L+  +K   GE   ++D   +Y++EYNLD+F+
Sbjct: 1170 GSTELIYHLSLSMETDVLPY---VIFLIVPL-LGRMSDSNEDVRNLATTTFASIIKLVPLEAGIADPKGLPEELVASRERERDFIQQMMDPSKAKPFKLPIAI-KATLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRKEDYEKTRSVESRALPSLIICPPSLTGHWENEFDQYA---PFLKVVVYAGGPTVRLTLRPQLSDADIIVTSYDVARNDLAVL-------------------NKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANHRLILTGTPIQNNVLELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELGDLQKQLYMDFTKKQK-------NVVEKDIENSEIADGKQHIFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGLDLHDIINAPKLSALRTLLFECGI-----GEEDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLDMVENDLFKKYMPSVTYMRLDGSIDPRDRQKVVRKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLFDPD-NVTSQDNEEKNNGD----SQAAKGME-DIANETGLTGKAKEALGELKELWDP-SQYEEEYNLDTFI 1863          

HSP 2 Score: 95.1301 bits (235), Expect = 8.446e-20
Identity = 141/556 (25.36%), Postives = 231/556 (41.55%), Query Frame = 2
Query:   86 SRLDKLFELLESNH-QNIRNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLW-------VPGTS---------------------ESNVTNVSNLI-------NLENLNLHDILKIGTRLYSRDFKDLD-----EANTNQNINRDELARHLGFLIPDECEIKNLITVKDCELVESKSENKMSVELAVMK------SMENSPKKPVKRPHEEVQDV--------------------NEPGTKMKCVEK--------------IGNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDE---------WRVNHXXXXXXXXXXXXRMD------LVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERL---YEKCNVVYNQSEDQP 1456
            SRLD+   L+E+   Q +RN AA Q+G L+  +  +I +LL+++ P+   K W  R+ A+ AV  I  +A  W       V GT+                     E+   N  NL+       +L +  L++ILK G  L +    D +     + N  +    D++ +    L   +   +N             + NK S  +  M       S +N+PK PV      V                       N+   K++  E+              +  + E      W +    E LL NL    WEIRHGAA  LREL++     +     N    +     + R  E++  RLL    LD+  D+V D +VAPVRES AQ L  + +HL   L   + N L  L+  D          W   HG LLG++Y ++ + +      L+E ++ I+   ++       DDDV+  A + L P+     S  V ++N  ++ L T +W +LA R+D   S +  +++ LL +L    E  +++ N++ + P
Sbjct:    6 SRLDRQVILIETGSTQVVRNMAADQMGDLAKQHPEDILSLLSRVYPFLLVKKWETRVTAARAVGGIVAHAPSWDPNESDLVGGTNEGSPLDNAQVKLEHEMKIKLEEATQNNQLNLLQEDHHLSSLSDWKLNEILKSGKVLLASSMNDYNVLGKADDNIRKQAKTDDIKQETSMLNASDKANEN-----------KSNANKKSARMLAMARRKKKMSAKNTPKHPVDITESSVSKTLLNGKNMTNSAASLATSPTSNQLNPKLEITEQADESKLMIESTVRPLLEQHEIVAGLVWQFQGIYELLLDNLMSENWEIRHGAALGLRELVKKHAYGVSRVKGNTREENNLR--NSRSLEDLASRLLTVFALDRFGDYVYDTVVAPVRESVAQTLAALLIHLDSTLSIKIFNCLEQLVLQDPLQTGLPNKIWEATHGGLLGIRYFVSIKTNFLFAHGLLENVVRIVLYGLN-----QSDDDVQSVAASILTPI----TSEFVKLNNSTIEILVTTIWSLLA-RLDDDISSSVGSIMDLLAKLCDHQEVLDILKNKALEHP 538          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 229.565 bits (584), Expect = 1.873e-61
Identity = 175/524 (33.40%), Postives = 268/524 (51.15%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL---SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHG----FQTMHYLRLVCNHPSL--GLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSC-DAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIM 5212
            V S KLR YQ +G+NWL  L+   L G+LAD+MGLGKTLQ I  + G          P LI+ P +   +W +EF K+    P+ N +V  G    R  I  ++   +R+ V+ITSY+ +  + N L R                     W Y+V+DE H I+N +S ++   R   +++RL++TGTP+QN + ELW+L +FL+P + G    F+  +    EQN S   +++        ++ LH  + PF+LRRVK DV + L PKI  +    M+ +Q++ Y   +E     D D V         N A+ + R G       +  LR  CNHP L  G     P   T    L  N         SGK++ L +L+            + L E      +R+L+F Q  +++++++           + R+DGS   ++R + +++++  ++   + LLTT  GGLG+NL +A+ VI  + DWNP  DLQAMDRAHRIGQK  V VYR +T  +IEEK++
Sbjct:  179 VKSGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFL-GYLRYVKQIEGPFLIIVPKSTLDNWRREFLKWT---PNVNVLVLHGDKDTRADIVRNIILEARFDVLITSYEMVIREKNALKRL-------------------AWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDIFGDSELFDEWF----EQNNSEQDQEI-------VIQQLHSVLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEK----DIDAV---------NGAVGK-REGKTRLLNIVMQLRKCCNHPYLFEGAEPGPPY--TTDEHLIFN---------SGKMIILDKLL------------KRLKE----KGSRVLIFSQMSRLLDILEDYCY--FRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVI 625          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Yeast
Match: RAD26 (Protein involved in transcription-coupled nucleotide excision repair; repairs UV-induced DNA lesions; recruitment to DNA lesions is dependent on an elongating RNA polymerase II; homolog of human CSB protein [Source:SGD;Acc:S000003796])

HSP 1 Score: 228.024 bits (580), Expect = 5.209e-61
Identity = 179/591 (30.29%), Postives = 278/591 (47.04%), Query Frame = 2
Query: 3596 RKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFK----------------------KFLVNLPDFNTIVYLGTP--MYRQCIFNSLSRYQVVITSY------DTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHY----LRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATH---LRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVS 5257
            R+ H +  D+ LN     Q+     + S  L  YQ+  V WL  L +    G++ D+MGLGKT+Q I  IA  +     T P  LIVCP T+   W  EF+                      KF ++  D   ++    P     +   NS    + + +SY      D + +D ++L   T+   G  +    L+     W Y VLDEGH IRN  S++++  + L   +R++L+GTPIQN + ELWSLFDF+ PG LGT   F +++   +   G  +   +  + G      L   + P++LRRVK DV ++LP K      C ++  Q   Y   + S                   S +NQ ++G + + +    LR +CNHP L           L R+   +N    D   SGK+  ++QL+L                       + L+F QS +M++++++ I  + P  +H   LR+DG+   K RQ +V++F+ ++    LL T   G       +  I+IF + DWNP  D+QA +RA RIGQK  V +YRL+   SIEEKI + Q FK+FL N +++
Sbjct:  272 RRPHPNIPDAKLN----SQFKIPGEIYSL-LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHSGLLTGPV-LIVCPATVMKQWCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVVTDGHILI-TTY--VGLRIHSDKLLKVK--WQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLEFLHS-------------------SDLNQIQNGKRNVLFGIDILRKICNHPDL-----------LDRDTKRHNPDYGDPKRSGKMQVVKQLLL----------------LWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTNIKGRQSLVDRFNNESFDVFLLTTRVGGLGVNLTGANRIIIF-DPDWNPSTDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILT 804          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Yeast
Match: SNF2 (Catalytic subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; contains DNA-stimulated ATPase activity; functions interdependently in transcriptional activation with Snf5p and Snf6p [Source:SGD;Acc:S000005816])

HSP 1 Score: 219.164 bits (557), Expect = 1.518e-57
Identity = 163/553 (29.48%), Postives = 285/553 (51.54%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRA-LCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQT-MHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDI-NLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSC-DAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVV---SKDNNQMASMNTENIL 5302
            +V   L+ YQ +G+ W+  L    L+G+LAD+MGLGKT+Q I ++   Y    +   P L++ P +   +W  EF K+    P   TI + G+P  R+     +    + VV+T+++ +  +  LL++                     W ++++DEGH ++N +SK+++       A +RL+LTGTP+QN + ELW+L +F++P +  +   F+  +       G     ++  E   L +  LH+ + PF+LRR+K DV +ELP K+ +   C MS LQ  +Y   ++ +       + + D++ K+   +     GF   +  L+ +CNHP         ++  +  ++    +  DDI  ++GK   L +++    +  +G              +R+L+F Q  ++M++++  +R       +LRLDG   + +R +++  F+  D+     +L+T  GGLGLNL +A+ VI  + DWNP +DLQA DRAHRIGQK+ V + RLIT  S+EE I+  + +KK   +  V    K +N+  S   E +L
Sbjct:  762 LVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYE-MKNIRGPYLVIVPLSTLSNWSSEFAKWA---PTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVK-------------------WVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRR------LFIGDQNNKKMVGL----RGFNNQIMQLKKICNHPF--------VFEEVEDQINPTRETNDDIWRVAGKFELLDRIL--PKLKATG--------------HRVLIFFQMTQIMDIMEDFLR--YINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILE-RAYKKLDIDGKVIQAGKFDNKSTSEEQEALL 1254          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Yeast
Match: IRC5 (Putative ATPase containing the DEAD/H helicase-related sequence motif; null mutant displays increased levels of spontaneous Rad52p foci; SWAT-GFP and mCherry fusion proteins localize to the nucleus [Source:SGD;Acc:S000001934])

