Transient receptor potential cation channel subfamily M member-like 2

Overview
NameTransient receptor potential cation channel subfamily M member-like 2
Smed IDSMED30028809
Length (bp)3462
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel subfamily M member-like 2 (SMED30028809) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member-like 2 (SMED30028809) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel subfamily M member-like 2 (SMED30028809) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member-like 2 (SMED30028809) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028809

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30028809SMESG000004955.1 dd_Smed_v4_8493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028809SMESG000004955.1 dd_Smed_v4_8493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028809SMESG000004955.1 dd_Smed_v4_8493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30028809SMESG000004955.1 dd_Smed_v4_8493_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Human
Match: TRPM2 (transient receptor potential cation channel subfamily M member 2 [Source:HGNC Symbol;Acc:HGNC:12339])

HSP 1 Score: 257.684 bits (657), Expect = 1.578e-69
Identity = 248/966 (25.67%), Postives = 441/966 (45.65%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIE---KGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFER----NVRDIGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEI--LETDKMNVEIVDK-----YEEQLR-LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDR------NLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ--------ENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI-NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGEL--MLDDFKI-PSPCNT-------TVCIVQSAT----------LIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPP 3079
            Y L+T++W    P LLIS+ GG K  N K   +    + GL++V +    WII GG H G+ K V EAV DF + S   E ++  I ++TWG V     L   T ++     ++   +G +T LD N+  ++  DDGT  +Y  EI  R   E+      ++ G  A++I     + EGG   + +I  +     P VV++ SGR AD+I ++  L    + + ++ +     ++E     T+   +   + + DI    +      +  D    +D  IL A++ +   +      N +  L LAV +N VDIA  ++F        S   L       L  N+ E ++LFL N   + EFV         ENL    +   +       +++ +L+    +       +N    LL  +  +  N+    L+  S   RSS       +  R+L +W+++    E+A I W   ++ + +AL  S IL ++    K +   D S+ +L  + +++  A  + T+ Y+ ++E+   +LTR    W   TCLQ+A+    + F++    +++  + W G LS     W++ + +   PLL+   I                       F +++++                  D  +       F+ AP+V F + +LSY  FL +FAY+ +V+ +P+           E  +Y+++   + EE+ Q+  + ++ GL+ K   Y S  WN  D+  I +F+  +  R      +    R   ++   LF LR M  + IS+++GPK+I++++M+ DVFFFL + +++++S+G    +I   N +   +L     Y  Y   +G++   +D     P  C+          C    AT           ++   ++LL TNILLLNLLIAMF YTF ++Q  +++ + F +  L++E+H +P  PPP
Sbjct:  155 YHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSD--LHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKLNVQGVSLR--SLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELS---KEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLIS----------------------FREKRLQ------------------DVGTPAARARAFFTAPVVVFHLNILSYFAFLCLFAYVLMVDFQPVPS-------WCECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPA--TLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNERRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPP 1063          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Human
Match: TRPM2 (transient receptor potential cation channel subfamily M member 2 [Source:HGNC Symbol;Acc:HGNC:12339])