HSP 1 Score: 210.69 bits (535), Expect = 2.829e-56
Identity = 179/573 (31.24%), Postives = 279/573 (48.69%), Query Frame = 2
Query: 3686 LRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQ------CIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNR--RYGRVLEQNGSNS---GRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQE-LPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSS---HPLYRTL--MRELAANNQCLDDIN--LSGKLVALRQLI-----------------LDCGVGVSGAGE--EELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKF-SCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMN 5287
            L+ YQ EG+NWL  L   GL+G+LAD+MGLGKT+Q+I ++A  Y     T  P L+  P +   +W  EF KF    PD   + Y GT  Y++        F       +VITSY+ +  D +L+                    S  W ++++DEGH ++N   ++    + +   +RL+LTGTP+QN + ELWSL +F+MP +      FN+   +  +   +GSNS    + ++ E     +  LH  + PF+LRR+K  VL   LPPK      C M+  Q + Y   +  +    T F EL+    K+   +N    G  +   +R   N+   G  +S   + +  TL  M +L   N  ++  N  L   ++ LRQ+I                 L+  +  SG  +  ++L    +   +++L++ Q + M++L++     ++      R+DGSV  + R+  +EKF S     +I LL+T   GLG+NL  A+ V+  + DWNP  DLQAMDR HRIGQ+  VIVYRL    +IE  I+     K+ L   V+     QM   N
Sbjct:  222 LKPYQLEGLNWLITLYENGLNGILADEMGLGKTVQSIALLAFIYEM--DTKGPFLVTAPLSTLDNWMNEFAKFA---PDLPVLKYYGTNGYKERSAKLKNFFKQHGGTGIVITSYEIILRDTDLIM-------------------SQNWKFLIVDEGHRLKNINCRLIKELKKINTSNRLLLTGTPLQNNLAELWSLLNFIMPDIFADFEIFNKWFDFDSLNLGSGSNSEALNKLINDELQKNLISNLHTILKPFLLRRLKKVVLANILPPKREYIINCPMTSAQEKFYKAGLNGKLKK-TMFKELI----KDFFTLNDEYIGHVSNRSIRDFINYKLSGNETSNTDNKINPTLLQMDKLYKKNLQMEISNKKLQNMMMQLRQIIDSTFLFYFPYLHPEDLTLETLLKTSGKLQILQKLIPPLISEGHKVLIYSQFVNMLDLIEDWC--DLNSFATFRIDGSVNNETRKDQLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQESPVIVYRLCCDNTIEHVILTRAANKRNLERMVI-----QMGKFN 758          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Nematostella
Match: EDO38021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE43])

HSP 1 Score: 503.056 bits (1294), Expect = 4.305e-147
Identity = 304/703 (43.24%), Postives = 432/703 (61.45%), Query Frame = 2
Query: 3458 VLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG----------EYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFD--FLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQA--ATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK-MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEI--MNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            +L  ++   + +R +AT+ F+ L++L+PLE    D   +  +  +Q++   +FL+ LL+ K +  Y     +  A+LR+YQ++GVNWL FL++Y LHG+L DDMGLGKTLQ+IC++A           E   A     PSL++CPPTLT HW  E +KF++       + Y G PM RQ + N +  + +++ SYD +R+D +                      S  WNY +LDEGH+I+N K+K+A   + L A HRL+L+GTPIQN V ELWSL    + +P +L   T F       L Q+        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C +SPLQ++LY    +SQA    +  F    D   KE ++     H FQ + YLR VCNHP L LT  HP +  +M++L    Q L DI+ + KLVAL+QL+LDCG+GVS +   +L    VV+ +R+L+FCQ   M+++V+  + +  +P  T+LRLDGS PA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ VIFVEHDWNPM+DLQAMDRAHRIGQK  V VYRL+T  ++EEKIM LQ+FK  +AN V+S+DN+ +++M+T  + ++  ++KE     Q   A  N K+K+  SV    E                 GE ++D  ++Y+ EYNLD+F+
Sbjct: 1207 ILGRMSDQTEDVRLLATNCFATLISLMPLEKGVPDPPDMPASLVEQKQIERTFLEQLLDSKKLQNYTISIPI-KAELRKYQQDGVNWLAFLSKYKLHGILCDDMGLGKTLQSICIMASDHHYKLQKYKETGHADCKPLPSLVICPPTLTGHWVYEVEKFVIK-EYLKPLHYTGPPMERQRLRNKVKNHNLIVASYDIVRNDGDFF-------------------KSIHWNYCILDEGHIIKNGKTKLARVIKQLRANHRLILSGTPIQNNVLELWSLLHSFYWIPFILYNNTHFQENIDMCLIQSRDAKSSSKEQEAGALAMESLHRQVLPFLLRRLKEDVLQDLPPKIIQDYYCELSPLQVQLYEDFAKSQAKKGLEESFSLSEDADDKEMASKKGSAHIFQALQYLRKVCNHPLLVLTPQHPEHDKIMQQLKETRQSLKDIHHAAKLVALKQLLLDCGIGVSTSSTSDLASEPVVSQHRVLLFCQLKSMLDIVENDLFKTNMPSVTYLRLDGSTPAGSRHSIVHRFNNDPSIDVLLLTTHVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLVTKGTLEEKIMGLQKFKMTIANTVISQDNSSLSTMDTGQLFDLFTVDKEGKREEQH-EAQDNNKRKM--SVKNAIEGM---------------GE-LWD-EEQYETEYNLDNFI 1868          

HSP 2 Score: 139.043 bits (349), Expect = 1.243e-32
Identity = 174/629 (27.66%), Postives = 284/629 (45.15%), Query Frame = 2
Query:  137 RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPG--TSESNVTNVSNLINLE-------NLNLHDILKIGTRLYSRDFKDLD---------EANTNQNINRDELARHLGF-LIP----------DECEIKNLITVKDCELVESKSENK-------MSVELAVMKSMENSP--------------KKPVKRPHEEVQDVNEPGTKMK-------CVEK--------IGNETE----RERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHE---RFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYS-DLVRLAAVRTCRAVLQSIG-IKVGT---ILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQP 1792
            R AAA Q+G++   +   +  LL+++  + K   W  RIAA  A+  I  +   W P   T ++   + S+L   E         ++  +L+ G  L      + D         +      + +  + + LG  +IP          D+ ++  L++V+D     +K +N        ++ E+A + S + S               K+  K   + V + +E G  +K        VE+        + N T+     E + EWP+   C+EL + L    WE+RHGAAT LRE+++  G     + A  +        H    ++ E + V LLC L LD+  DFVSDE+VAPVRE+CAQ LGV+  H+       +   LL+L    EW V HG LLG+KYLLA R DL   LLP++ +PI S L+ + DDDVR  A +AL+P+      + V ++  ++  L   LW+ L    D T S  T +++ LL  +    +V                +L++ + RL W +  ++   VRLAA+RT R +LQ    +  GT   +     +   +  + QR +++ +  V    + VW   +    +Q L+      L  W+   MQP
Sbjct:   33 RKAAAKQLGEVQKLHPHELPNLLSRVHTFLKSGNWDTRIAAGQAIEAIAQSVPQWEPPGLTVKAEPQDGSSLCGSEPEQLEFGKFDIKRVLQHGEPLVGSSGAEYDMPDDELAGLDPKEKLALQQRMVRKRLGLDIIPGLDVGMDKLFDDEDL--LMSVEDTRRKPAKKQNSFESAADVVAAEIAAISSSKMSAREKNRAKRKAKLLAKQRSKEAGDSVSNEDEDGPNVKKRKTASVVVEQPAHADKIVVDNVTDVAATFEESGEWPFEHXCQELSQELXHHSWEVRHGAATGLREIVKVHG-----QGAGKTVDTFLEEMHMQNMKWMENMAVYLLCVLALDRFGDFVSDEVVAPVRETCAQTLGVVVRHMNVSDCRSVMLTLLTLQEQTEWEVRHGGLLGIKYLLAVRQDLSADLLPLVLNPIISALQ-DDDDDVRAIAASALLPI----AESIVQLAPNKVQELLMTLWNTLVELDDLTAS--TNSIMLLLAGILACPSVSMTM-------FGSAGSLSDLVPRL-WPFLRHTIRSVRLAALRTLRILLQGTANVSSGTAECVWLTPILQDAVRHIYQRFILESDASVIQYVYEVWCDLLSKSSKQCLSSSILPYLNSWLGMMMQP 639          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Nematostella
Match: EDO48116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK66])

HSP 1 Score: 226.098 bits (575), Expect = 2.306e-59
Identity = 174/575 (30.26%), Postives = 290/575 (50.43%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCL---DDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIR-NEIPKATHLRLDGSVPAKDRQQIVEKFSC-DAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSK---DNNQMASMNTENILEIMNKEANWPTQSPPASANG 5362
            +V  +L++YQ  G+ W+  L+   L+G+LAD+MGLGKT+Q I + +    +      P L++ P +   +W  EF+K+    P    + Y G+P  R+     L   ++ VV+T+Y+ +  D  +LA+                     W Y+V+DEGH ++N+  K+  V      A+HR++LTGTP+QNR+ ELW+L +FL+P +  + + F + +       G     +++ E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ  LY H  +         V L D S K+       +    T+  LR +CNHP +       +  ++   L  +   +   D    SGK   L +++                       +R+L+FCQ   +M +++        P   +LRLDG+  ++DR Q++  F+  D+   + LL+T  GGLGLNL +A+ V+  + DWNP +DLQA DRAHRIGQ+  V V RL+T  S+EEKI+    +K  +   V+     + N  +S     ++ +++ E N   ++P +++NG
Sbjct:  641 LVGGRLKEYQLAGLEWMVSLHNNNLNGILADEMGLGKTIQTIALFSYLIEKK-RLNGPFLVIVPLSTLSNWQLEFEKWA---PSAIVVSYKGSPNMRRSAGAVLRTGKFNVVLTTYEYVMRDKAILAKVR-------------------WKYMVVDEGHRMKNHHCKLTQVLNTHYAAQHRILLTGTPLQNRLPELWALLNFLLPTIFKSVSTFEQWFNAPFAMTGEKV--ELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVVKCDMSILQRILYNHMYKK-------GVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPFM----FQHIEESIAEHLGFHGGIVTGPDIYRASGKFELLDRILPKLKRN----------------KHRVLMFCQMTSLMTILEDYFNWKGFP---YLRLDGTTKSEDRGQLLSLFNAKDSPYFVFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQEKEVRVLRLMTVNSVEEKILAAARYKLNVDEKVIQAGMFNQNSTSSERKAFLMALLDTE-NDDDEAPKSNSNG 1159          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Nematostella
Match: EDO40761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S667])

HSP 1 Score: 213.386 bits (542), Expect = 3.991e-56
Identity = 167/541 (30.87%), Postives = 264/541 (48.80%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL---SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSL-GLTSSHPLYRTLMRELAANNQCLDDINL---SGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDK--MIRNEIPKATHLRLDGSVPAKDRQQIVEKFSC-DAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSK 5260
            +   ++R YQ  G+NWL  L   G++G+LAD+MGLGKTLQ I ++   Y +     P P +++CP +   +W  EF+++    P    +  +G    R            + V +TSY+     M +  +  F +                W Y+V+DE H I+N KSK++   R L + +RL+LTGTP+QN + ELW+L +FL+P +  +  +F+  +         NS   V+ +     +E LH  + PF+LRR+K DV + L PK        ++ +Q   YT  +      D D V    K+ K              +  LR  CNHP L       P Y T             D++L   SGK+  L +L+    +   G+              R+L+F Q  +++++++   + R    +  + RLDG  P ++RQ  +  F+   ++  I +L+T  GGLG+NL +A+IVI  + DWNP  DLQAMDRAHRIGQK  V V+R I+  ++EE+I+   E K  L   V+ +
Sbjct:  139 IKGGEMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLG--YMKNFRNVPGPHMVICPKSTLANWMAEFERWC---PSIRAVCLIGNQEQRTAFIRDTMLPGEWDVCVTSYE-----MVIREKAVFKKFA--------------WRYIVIDEAHRIKNEKSKLSEIVRELRSANRLLLTGTPLQNNLHELWALLNFLLPDVFSSSDDFDAWF---------NSNNLVEEKQ---LVERLHSVLRPFLLRRLKSDVEKRLLPKKETKVYTGLTKMQRSWYTKIL----MKDIDVVNGAGKTDK--------MRLLNILMQLRKCCNHPYLFDGAEPGPPYTT-------------DVHLIENSGKMRVLDKLL--ARLKQEGS--------------RVLIFSQMTRLLDILEDYCLWR----QYDYCRLDGQTPHEERQAYINSFNMPGSTKFIFMLSTRAGGLGINLATADIVILYDSDWNPQVDLQAMDRAHRIGQKKQVKVFRFISESTVEERIIERAEMKLRLDAVVIQQ 598          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Nematostella
Match: EDO46669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD7])

HSP 1 Score: 206.838 bits (525), Expect = 2.157e-54
Identity = 174/568 (30.63%), Postives = 276/568 (48.59%), Query Frame = 2
Query: 3686 LRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQ---------VVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYG-RVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELV--DKSYKEN-----SAINQHRHGFQTMHYLRLVCNHPSL-GLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDC------------GVGVSGAGEEELDETS---------VVASNR----LLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSK 5260
            LR YQ EGV WL  L   G++G+LAD+MGLGKT+Q I +++  Y        P L+  P +   +W  EF++F   +P    I+Y G+   R  +   +++ +         VV+TSY+   +D   L +              LM     W ++++DEGH I+N   ++    ++  + +RL+LTGTP+QN + ELWSL +FL+P +      F R +    +   G N  + +  E     LE LH  + PF+LRR+K DV   LPPK        ++  Q   Y      +AA D   +++V  +K  KE+     S   + R G + ++Y      + S+  L           RE+   +Q     ++S K+  +  L+  C             V      +EEL   S         V A  R    +L+F Q  KM++++       +    + RLDGS+  +DR++ ++ F+ D    I LL+T  GGLGLNL++A+ VI  + DWNP  DLQA DR HRIGQ   ++VYRL+T+ ++++KI+     K+ L   V+ K
Sbjct:  298 LRSYQLEGVEWLKGLYENGVNGILADEMGLGKTIQCIGLVS--YLIEMGVRGPFLVAAPLSTLPNWVSEFRRFSPQIP---VILYHGSIQERTSLRRKITKLKKAGPFETMPVVVTSYEIAMNDQKHLFQ--------------LM-----WKHMIVDEGHRIKNLNCRLIRELKSYNSANRLLLTGTPLQNNLAELWSLLNFLLPDIFDDLNSFQRWFDFSAINDEGGNE-KIIAQEKEHQVLERLHSILTPFLLRRLKTDVELSLPPKKEVLVRAPLTSKQTEFY------RAALDKTILDIVGDNKDKKEDKVEISSTGRKKRKGRRNINYKIFDDENGSIEELAEELATLEKSRREICTPSQKSSTYDISIKITNILMLLRKCCNHPYLLEYPLDPVTQQYKIDEELVRCSGKMLLLDQMVPALKRRGHKILIFSQMTKMLDILQDYCY--LRGYQYSRLDGSMKVEDRREEIDAFASDPEKFIFLLSTRAGGLGLNLSAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPILVYRLVTSNTVDQKIVERAASKRKLEKMVIYK 832          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Nematostella
Match: EDO41059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5B2])

HSP 1 Score: 198.749 bits (504), Expect = 3.041e-53
Identity = 176/569 (30.93%), Postives = 275/569 (48.33%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGT----PMYRQCIFNSLSRYQVVITSYDTLRS---DMNLLA--RPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSL--------GLTSSHPLY-----------------RTLMRELAANNQCLDDINLSGKLVALRQLILDCG-VGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQ 5272
            + +  L+ YQ  G+NWL  ++  G++G+LAD+MGLGKT+QAI  IA    +      P LI+ P +   +W +EFK++    P     +Y G+       R+ I +  S ++V+IT+Y+       D + L   RP                     +YVV DEGH+++N +S+  +    + A+ RL+LTGTP+QN + EL SL  F+MP +    T+     G  L        R  DS       E   + + PF+LRR+K DVLQELP K      C +S  Q  L++              +L+ K Y E    ++ R     +  LR++ NHP L         L      Y                  T+M +   +  CL+  +LS  ++   +L+ D G      A   E+ +      +R+L+F Q   +M++++  +++      + RLDG  P  +RQ +++ F+ D  I + LL+T  GGLG+NLTSAN+VI  + D+NP  D QA DR HR+GQ   V VYRLI   ++E+ ++     K  L   VVS DN++
Sbjct:  108 IRAKSLKPYQLTGLNWLILMHEQGVNGILADEMGLGKTVQAISFIAHLIEKGDDG--PHLIIVPSSTLNNWVKEFKQWC---PTIRFTLYYGSQEERTYLREEILDEHSDFKVIITTYNMATGGFEDTSFLRQLRP---------------------HYVVFDEGHMLKNMQSQRYLKLTRIRAKRRLLLTGTPMQNDLLELMSLLSFVMPTIFDGRTD-----GLKLLFGNKKLDRDADSGYIKERAEQAKKIMKPFVLRRLKKDVLQELPQKHEHVIHCELSTSQKDLHS--------------KLMLKCYNEYRDASKSRDYKNILMALRMMSNHPLLLRNYYKDETLREMAVKYCRDIENRGSEVDLVCEDMTVMSDFELHRLCLEQRSLSSYVLG-EELLYDSGKFERLNAMLPEMKDNG----DRVLLFSQFTLVMDIIEVYLQH--CGYRYFRLDGQTPVVERQPMIDNFNSDPDIFLFLLSTKAGGLGINLTSANVVILHDIDFNPYNDKQAEDRCHRVGQTRDVHVYRLIAKDTVEDNMLKCANSKLKLEKDVVSADNDE 624          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Medaka
Match: btaf1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:101162779])

HSP 1 Score: 511.146 bits (1315), Expect = 9.838e-150
Identity = 327/731 (44.73%), Postives = 459/731 (62.79%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSV-VSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY---------SRAPSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQA-ATDTDFVELVD-KSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVD-KMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GAIE +  V       ++PY   I ++++PV L  ++ P D +R +AT  F+ L+ LLPLE+   D   ++    +Q+ +   FL+ LL+ + +  Y  H  V + A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG++         ++A    P PSL+VCPPTLT HW  E  KF       + + Y G P  R  + + + ++ +++ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A  RL+L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C +SPLQ++LY    +S+A A+  D +     +  +E   +    H FQ + YLR +CNHPSL LT  HP Y+ +  +LAA N  L DI  + KL AL+QL+LDCG+G  G  E   +  +VVA +R+L+FCQ   M+++V+  +++ ++P  T+LRLDGSVPA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V++++N  M SM T+ +L +   +            +GK +  SS SG        KSV+  +     GE ++D   +YD EYNLDSF+
Sbjct: 1106 GAIEALACVMEQLEVDIIPY---IVLLVVPV-LGRMSDPSDSIRFMATQCFATLIRLLPLEAGIPDPPAMSADLIRQKARERYFLEQLLDGRKLENY--HIPVPIKAELRKYQQDGVNWLSFLNKYKLHGILCDDMGLGKTLQSICILAGDHYLRAQEYAKTKAADCSPLPSLVVCPPTLTGHWVDEVGKFCTK-EYLHPLHYTGPPSERMRLQHQVKKHNLIVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHIIKNGKTKLSKAIKQLAANFRLILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDAKSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCNLSPLQVQLYEDFAKSRAKASVEDSISTASAEEEEEKPKLKATGHVFQALQYLRKLCNHPSLVLTPQHPEYKRVTDQLAAQNSGLRDIQHAPKLSALKQLLLDCGLGDGGGSETGTE--AVVAQHRVLIFCQLKSMLDIVEHDLLKPKMPTVTYLRLDGSVPAGLRHAIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTVINQENTSMQSMGTDQLLNLFTLDQE--------EKDGKGEQSSSTSGKPSM----KSVIDGL-----GE-LWD-QQQYDTEYNLDSFM 1789          

HSP 2 Score: 112.079 bits (279), Expect = 4.678e-24
Identity = 104/372 (27.96%), Postives = 162/372 (43.55%), Query Frame = 2
Query:   86 SRLDKLFELLESNHQNI-RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGTSE--------SNVTNVSNLINLENLNLHDILKIGTRLYSR---DFKDLDEANTNQNINRDELARH-------LGF------------LIPDE---------------------CEIKNLITVKDCELVESKSENKMSV-ELAVMKSMENSPKKPVKR---PHEEVQD-----------------VNEPGTKMKCVEKIGNETER--ERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDE 976
            SRLD+LF LL++    + R AAA Q+G++   +   +  LLAK+L Y +   W  RIAA  AV  I  N   W P            S   + S+ ++  + ++  +LK G  L      +F +L E  T +   ++ LAR        LG             L  DE                     C   N +T++  EL++S+    MS  +    K M     K   R   P+E+  D                 +++P  + K +     +T    E ++EWP   FCEEL  +L++  WE+RHGA T LRE+++  G+         S+  + +  H+ + E++V+RLLC   LD+  DFVSDE
Sbjct:    4 SRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELHNLLAKVLTYLRSPNWDTRIAAGQAVEAIVKNIPEWNPSPKPKEESCEDLSPEDSSSDRLSFYHFDISRLLKHGASLLGSAGAEF-ELQEDKTGEMDPKERLARQRKLLQKKLGLDMGAAIGMDTEELFNDEDLDDTCQSSVVKAHGVKVTAGCSSHNHLTIQAAELIDSEFRTGMSSRQKNKAKRMAKLVAKQRSRDVDPNEKSNDSFEGEPEEKRRKTTNVVIDQPAAQPKVLIDNVPDTSSVLEESSEWPLESFCEELCNDLFNPSWEVRHGAGTGLREILKCHGAAG--GKLVGSTAQQMSRQHQEWIEDLVIRLLCVFALDRFGDFVSDE 372          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Medaka
Match: btaf1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:101162779])