HSP 1 Score: 255.373 bits (651), Expect = 1.008e-68
Identity = 254/987 (25.73%), Postives = 446/987 (45.19%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIE---KGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFER----NVRDIGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEI--LETDKMNVEIVDK-----YEEQLR-LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDR------NLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ--------ENLQD--LYMTSLRSI------KCRCTEMISDL-------ILRE------DKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI-NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGEL--MLDDFKI-PSPCNT-------TVCIVQSAT----------LIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPP 3079
            Y L+T++W    P LLIS+ GG K  N K   +    + GL++V +    WII GG H G+ K V EAV DF + S   E ++  I ++TWG V     L   T ++     ++   +G +T LD N+  ++  DDGT  +Y  EI  R   E+      ++ G  A++I     + EGG   + +I  +     P VV++ SGR AD+I ++  L    + + ++ +     ++E     T+   +   + + DI    +      +  D    +D  IL A++ +   +      N +  L LAV +N VDIA  ++F        S   L       L  N+ E ++LFL N   + EFV         ENL    L+ + L+ +      +  C      L       +LRE         +     N+  + LL V +     L+   +   S   RSS       +  R+L +W+++    E+A I W   ++ + +AL  S IL ++    K +   D S+ +L  + +++  A  + T+ Y+ ++E+   +LTR    W   TCLQ+A+    + F++    +++  + W G LS     W++ + +   PLL+   I                       F +++++                  D  +       F+ AP+V F + +LSY  FL +FAY+ +V+ +P+           E  +Y+++   + EE+ Q+  + ++ GL+ K   Y S  WN  D+  I +F+  +  R      +    R   ++   LF LR M  + IS+++GPK+I++++M+ DVFFFL + +++++S+G    +I   N +   +L     Y  Y   +G++   +D     P  C+          C    AT           ++   ++LL TNILLLNLLIAMF YTF ++Q  +++ + F +  L++E+H +P  PPP
Sbjct:  155 YHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSD--LHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPH---VKLNVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELS---KEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLIS----------------------FREKRLQ------------------DVGTPAARARAFFTAPVVVFHLNILSYFAFLCLFAYVLMVDFQPVPS-------WCECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPA--TLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNERRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPP 1083          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Human
Match: TRPM2 (transient receptor potential cation channel subfamily M member 2 [Source:HGNC Symbol;Acc:HGNC:12339])

HSP 1 Score: 254.988 bits (650), Expect = 1.375e-68
Identity = 254/987 (25.73%), Postives = 446/987 (45.19%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIE---KGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFER----NVRDIGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEI--LETDKMNVEIVDK-----YEEQLR-LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDR------NLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ--------ENLQD--LYMTSLRSI------KCRCTEMISDL-------ILRE------DKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI-NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGEL--MLDDFKI-PSPCNT-------TVCIVQSAT----------LIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPP 3079
            Y L+T++W    P LLIS+ GG K  N K   +    + GL++V +    WII GG H G+ K V EAV DF + S   E ++  I ++TWG V     L   T ++     ++   +G +T LD N+  ++  DDGT  +Y  EI  R   E+      ++ G  A++I     + EGG   + +I  +     P VV++ SGR AD+I ++  L    + + ++ +     ++E     T+   +   + + DI    +      +  D    +D  IL A++ +   +      N +  L LAV +N VDIA  ++F        S   L       L  N+ E ++LFL N   + EFV         ENL    L+ + L+ +      +  C      L       +LRE         +     N+  + LL V +     L+   +   S   RSS       +  R+L +W+++    E+A I W   ++ + +AL  S IL ++    K +   D S+ +L  + +++  A  + T+ Y+ ++E+   +LTR    W   TCLQ+A+    + F++    +++  + W G LS     W++ + +   PLL+   I                       F +++++                  D  +       F+ AP+V F + +LSY  FL +FAY+ +V+ +P+           E  +Y+++   + EE+ Q+  + ++ GL+ K   Y S  WN  D+  I +F+  +  R      +    R   ++   LF LR M  + IS+++GPK+I++++M+ DVFFFL + +++++S+G    +I   N +   +L     Y  Y   +G++   +D     P  C+          C    AT           ++   ++LL TNILLLNLLIAMF YTF ++Q  +++ + F +  L++E+H +P  PPP
Sbjct:  155 YHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSD--LHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPH---VKLNVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELS---KEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLIS----------------------FREKRLQ------------------DVGTPAARARAFFTAPVVVFHLNILSYFAFLCLFAYVLMVDFQPVPS-------WCECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPA--TLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNERRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPP 1083          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Human
Match: TRPM2 (transient receptor potential cation channel subfamily M member 2 [Source:HGNC Symbol;Acc:HGNC:12339])