HSP 1 Score: 511.146 bits (1315), Expect = 1.976e-149
Identity = 327/731 (44.73%), Postives = 459/731 (62.79%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSV-VSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY---------SRAPSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQA-ATDTDFVELVD-KSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVD-KMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            GAIE +  V       ++PY   I ++++PV L  ++ P D +R +AT  F+ L+ LLPLE+   D   ++    +Q+ +   FL+ LL+ + +  Y  H  V + A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG++         ++A    P PSL+VCPPTLT HW  E  KF       + + Y G P  R  + + + ++ +++ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A  RL+L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C +SPLQ++LY    +S+A A+  D +     +  +E   +    H FQ + YLR +CNHPSL LT  HP Y+ +  +LAA N  L DI  + KL AL+QL+LDCG+G  G  E   +  +VVA +R+L+FCQ   M+++V+  +++ ++P  T+LRLDGSVPA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQK  V VYRLIT  ++EEKIM LQ+FK  +AN V++++N  M SM T+ +L +   +            +GK +  SS SG        KSV+  +     GE ++D   +YD EYNLDSF+
Sbjct: 1165 GAIEALACVMEQLEVDIIPY---IVLLVVPV-LGRMSDPSDSIRFMATQCFATLIRLLPLEAGIPDPPAMSADLIRQKARERYFLEQLLDGRKLENY--HIPVPIKAELRKYQQDGVNWLSFLNKYKLHGILCDDMGLGKTLQSICILAGDHYLRAQEYAKTKAADCSPLPSLVVCPPTLTGHWVDEVGKFCTK-EYLHPLHYTGPPSERMRLQHQVKKHNLIVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHIIKNGKTKLSKAIKQLAANFRLILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDAKSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCNLSPLQVQLYEDFAKSRAKASVEDSISTASAEEEEEKPKLKATGHVFQALQYLRKLCNHPSLVLTPQHPEYKRVTDQLAAQNSGLRDIQHAPKLSALKQLLLDCGLGDGGGSETGTE--AVVAQHRVLIFCQLKSMLDIVEHDLLKPKMPTVTYLRLDGSVPAGLRHAIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTVINQENTSMQSMGTDQLLNLFTLDQE--------EKDGKGEQSSSTSGKPSM----KSVIDGL-----GE-LWD-QQQYDTEYNLDSFM 1848          

HSP 2 Score: 185.267 bits (469), Expect = 2.960e-46
Identity = 248/842 (29.45%), Postives = 383/842 (45.49%), Query Frame = 2
Query:   86 SRLDKLFELLESNHQNI-RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGTSE--------SNVTNVSNLINLENLNLHDILKIGTRLYSR---DFKDLDEANTNQNINRDELARH-------LGF------------LIPDE---------------------CEIKNLITVKDCELVESKSENKMSV-ELAVMKSMENSPKKPVKR---PHEEVQD-----------------VNEPGTKMKCVEKIGNETER--ERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYS-DLVRLAAVRTCRAVL----QSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILT-EFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFIFHE--AGIRNILIS-IIAQI---HLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSL--SPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLILIYIEREIPL 2344
            SRLD+LF LL++    + R AAA Q+G++   +   +  LLAK+L Y +   W  RIAA  AV  I  N   W P            S   + S+ ++  + ++  +LK G  L      +F +L E  T +   ++ LAR        LG             L  DE                     C   N +T++  EL++S+    MS  +    K M     K   R   P+E+  D                 +++P  + K +     +T    E ++EWP   FCEEL  +L++  WE+RHGA T LRE+++  G+         S+  + +  H+ + E++V+RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV   H+    V +  N LL LL  D+W V HG LLG+KY LA R DL+ VLLP +   I+  L+ + DDDVR  A AAL+P+        V +   E+ ++   LWD L    D T S  T +++ LL  L     + Y Q     M     ++L   + R+ W +  ++   VR AA+ T   +L    QS  + +  I     I  +L  + Q  +++ + ++      VW + +   P+Q +   SC  +  W+C  MQ + +      +L            A +    G     GN     T + YI G E+   D     RD +V+RARL + +LL  LC+     +  A  + I  +  +AQ+   HL  + A+QR   +++L  W      A++   DC +  S +Q +LL  L E +YY EI   F +M   C+ LI +  +  I L
Sbjct:    4 SRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELHNLLAKVLTYLRSPNWDTRIAAGQAVEAIVKNIPEWNPSPKPKEESCEDLSPEDSSSDRLSFYHFDISRLLKHGASLLGSAGAEF-ELQEDKTGEMDPKERLARQRKLLQKKLGLDMGAAIGMDTEELFNDEDLDDTCQSSVVKAHGVKVTAGCSSHNHLTIQAAELIDSEFRTGMSSRQKNKAKRMAKLVAKQRSRDVDPNEKSNDSFEGEPEEKRRKTTNVVIDQPAAQPKVLIDNVPDTSSVLEESSEWPLESFCEELCNDLFNPSWEVRHGAGTGLREILKCHGAA--GGKLVGSTAQQMSRQHQEWIEDLVIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVALRHMNESGVFMTVNVLLKLLREDQWEVRHGGLLGIKYALAVRQDLMGVLLPRVLPAITEGLQ-DLDDDVRAVAAAALIPVV----DGLVQLQTNEVPSIVNTLWDALLDLDDLTAS--TNSIMTLLSSL-----LTYPQVRLCSMQ----QSLTVLVPRV-WPFLRHTISSVRRAALETLYTLLSTADQSCAVWINPI-----IQDMLRHIFQSCILESHEEILELIQKVWMELLFQAPQQYVVAASCPWMGAWLCLMMQASHIPIDQNMLL---------EVKARSKDKAGAKARLGNSQAKETVQEYIAGAETVADD--PLTRDYVVVRARLMSAKLLGALCKCICDPQLNAATQEIRPAESLAQLLLFHLNSKSALQRIAVALVLCEW-----AALQ--KDCQVVSSMVQPRLLAILAEQLYYDEIAIPFTRMQNECKQLITLLADANIDL 802          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Medaka
Match: btaf1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:101162779])

HSP 1 Score: 446.047 bits (1146), Expect = 7.029e-128
Identity = 280/612 (45.75%), Postives = 393/612 (64.22%), Query Frame = 2
Query: 3374 GAIELIYLVCHS---GLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSXXXXXXXXESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSV-VSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEY---------SRAPSTCP-PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQA-ATDTDFVELVD-KSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVD-KMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKH 5158
            GAIE +  V       ++PY   I ++++PV L  ++ P D +R +AT  F+ L+ LLPLE+   D   ++    +Q+ +   FL+ LL+ + +  Y  H  V + A+LR+YQ++GVNWL FLN+Y LHG+L DDMGLGKTLQ+IC++AG++         ++A    P PSL+VCPPTLT HW  E  KF       + + Y G P  R  + + + ++ +++ SYD +R+D++      F                   NY +LDEGH+I+N K+K++ A + L A  RL+L+GTPIQN V ELWSLFDFLMPG LGT  +F  RYG+ +  +        + EAG LA+E LHRQVLPF+LRR+K+DVLQ+LPPKI+QDY C +SPLQ++LY    +S+A A+  D +     +  +E   +    H FQ + YLR +CNHPSL LT  HP Y+ +  +LAA N  L DI  + KL AL+QL+LDCG+G  G  E   +  +VVA +R+L+FCQ   M+++V+  +++ ++P  T+LRLDGSVPA  R  IV +F+ D SID+LLLTT +GGLGLNLT A+ V+FVEHDWNPMRDLQAMDRAHRIGQ+ 
Sbjct: 1165 GAIEALACVMEQLEVDIIPY---IVLLVVPV-LGRMSDPSDSIRFMATQCFATLIRLLPLEAGIPDPPAMSADLIRQKARERYFLEQLLDGRKLENY--HIPVPIKAELRKYQQDGVNWLSFLNKYKLHGILCDDMGLGKTLQSICILAGDHYLRAQEYAKTKAADCSPLPSLVVCPPTLTGHWVDEVGKFCTK-EYLHPLHYTGPPSERMRLQHQVKKHNLIVASYDVVRNDIDFFRNIKF-------------------NYCILDEGHIIKNGKTKLSKAIKQLAANFRLILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDAKSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCNLSPLQVQLYEDFAKSRAKASVEDSISTASAEEEEEKPKLKATGHVFQALQYLRKLCNHPSLVLTPQHPEYKRVTDQLAAQNSGLRDIQHAPKLSALKQLLLDCGLGDGGGSETGTE--AVVAQHRVLIFCQLKSMLDIVEHDLLKPKMPTVTYLRLDGSVPAGLRHAIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQEE 1748          

HSP 2 Score: 184.882 bits (468), Expect = 3.162e-46
Identity = 248/842 (29.45%), Postives = 383/842 (45.49%), Query Frame = 2
Query:   86 SRLDKLFELLESNHQNI-RNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGTSE--------SNVTNVSNLINLENLNLHDILKIGTRLYSR---DFKDLDEANTNQNINRDELARH-------LGF------------LIPDE---------------------CEIKNLITVKDCELVESKSENKMSV-ELAVMKSMENSPKKPVKR---PHEEVQD-----------------VNEPGTKMKCVEKIGNETER--ERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYS-DLVRLAAVRTCRAVL----QSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILT-EFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFIFHE--AGIRNILIS-IIAQI---HLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSL--SPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLILIYIEREIPL 2344
            SRLD+LF LL++    + R AAA Q+G++   +   +  LLAK+L Y +   W  RIAA  AV  I  N   W P            S   + S+ ++  + ++  +LK G  L      +F +L E  T +   ++ LAR        LG             L  DE                     C   N +T++  EL++S+    MS  +    K M     K   R   P+E+  D                 +++P  + K +     +T    E ++EWP   FCEEL  +L++  WE+RHGA T LRE+++  G+         S+  + +  H+ + E++V+RLLC   LD+  DFVSDE+VAPVRE+CAQ LGV   H+    V +  N LL LL  D+W V HG LLG+KY LA R DL+ VLLP +   I+  L+ + DDDVR  A AAL+P+        V +   E+ ++   LWD L    D T S  T +++ LL  L     + Y Q     M     ++L   + R+ W +  ++   VR AA+ T   +L    QS  + +  I     I  +L  + Q  +++ + ++      VW + +   P+Q +   SC  +  W+C  MQ + +      +L            A +    G     GN     T + YI G E+   D     RD +V+RARL + +LL  LC+     +  A  + I  +  +AQ+   HL  + A+QR   +++L  W      A++   DC +  S +Q +LL  L E +YY EI   F +M   C+ LI +  +  I L
Sbjct:    4 SRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELHNLLAKVLTYLRSPNWDTRIAAGQAVEAIVKNIPEWNPSPKPKEESCEDLSPEDSSSDRLSFYHFDISRLLKHGASLLGSAGAEF-ELQEDKTGEMDPKERLARQRKLLQKKLGLDMGAAIGMDTEELFNDEDLDDTCQSSVVKAHGVKVTAGCSSHNHLTIQAAELIDSEFRTGMSSRQKNKAKRMAKLVAKQRSRDVDPNEKSNDSFEGEPEEKRRKTTNVVIDQPAAQPKVLIDNVPDTSSVLEESSEWPLESFCEELCNDLFNPSWEVRHGAGTGLREILKCHGAA--GGKLVGSTAQQMSRQHQEWIEDLVIRLLCVFALDRFGDFVSDEVVAPVRETCAQTLGVALRHMNESGVFMTVNVLLKLLREDQWEVRHGGLLGIKYALAVRQDLMGVLLPRVLPAITEGLQ-DLDDDVRAVAAAALIPVV----DGLVQLQTNEVPSIVNTLWDALLDLDDLTAS--TNSIMTLLSSL-----LTYPQVRLCSMQ----QSLTVLVPRV-WPFLRHTISSVRRAALETLYTLLSTADQSCAVWINPI-----IQDMLRHIFQSCILESHEEILELIQKVWMELLFQAPQQYVVAASCPWMGAWLCLMMQASHIPIDQNMLL---------EVKARSKDKAGAKARLGNSQAKETVQEYIAGAETVADD--PLTRDYVVVRARLMSAKLLGALCKCICDPQLNAATQEIRPAESLAQLLLFHLNSKSALQRIAVALVLCEW-----AALQ--KDCQVVSSMVQPRLLAILAEQLYYDEIAIPFTRMQNECKQLITLLADANIDL 802          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Medaka
Match: ercc6 (ERCC excision repair 6, chromatin remodeling factor [Source:NCBI gene;Acc:101166245])

HSP 1 Score: 232.261 bits (591), Expect = 5.664e-61
Identity = 183/601 (30.45%), Postives = 290/601 (48.25%), Query Frame = 2
Query: 3683 KLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-EYSRAPSTCP--------PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMY----RQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQ--ELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKIS 5440
            KL +YQ+ GV W+  L+     G+L D+MGLGKT+Q I  +AG  YS+  +           P++IVCP T+   W +EF  +    P F   V   T  +     + I    S + ++ITSY  +R+  ++L R                     W+Y++LDEGH IRN  + V  A +     HR +L+G+P+QN + ELWSLFDF+ PG LGT   F  ++   +   G ++   V  +       +L   + P++LRR+K DV     LP K  Q   C ++  Q ++Y   ++S+                    +N     F  +  LR +CNHP L  +    + + +  +     +       SGKL+ +  L+                       +R+L+F QS +M+++++  +R      ++L++DG+     RQ ++ +++ D SI I LLTT +GGLG+NLT AN VI  + DWNP  D QA +RA RIGQ   V +YRL+TA +IEEKI + Q FK+FL N V+ KD  Q     + +I E+        T + P  + G +        G++ ++  K    K++
Sbjct:  497 KLYKYQQTGVRWMWELHCQQAGGILGDEMGLGKTIQVISFLAGLSYSKLRTRGSNYRYAGLGPTVIVCPATVMHQWVKEFHTWW---PPFRVAVLHETGSFTSKKEKLIPEIASCHGILITSYSAVRNLQDILIRYD-------------------WHYIILDEGHKIRNPNAAVTAACKQFQTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVQTAYKCACVLRDTINPYLLRRMKADVKANLSLPDKNEQVLFCRLTEEQRQVYQSFLDSKEVYQI---------------LNGDMQVFSGLIALRKICNHPDL-FSGGPRMLKGIPEDQLTEEEHFGFWRRSGKLIVVESLL----------------RLWFKQGHRVLLFSQSRQMLDILEVFVREN--NYSYLKMDGTTTIASRQPLIARYNQDRSIFIFLLTTKVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQTLQVTIYRLLTAGTIEEKIYHRQIFKQFLTNRVL-KDPKQRRFFKSNDIYELF-------TLADPDGSQGTETSAIFAGTGSDVKVTKKPARPKLT 1033          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Medaka
Match: ercc6 (ERCC excision repair 6, chromatin remodeling factor [Source:NCBI gene;Acc:101166245])

HSP 1 Score: 232.261 bits (591), Expect = 5.664e-61
Identity = 183/601 (30.45%), Postives = 290/601 (48.25%), Query Frame = 2
Query: 3683 KLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAG-EYSRAPSTCP--------PSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMY----RQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQ--ELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKIS 5440
            KL +YQ+ GV W+  L+     G+L D+MGLGKT+Q I  +AG  YS+  +           P++IVCP T+   W +EF  +    P F   V   T  +     + I    S + ++ITSY  +R+  ++L R                     W+Y++LDEGH IRN  + V  A +     HR +L+G+P+QN + ELWSLFDF+ PG LGT   F  ++   +   G ++   V  +       +L   + P++LRR+K DV     LP K  Q   C ++  Q ++Y   ++S+                    +N     F  +  LR +CNHP L  +    + + +  +     +       SGKL+ +  L+                       +R+L+F QS +M+++++  +R      ++L++DG+     RQ ++ +++ D SI I LLTT +GGLG+NLT AN VI  + DWNP  D QA +RA RIGQ   V +YRL+TA +IEEKI + Q FK+FL N V+ KD  Q     + +I E+        T + P  + G +        G++ ++  K    K++
Sbjct:  497 KLYKYQQTGVRWMWELHCQQAGGILGDEMGLGKTIQVISFLAGLSYSKLRTRGSNYRYAGLGPTVIVCPATVMHQWVKEFHTWW---PPFRVAVLHETGSFTSKKEKLIPEIASCHGILITSYSAVRNLQDILIRYD-------------------WHYIILDEGHKIRNPNAAVTAACKQFQTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVQTAYKCACVLRDTINPYLLRRMKADVKANLSLPDKNEQVLFCRLTEEQRQVYQSFLDSKEVYQI---------------LNGDMQVFSGLIALRKICNHPDL-FSGGPRMLKGIPEDQLTEEEHFGFWRRSGKLIVVESLL----------------RLWFKQGHRVLLFSQSRQMLDILEVFVREN--NYSYLKMDGTTTIASRQPLIARYNQDRSIFIFLLTTKVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQTLQVTIYRLLTAGTIEEKIYHRQIFKQFLTNRVL-KDPKQRRFFKSNDIYELF-------TLADPDGSQGTETSAIFAGTGSDVKVTKKPARPKLT 1033          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Planmine SMEST
Match: SMESG000072160.1 (SMESG000072160.1)

HSP 1 Score: 1807.73 bits (4681), Expect = 0.000e+0
Identity = 980/980 (100.00%), Postives = 980/980 (100.00%), Query Frame = 2
Query:   80 MASRLDKLFELLESNHQNIRNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGTSESNVTNVSNLINLENLNLHDILKIGTRLYSRDFKDLDEANTNQNINRDELARHLGFLIPDECEIKNLITVKDCELVESKSENKMSVELAVMKSMENSPKKPVKRPHEEVQDVNEPGTKMKCVEKIGNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHXXXXXXXXXXXXRMDLVEVLLPIIYDPISSHLKGNXXXXXXXXXXXXLMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYSDLVRLAAVRTCRAVLQSIGIKVGTILEHGTIXXXXXXXXXXXXIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIIXXXXXXXXXXXXDGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVXXXXXXXXXXXXXXXXXFIFHEAGIRNILISIIAQIHLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSLSPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLILIYIEREIPLPPSIMNAVGPNASPVSIALNISQCQSLISSEMCSLCPPESMTTFSCATAAVDTCAQQHATLCRLVDIAVGRALLQWGWXXXXXXXXXXXXXSAVRSETCVTLQTEACIALAQLVVDHNSQTRLLAPVTKLVKNLIQYQSEAIDSLATMQPHEVEQGEIVAIYKTSQLGREAFPRQEDNGTAVAIDNDVMIKLRGSRLALEKIYSRFVSSSESDLDHSFLMEIIYH 3019
            MASRLDKLFELLESNHQNIRNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGTSESNVTNVSNLINLENLNLHDILKIGTRLYSRDFKDLDEANTNQNINRDELARHLGFLIPDECEIKNLITVKDCELVESKSENKMSVELAVMKSMENSPKKPVKRPHEEVQDVNEPGTKMKCVEKIGNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHGALLGLKYLLAARMDLVEVLLPIIYDPISSHLKGNCDDDVRCAAVAALMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYSDLVRLAAVRTCRAVLQSIGIKVGTILEHGTILQVLSQLVQRVLIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIITTAAGAAATVVGDGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVLRARLAACQLLARLCQRFIFHEAGIRNILISIIAQIHLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSLSPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLILIYIEREIPLPPSIMNAVGPNASPVSIALNISQCQSLISSEMCSLCPPESMTTFSCATAAVDTCAQQHATLCRLVDIAVGRALLQWGWLPLKLTPLIKPLISAVRSETCVTLQTEACIALAQLVVDHNSQTRLLAPVTKLVKNLIQYQSEAIDSLATMQPHEVEQGEIVAIYKTSQLGREAFPRQEDNGTAVAIDNDVMIKLRGSRLALEKIYSRFVSSSESDLDHSFLMEIIYH
Sbjct:    1 MASRLDKLFELLESNHQNIRNAAAIQIGQLSANNQVNISALLAKLLPYAKHKIWVVRIAASDAVRHIGNNAKLWVPGTSESNVTNVSNLINLENLNLHDILKIGTRLYSRDFKDLDEANTNQNINRDELARHLGFLIPDECEIKNLITVKDCELVESKSENKMSVELAVMKSMENSPKKPVKRPHEEVQDVNEPGTKMKCVEKIGNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRSQGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEMVAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHGALLGLKYLLAARMDLVEVLLPIIYDPISSHLKGNCDDDVRCAAVAALMPLFGDCCSNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNVVYNQSEDQPMATDRVKALNEYINRLHWCYFNYSDLVRLAAVRTCRAVLQSIGIKVGTILEHGTILQVLSQLVQRVLIDDNCQVAAEAHSVWNQFIDSLPEQLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIITTAAGAAATVVGDGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVLRARLAACQLLARLCQRFIFHEAGIRNILISIIAQIHLKDRLAVQRFVASMILAYWDPDHLLAMRNLNDCSLSPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLILIYIEREIPLPPSIMNAVGPNASPVSIALNISQCQSLISSEMCSLCPPESMTTFSCATAAVDTCAQQHATLCRLVDIAVGRALLQWGWLPLKLTPLIKPLISAVRSETCVTLQTEACIALAQLVVDHNSQTRLLAPVTKLVKNLIQYQSEAIDSLATMQPHEVEQGEIVAIYKTSQLGREAFPRQEDNGTAVAIDNDVMIKLRGSRLALEKIYSRFVSSSESDLDHSFLMEIIYH 980          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Planmine SMEST
Match: SMESG000072161.1 (SMESG000072161.1)

HSP 1 Score: 1167.91 bits (3020), Expect = 0.000e+0
Identity = 580/583 (99.49%), Postives = 581/583 (99.66%), Query Frame = 2
Query: 3767 MGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            MGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMC MSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDASIDILLLTTSIGGLGLNLTSANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKI+KADSGERVYDC DEYDQEYNLDSFV
Sbjct:    1 MGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCNMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDASIDILLLTTSIGGLGLNLTSANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKINKADSGERVYDCFDEYDQEYNLDSFV 583          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Planmine SMEST
Match: SMESG000072161.1 (SMESG000072161.1)

HSP 1 Score: 1032.71 bits (2669), Expect = 0.000e+0
Identity = 518/521 (99.42%), Postives = 519/521 (99.62%), Query Frame = 2
Query: 3953 MYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLDEYDQEYNLDSFV 5515
            MYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMC MSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDASIDILLLTTSIGGLGLNLTSANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKI+KADSGERVYDC DEYDQEYNLDSFV
Sbjct:    1 MYRQCIFNSLSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCNMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDASIDILLLTTSIGGLGLNLTSANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANWPTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKINKADSGERVYDCFDEYDQEYNLDSFV 521          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Planmine SMEST
Match: SMESG000076666.1 (SMESG000076666.1)

HSP 1 Score: 228.794 bits (582), Expect = 6.795e-60
Identity = 172/529 (32.51%), Postives = 278/529 (52.55%), Query Frame = 2
Query: 3671 VVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPSTCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNSL--SRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVA-VATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVD--SEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQCLDDINLSGKLVALRQLILDCGVGVSGAGEEELDE---TSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFS-CDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFK 5230
            +++  L+QYQ +G+ WL  L    L+G+LAD+MGLGKT+Q I +I     R      P LI+ P +   +W  EF+K+    P    I+Y G+P  R+ +   L  S++ V++T+Y+ +  D + L++                     W Y+++DEGH ++N+  K+  +      A +RL+LTGTP+QN++ ELW+L +FL+P +  +   F + +        ++SG KV+   E   L +  LH+ + PF+LRR+K +V  +LP K+     C MS LQ ++Y++    +A      ++ VDK  K  +     R     +  LR +CNHP +         + +  ++   N   +        V + + I    +  +    E LD        A +R+L+FCQ   +M+L++  +     K  +LRLDG+  ++DR  ++  F+  ++   I +L+T  GGLGLNL SA+ VI  + DWNP +DLQA DRAHRIGQ++ V V RLI   SIEEKI+    FK
Sbjct:  543 LINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERK-KVNGPFLIIVPLSTMSNWAMEFEKW---GPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVK-------------------WKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPF----ASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRA-----ILKSVDKDKKGRT----ERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPN--------VPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFK--YLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFK 1025          
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Planmine SMEST
Match: SMESG000014388.1 (SMESG000014388.1)

HSP 1 Score: 209.534 bits (532), Expect = 2.987e-54
Identity = 173/564 (30.67%), Postives = 268/564 (47.52%), Query Frame = 2
Query: 3668 SVVSAKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAPS---TCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPM---YRQCIFNSLSRY-QVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVLDEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPGLLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRRVKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKSYKENSAINQHRHGFQTMHYLRLVCNHPSLGLTS-----SHPLYRTLMRELAANNQC--LDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQSIKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKF--SCDAXXXXXXXXXXXXXXXXXXXXANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRLITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIM 5311
            S +  KL  YQ+ GV WL  L+  G  G+L D+MGLGKT+Q I  +AG  SR+        P LIVCP T+   W  EF+ +    P F   +   T       + +  S++ +  V+IT+Y ++     +L  P   R                W Y++LDEGH I+N  +KV    +    RHRL+++G+PIQN + ELWSL DF+ PG LG+   F + +   + + G      +  E       ++   +  ++LRR K +V  +LP K  Q   C ++  Q  +Y   + S+                    I   +  F  +  LR +CNHP L          HP+     RE   +         + SGK+V +++L+     G                 +++L+F Q   M++++ + I  E    +   +DG+     R  IV+KF  S      I LLTT +GGLGLNL  A+ V+  + DWNP  DLQA +RA RIGQ   V++YRL+ + S+EEKI + Q FK+FL N ++ K+  Q     T+++ ++ 
Sbjct:  275 SSIWNKLYGYQQAGVRWLLQLHDNGAGGILGDEMGLGKTIQVIAFLAG-LSRSKGGNYDIGPVLIVCPATVMRQWMDEFRAWA---PLFRVALLHATGSGYDKPERLLESIAHHPGVLITTYSSM-----VLHHPLLTRYD--------------WQYIILDEGHKIKNPNAKVTHCCKQFETRHRLIMSGSPIQNNLKELWSLVDFIYPGKLGSLASFIQNFAVPIMKGGYEHASPLQVETAYRCACVVRDTINEYLLRRTKAEVELQLPRKTEQVLFCGLTGHQNEVYREYLASRQC---------------KQIIAGQQVPFPGLVMLRKICNHPDLVTGGPKCVLDHPIL-GFAREATDDGHSYKFGHFSRSGKMVVVKELLRLWYRG----------------KHKVLLFTQGRMMLQILKRFI--EQQGYSMCTMDGTTAIGSRHAIVDKFNDSPYKEAFIFLLTTRVGGLGLNLVGADRVLVFDPDWNPCTDLQARERAWRIGQNRKVVIYRLVISGSVEEKIYHRQVFKQFLTNRIL-KNPRQRRFFKTQDLRDLF 780          
The following BLAST results are available for this feature:
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BTAF13.414e-15743.85B-TFIID TATA-box binding protein associated factor... [more]
BTAF14.778e-15743.85B-TFIID TATA-box binding protein associated factor... [more]
ERCC67.436e-6132.29ERCC excision repair 6, chromatin remodeling facto... [more]
SMARCA43.501e-6033.46SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA44.981e-6033.46SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btf-14.959e-9034.26BTAF (TBP-associated factor) homolog [Source:UniP... [more]
isw-14.182e-6232.28Chromatin-remodeling complex ATPase chain isw-1 [... [more]
pqn-157.788e-5832.97Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
swsn-41.456e-5731.55SWI/SNF nucleosome remodeling complex component; S... [more]
chd-13.672e-5330.54Chromodomain and Helicase Domain protein [Source:... [more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hel89B4.008e-15044.17gene:FBgn0022787 transcript:FBtr0301715[more]
Hel89B4.008e-15044.17gene:FBgn0022787 transcript:FBtr0344471[more]
brm3.737e-6131.82gene:FBgn0000212 transcript:FBtr0333580[more]
brm3.881e-6131.82gene:FBgn0000212 transcript:FBtr0075526[more]
brm3.881e-6131.82gene:FBgn0000212 transcript:FBtr0075525[more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btaf14.917e-15646.47BTAF1 RNA polymerase II, B-TFIID transcription fac... [more]
btaf14.982e-15646.47BTAF1 RNA polymerase II, B-TFIID transcription fac... [more]
ercc62.156e-6130.42excision repair cross-complementation group 6 [Sou... [more]
SMARCA42.576e-6033.71transcription activator BRG1-like [Source:NCBI gen... [more]
smarca22.803e-5932.47SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BTAF15.393e-15342.45B-TFIID TATA-box binding protein associated factor... [more]
BTAF11.390e-14641.55B-TFIID TATA-box binding protein associated factor... [more]
BTAF12.805e-14641.55B-TFIID TATA-box binding protein associated factor... [more]
BTAF13.252e-14641.55B-TFIID TATA-box binding protein associated factor... [more]
BTAF13.524e-14641.55B-TFIID TATA-box binding protein associated factor... [more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Btaf16.822e-15843.85B-TFIID TATA-box binding protein associated factor... [more]
Ercc61.708e-6232.32excision repair cross-complementing rodent repair ... [more]
Smarca26.564e-6032.47SWI/SNF related, matrix associated, actin dependen... [more]
Smarca27.211e-6032.77SWI/SNF related, matrix associated, actin dependen... [more]
Smarca28.969e-6032.77SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O14981|BTAF1_HUMAN1.639e-15643.85TATA-binding protein-associated factor 172 OS=Homo... [more]
sp|B0XPE7|MOT1_ASPFC3.363e-14842.31TATA-binding protein-associated factor mot1 OS=Neo... [more]
sp|Q4WJI7|MOT1_ASPFU4.382e-14842.31TATA-binding protein-associated factor mot1 OS=Neo... [more]
sp|P32333|MOT1_YEAST1.358e-14741.62TATA-binding protein-associated factor MOT1 OS=Sac... [more]
sp|O43065|MOT1_SCHPO1.046e-14543.67Probable helicase mot1 OS=Schizosaccharomyces pomb... [more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0T6B0J00.000e+033.77HEAT domain-containing protein (Fragment) OS=Oryct... [more]
A0A2D4HIG33.017e-16443.72Uncharacterized protein (Fragment) OS=Micrurus lem... [more]
Q59HB61.050e-16344.07BTAF1 RNA polymerase II, B-TFIID transcription fac... [more]
Q8N6J11.085e-16344.07BTAF1 protein (Fragment) OS=Homo sapiens OX=9606 G... [more]
V4B6I61.901e-16345.06Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btaf15.813e-15743.93B-TFIID TATA-box binding protein associated factor... [more]
btaf11.555e-15445.86B-TFIID TATA-box binding protein associated factor... [more]
btaf13.106e-15345.29B-TFIID TATA-box binding protein associated factor... [more]
ercc67.043e-6031.30excision repair cross-complementation group 6 [Sou... [more]
ENSAMXT00000011579.22.054e-5932.66pep primary_assembly:Astyanax_mexicanus-2.0:13:200... [more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btaf11.714e-15044.55BTAF1 RNA polymerase II, B-TFIID transcription fac... [more]
SMARCA24.414e-5932.65SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA51.362e-5832.16SWI/SNF related, matrix associated, actin dependen... [more]
ercc63.591e-5631.93excision repair cross-complementation group 6 [Sou... [more]
ercc6l2.323e-5531.77excision repair cross-complementation group 6-like... [more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MOT11.955e-14941.62Essential protein involved in regulation of transc... [more]
ISW21.873e-6133.40ATP-dependent DNA translocase involved in chromati... [more]
RAD265.209e-6130.29Protein involved in transcription-coupled nucleoti... [more]
SNF21.518e-5729.48Catalytic subunit of the SWI/SNF chromatin remodel... [more]
IRC52.829e-5631.24Putative ATPase containing the DEAD/H helicase-rel... [more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380214.305e-14743.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481162.306e-5930.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407613.991e-5630.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466692.157e-5430.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410593.041e-5330.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btaf19.838e-15044.73B-TFIID TATA-box binding protein associated factor... [more]
btaf11.976e-14944.73B-TFIID TATA-box binding protein associated factor... [more]
btaf17.029e-12845.75B-TFIID TATA-box binding protein associated factor... [more]
ercc65.664e-6130.45ERCC excision repair 6, chromatin remodeling facto... [more]
ercc65.664e-6130.45ERCC excision repair 6, chromatin remodeling facto... [more]
back to top
BLAST of BTAF1 RNA polymerase II, B-TFIID transcription factor-associated vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072160.10.000e+0100.00SMESG000072160.1[more]
SMESG000072161.10.000e+099.49SMESG000072161.1[more]
SMESG000072161.10.000e+099.42SMESG000072161.1[more]
SMESG000076666.16.795e-6032.51SMESG000076666.1[more]
SMESG000014388.12.987e-5430.67SMESG000014388.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028815 ID=SMED30028815|Name=BTAF1 RNA polymerase II, B-TFIID transcription factor-associated|organism=Schmidtea mediterranea sexual|type=transcript|length=6167bp
TCAAAATGGTGTGCTTAGATATAAGTTTATTGATTAAACATTTTTTTATT
CAAATTCTATATATTGATTTATTAAAAATATGGCAAGCAGACTTGACAAA
TTATTTGAATTACTTGAAAGTAATCATCAAAATATTCGAAATGCTGCTGC
TATTCAAATTGGACAGTTATCTGCCAATAACCAAGTTAACATTTCGGCAT
TATTAGCTAAGTTACTTCCTTATGCAAAACACAAAATTTGGGTAGTGAGA
ATTGCAGCTTCTGATGCTGTTAGACATATAGGAAATAATGCAAAATTGTG
GGTTCCAGGTACGTCTGAATCAAACGTTACTAATGTTTCTAATTTAATAA
ATTTGGAAAATCTGAATTTACATGACATTTTAAAAATTGGAACTCGATTA
TACAGTAGAGACTTTAAAGATTTAGACGAAGCCAATACTAATCAGAATAT
TAATAGGGATGAACTTGCTCGGCATTTAGGGTTTTTGATTCCAGACGAAT
GCGAAATAAAAAATTTAATAACTGTCAAAGATTGTGAATTGGTTGAATCG
AAATCTGAAAATAAAATGAGCGTCGAGTTAGCTGTTATGAAATCTATGGA
AAATTCTCCTAAAAAACCGGTTAAGAGGCCTCACGAAGAAGTCCAAGATG
TCAATGAGCCAGGAACAAAGATGAAATGTGTTGAAAAAATCGGAAATGAA
ACTGAAAGGGAAAGAAATACTGAATGGCCATGGGTGGATTTTTGCGAGGA
GTTGTTGAAAAACTTGTGGGATGCTAAGTGGGAGATTCGACATGGCGCGG
CGACGTGTCTACGTGAATTGATCCGATCACAAGGTTCAATAATGTTGCCA
AAGAACGCCAACATTTCATCTACTGACAAGTTTGCCGCTTGCCATGAGCG
GTTCCAGGAGGAAATCGTCGTCCGTTTACTTTGTACGTTGACACTGGATC
AGTTGTCAGATTTTGTGTCAGATGAGATGGTCGCACCGGTCAGGGAAAGC
TGCGCACAAGCACTAGGTGTTATCAGTGTACACCTAACAAGGCGATTAGT
GGAGATTCTAGCAAATCAACTACTGAGCTTGTTGAATCACGATGAGTGGC
GAGTAAATCATGGAGCATTATTAGGATTGAAGTATCTGCTGGCGGCCCGC
ATGGACTTGGTCGAGGTGCTGCTGCCGATTATTTACGATCCGATCAGCAG
TCATTTGAAGGGCAATTGTGATGATGATGTACGATGCGCAGCAGTAGCTG
CGTTGATGCCTCTTTTCGGGGATTGTTGTAGCAATACAGTTGCCATTAGT
AACGAGGAACTTGACACACTCAAGACTGATCTGTGGGATGTGCTGGCTGT
GCGTATTGACTGCACTACTTCAGGTGCCACATGTGCAGTGCTACAGCTAC
TGGAAAGGCTGTATGAGAAATGTAACGTCGTCTATAACCAATCGGAAGAT
CAGCCAATGGCAACGGATCGGGTGAAAGCATTGAATGAATACATCAATCG
GTTACACTGGTGCTATTTCAACTACAGTGATCTTGTGAGACTAGCGGCCG
TGCGCACCTGTCGAGCGGTTCTGCAATCGATTGGCATCAAAGTAGGCACC
ATCCTCGAGCATGGAACTATTCTCCAGGTGTTATCACAATTGGTGCAGCG
AGTTCTCATCGATGACAACTGTCAGGTGGCAGCAGAGGCTCACTCGGTTT
GGAATCAATTCATTGACAGCCTTCCAGAACAACTGCTCGCCCGTGTCTCT
TGTGAACGGCTCGAGATCTGGATGTGTAGTGCGATGCAGCCGGCACGCCT
CAGTTACACCCCTGGCTCGATTCTGATGCCTGATTACATAATAACAACAG
CGGCGGGAGCAGCAGCAACAGTAGTAGGCGATGGCCTCGATGAGGACGAT
GGTAACAAGCATCACATATTGACCGAGTTCTACATCGGTGGCCGAGAATC
GTTCATTACTGATGGCTCATCGGCCGCTAGAGATGATCTGGTATTGAGGG
CGCGATTGGCCGCCTGCCAGCTGCTGGCGCGGCTGTGCCAGAGATTCATA
TTTCATGAGGCCGGCATCAGGAATATTCTTATATCGATCATCGCCCAGAT
CCATCTCAAGGACCGATTAGCTGTCCAGCGTTTCGTCGCATCTATGATCC
TCGCCTATTGGGATCCGGATCATTTATTGGCAATGCGGAACCTGAACGAT
TGTTCCCTGTCACCGTTGCAATCCCAGCTGTTAACCGCGCTCGAGGAACC
GATCTATTACCAGGAAATATTATCTCAATTCAAGCAGATGCACAAAGCCT
GTCGTGACCTCATACTAATCTATATCGAAAGAGAAATTCCGCTGCCTCCT
TCGATCATGAACGCTGTCGGACCGAATGCGTCGCCCGTCTCAATCGCTCT
TAACATTTCACAATGCCAGTCGCTCATTTCCAGTGAGATGTGCTCGCTCT
GTCCGCCCGAATCTATGACGACGTTCTCGTGTGCCACCGCTGCCGTCGAC
ACGTGTGCTCAGCAGCACGCCACTCTATGCAGATTGGTTGATATAGCAGT
CGGTCGAGCGCTCTTGCAATGGGGCTGGCTGCCACTCAAATTGACCCCTC
TGATCAAGCCACTAATCAGCGCAGTGCGCTCAGAGACCTGTGTAACTCTC
CAGACTGAGGCGTGCATCGCATTGGCTCAGCTGGTGGTTGATCATAATTC
TCAGACTCGCTTGCTTGCTCCCGTTACGAAATTGGTAAAAAATCTCATCC
AGTACCAATCGGAGGCGATCGATTCGCTAGCGACAATGCAACCGCATGAG
GTGGAGCAGGGGGAAATTGTGGCCATCTACAAGACATCGCAGTTAGGCAG
GGAGGCATTCCCGCGCCAGGAGGACAACGGAACTGCGGTTGCCATTGACA
ATGATGTCATGATTAAGTTGCGAGGATCTCGCTTGGCTTTGGAAAAGATT
TACAGTAGATTTGTCAGTTCTTCCGAGTCAGATTTGGATCATTCATTCCT
GATGGAGATAATTTATCACGCCCCCCTCCAACTGCTGCAGTTGTCACCGC
CGTTGCCACGTGACAGGCATCATGACAACAATTCTATCCTGGTAGCGCTG
CGGGCCATGAATACCTGCCTGCCATTCATTAAGCATGCATCCAATCGATT
CCAGAAAATTTCCCTCGCTTGTTATGCTCAATCTGTGTTTCAAAGCGGCC
TGTCTCACATTGATCCAATCATTCGCCATTGGAGCGCTCGCGTCCTCGCC
ATGCTCGTTATGCCTCAATCGGCAGCTGACAATATAGAATTATCATCCAA
ATTGCTCGATTTGATTCTCCTCGGCGACGCTTTGAAAGCTCTAGAAATGA
CTCTCAATGAAAAACTGTGCTACGGAGCAATTGAGCTCATATATCTTGTG
TGCCACAGTGGCCTGTTGCCATACCGACTGGCTATTGCTGTTATCATTCT
CCCAGTCGTGCTGGCCTGTCTGAATGCTCCATTCGATCCATTGCGTCGCG
TTGCTACTCACGTGTTCTCTCTGCTACTCACATTGCTACCTCTCGAGTCG
TCTGGGGCTGATCTATCGATCTTGACGCCAGCTAGACAGCAACAGCGCAA
ACAGCATCTCTCATTTCTTGACAGCCTATTGAATCCGAAGTTAATTGGCC
AATATAATGCACACCACAGCGTTGTGAGCGCCAAATTGCGCCAATACCAG
GAGGAGGGAGTCAATTGGCTGGGATTCCTCAATCGGTACGGTCTCCATGG
AGTCCTAGCTGACGATATGGGACTGGGCAAGACGCTGCAAGCGATATGTG
TGATAGCTGGAGAGTACAGCCGAGCACCGAGCACGTGCCCGCCATCACTC
ATTGTCTGTCCGCCCACACTCACTGTGCATTGGCACCAGGAATTCAAAAA
ATTTCTCGTAAATCTGCCCGATTTCAACACGATCGTCTATCTGGGAACTC
CTATGTACCGCCAGTGCATATTTAATAGTCTCTCGCGCTACCAGGTTGTT
ATCACATCGTATGACACGCTCCGCAGTGATATGAATTTGCTTGCCAGACC
GACATTCCCTCGATGCGGTACCGATGTTACCAAGGGCTCGCTTATGGCGA
ACAGCAACGTTTGGAACTATGTTGTGCTCGATGAGGGACATCTCATACGC
AATTACAAGAGCAAGGTTGCCGTAGCAACAAGGGCGCTGTGTGCACGGCA
CCGGCTGGTGCTCACCGGTACCCCGATACAGAACAGAGTCGGCGAGTTGT
GGTCGCTATTTGATTTCCTGATGCCCGGATTATTGGGAACGTGTACAGAG
TTCAACCGGCGCTACGGACGCGTCCTGGAGCAAAATGGTTCAAATTCCGG
CAGGAAAGTCGACAGTGAAGCGGGCACTCTCGCCCTTGAATTGTTGCATC
GGCAAGTGCTGCCATTTATGTTGCGACGGGTAAAGGATGATGTGCTCCAG
GAGTTGCCGCCCAAGATCATGCAGGATTACATGTGCACTATGAGCCCGTT
ACAATTGCGCCTCTACACTCATTGCATGGAGTCCCAGGCGGCCACTGACA
CAGATTTCGTCGAGCTCGTGGACAAGAGCTACAAGGAGAACTCGGCAATC
AATCAACATCGACATGGATTCCAGACAATGCACTATTTGCGGCTGGTGTG
CAATCATCCGAGCTTGGGGCTAACCAGTAGTCACCCGTTGTACCGCACGC
TCATGAGGGAGCTCGCTGCCAATAATCAATGTCTCGATGACATCAATCTG
TCTGGAAAACTCGTAGCTTTGAGGCAGCTGATTCTGGACTGTGGCGTCGG
TGTTAGCGGTGCCGGCGAGGAGGAGTTGGATGAGACGAGTGTTGTTGCTA
GCAATCGGTTGCTAGTGTTCTGCCAGTCGATCAAAATGATGGAGTTGGTG
GATAAAATGATTCGCAACGAGATTCCAAAGGCAACTCACCTACGGCTGGA
TGGCTCGGTACCAGCGAAAGACAGACAACAAATAGTCGAAAAATTCAGCT
GTGACGCATCTATTGATATATTGCTATTGACAACGAGTATCGGTGGCCTC
GGGCTCAACCTGACATCGGCAAACATCGTGATATTTGTTGAGCATGACTG
GAATCCGATGCGAGATCTGCAAGCAATGGATCGGGCTCATCGGATCGGAC
AAAAGCACACAGTCATTGTTTATCGATTGATTACGGCACAATCGATAGAG
GAAAAGATAATGAATCTGCAGGAATTCAAAAAGTTTCTGGCCAATGCAGT
GGTTAGCAAAGACAACAACCAAATGGCCTCCATGAACACTGAGAATATTC
TGGAAATCATGAACAAGGAAGCCAATTGGCCGACACAATCCCCCCCAGCA
TCGGCAAACGGCAAACAGAAAGTGGTCAGCTCAGTGAGTGGTGGTACAGA
AACTCAACTCGGATCGAAATCGGTGCTCAGTAAGATCAGCAAAGCAGACA
GTGGCGAGCGCGTATACGATTGTCTCGATGAATACGATCAAGAATATAAT
TTGGATAGTTTTGTAAAGAAATTATAAAAAACATTGTAGTTGCTTTATTT
CTTTGTTATGAATGCGTTTACTTAATATGGGGCCTGCTAACTATTGATTA
ATCAGCTGTTGCACATTATTTGGCATGACGAATTTTTCCATTTATCAGAT
TTGTGGAATTATAGCACAAATGATTGCAATCCGTTTAGGATTTACTAATT
TGTGCAATAGTTTTTGTTTAGATTAATTTTGTGCTACTCTTCATTTGCAG
CTGTGTTAGATCCTTCACTAGTGTTTAAGAGAAAAGTCGTGAAAAAATTC
TTATCCAAACCAACTGTCATCAGCTGTATCTTCATTGTGAATATTGTATT
TATGCAAATTTGTGATTGCTAATTATATGTGTCTGACGTATTCCAATCTC
GGATGAAATTTCTACATATTGCGGTAGTTGTTTGTTTACAAGTAATTCAT
GTTAAATATTTGTTATTTCTCTTGTCTTTGCTCCAGGCATATATCTAGTT
AGCATTTACTTAATGAAAAGTAAGATTCTTGCTTTCAAAAAATTCCCTTT
TCTCAGGCAACCTAGAAACTTTATTAATGTAAATACTAATTATGGGATAC
GTAACTCATTGATATTTTTATGGGAAATTGTTATTAGAAATTTACTGAAC
TAGATTGTACAGGTATG
back to top

protein sequence of SMED30028815-orf-1

>SMED30028815-orf-1 ID=SMED30028815-orf-1|Name=SMED30028815-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1816bp
MASRLDKLFELLESNHQNIRNAAAIQIGQLSANNQVNISALLAKLLPYAK
HKIWVVRIAASDAVRHIGNNAKLWVPGTSESNVTNVSNLINLENLNLHDI
LKIGTRLYSRDFKDLDEANTNQNINRDELARHLGFLIPDECEIKNLITVK
DCELVESKSENKMSVELAVMKSMENSPKKPVKRPHEEVQDVNEPGTKMKC
VEKIGNETERERNTEWPWVDFCEELLKNLWDAKWEIRHGAATCLRELIRS
QGSIMLPKNANISSTDKFAACHERFQEEIVVRLLCTLTLDQLSDFVSDEM
VAPVRESCAQALGVISVHLTRRLVEILANQLLSLLNHDEWRVNHGALLGL
KYLLAARMDLVEVLLPIIYDPISSHLKGNCDDDVRCAAVAALMPLFGDCC
SNTVAISNEELDTLKTDLWDVLAVRIDCTTSGATCAVLQLLERLYEKCNV
VYNQSEDQPMATDRVKALNEYINRLHWCYFNYSDLVRLAAVRTCRAVLQS
IGIKVGTILEHGTILQVLSQLVQRVLIDDNCQVAAEAHSVWNQFIDSLPE
QLLARVSCERLEIWMCSAMQPARLSYTPGSILMPDYIITTAAGAAATVVG
DGLDEDDGNKHHILTEFYIGGRESFITDGSSAARDDLVLRARLAACQLLA
RLCQRFIFHEAGIRNILISIIAQIHLKDRLAVQRFVASMILAYWDPDHLL
AMRNLNDCSLSPLQSQLLTALEEPIYYQEILSQFKQMHKACRDLILIYIE
REIPLPPSIMNAVGPNASPVSIALNISQCQSLISSEMCSLCPPESMTTFS
CATAAVDTCAQQHATLCRLVDIAVGRALLQWGWLPLKLTPLIKPLISAVR
SETCVTLQTEACIALAQLVVDHNSQTRLLAPVTKLVKNLIQYQSEAIDSL
ATMQPHEVEQGEIVAIYKTSQLGREAFPRQEDNGTAVAIDNDVMIKLRGS
RLALEKIYSRFVSSSESDLDHSFLMEIIYHAPLQLLQLSPPLPRDRHHDN
NSILVALRAMNTCLPFIKHASNRFQKISLACYAQSVFQSGLSHIDPIIRH
WSARVLAMLVMPQSAADNIELSSKLLDLILLGDALKALEMTLNEKLCYGA
IELIYLVCHSGLLPYRLAIAVIILPVVLACLNAPFDPLRRVATHVFSLLL
TLLPLESSGADLSILTPARQQQRKQHLSFLDSLLNPKLIGQYNAHHSVVS
AKLRQYQEEGVNWLGFLNRYGLHGVLADDMGLGKTLQAICVIAGEYSRAP
STCPPSLIVCPPTLTVHWHQEFKKFLVNLPDFNTIVYLGTPMYRQCIFNS
LSRYQVVITSYDTLRSDMNLLARPTFPRCGTDVTKGSLMANSNVWNYVVL
DEGHLIRNYKSKVAVATRALCARHRLVLTGTPIQNRVGELWSLFDFLMPG
LLGTCTEFNRRYGRVLEQNGSNSGRKVDSEAGTLALELLHRQVLPFMLRR
VKDDVLQELPPKIMQDYMCTMSPLQLRLYTHCMESQAATDTDFVELVDKS
YKENSAINQHRHGFQTMHYLRLVCNHPSLGLTSSHPLYRTLMRELAANNQ
CLDDINLSGKLVALRQLILDCGVGVSGAGEEELDETSVVASNRLLVFCQS
IKMMELVDKMIRNEIPKATHLRLDGSVPAKDRQQIVEKFSCDASIDILLL
TTSIGGLGLNLTSANIVIFVEHDWNPMRDLQAMDRAHRIGQKHTVIVYRL
ITAQSIEEKIMNLQEFKKFLANAVVSKDNNQMASMNTENILEIMNKEANW
PTQSPPASANGKQKVVSSVSGGTETQLGSKSVLSKISKADSGERVYDCLD
EYDQEYNLDSFVKKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR011989ARM-like
IPR027417P-loop_NTPase
IPR022707DUF3535
IPR000330SNF2_N
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0005488binding