HSP 1 Score: 254.988 bits (650), Expect = 1.375e-68
Identity = 254/987 (25.73%), Postives = 446/987 (45.19%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIE---KGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFER----NVRDIGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEI--LETDKMNVEIVDK-----YEEQLR-LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDR------NLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ--------ENLQD--LYMTSLRSI------KCRCTEMISDL-------ILRE------DKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI-NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGEL--MLDDFKI-PSPCNT-------TVCIVQSAT----------LIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPP 3079
            Y L+T++W    P LLIS+ GG K  N K   +    + GL++V +    WII GG H G+ K V EAV DF + S   E ++  I ++TWG V     L   T ++     ++   +G +T LD N+  ++  DDGT  +Y  EI  R   E+      ++ G  A++I     + EGG   + +I  +     P VV++ SGR AD+I ++  L    + + ++ +     ++E     T+   +   + + DI    +      +  D    +D  IL A++ +   +      N +  L LAV +N VDIA  ++F        S   L       L  N+ E ++LFL N   + EFV         ENL    L+ + L+ +      +  C      L       +LRE         +     N+  + LL V +     L+   +   S   RSS       +  R+L +W+++    E+A I W   ++ + +AL  S IL ++    K +   D S+ +L  + +++  A  + T+ Y+ ++E+   +LTR    W   TCLQ+A+    + F++    +++  + W G LS     W++ + +   PLL+   I                       F +++++                  D  +       F+ AP+V F + +LSY  FL +FAY+ +V+ +P+           E  +Y+++   + EE+ Q+  + ++ GL+ K   Y S  WN  D+  I +F+  +  R      +    R   ++   LF LR M  + IS+++GPK+I++++M+ DVFFFL + +++++S+G    +I   N +   +L     Y  Y   +G++   +D     P  C+          C    AT           ++   ++LL TNILLLNLLIAMF YTF ++Q  +++ + F +  L++E+H +P  PPP
Sbjct:  155 YHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSD--LHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPH---VKLNVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELS---KEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLIS----------------------FREKRLQ------------------DVGTPAARARAFFTAPVVVFHLNILSYFAFLCLFAYVLMVDFQPVPS-------WCECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPA--TLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNERRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPP 1083          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Human
Match: TRPM5 (transient receptor potential cation channel subfamily M member 5 [Source:HGNC Symbol;Acc:HGNC:14323])

HSP 1 Score: 245.358 bits (625), Expect = 6.304e-66
Identity = 241/1034 (23.31%), Postives = 484/1034 (46.81%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVG----TCAYDNSNTIEKGKV-TLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI-----GAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIV--DKYEEQL---RLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVH-LDKKILDAIIS-----SREDRNLEKTLNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKI-----------DNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNA--------------------NQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIEL-NIRKKSPKSWKSYHSESDQVSFCRALI----KFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQ-INNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDF-KIPSPCNTTVCIVQSATLIIGF----------GIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFE 3217
            ++L+   W+ P P L++S+ G  ++     +  +   ++GL++  +    WI+     VG+ + V +AV D  + S   + +V  + +++ G V + R L          Y   +   +G + +LD N   ++  + G   + D   + RL  E+++ +      G  +++I     L  G    +E I R+++++ P +++  SG  AD++  ++    + V  V   +++E+      + +D +R  ++L +I S ++  +T++D   +    LD  IL A++      S+E ++    L LAV ++ VDIA  ++F      ++  L +  +     + L  N+ E ++LF+ N   + +F+    LQ+LY +  R        ++ DL+ R+ +  ++           +    P    L  + +++ +   +  +    + R  +   A                    ++N +R+LFLW+++    EMA  FW  G+E V +AL    IL +M                     K++ LA D+ ++ Y  ++ +   +L R    W+  TCL +A   +   F   +  +++    W GD++   P  ++L      P L+   +I +       + L  E ++D    + EK  L  ++ +  +  ++  ++ D+      L+    KF+ AP+  F+  ++ Y  FL +F Y+ LV+ +P  +      VT    +Y ++   ++EEI Q     E   L+ K   YV  +WN  DM+ IF+FI+ +  R   +  +F   R   A+   +F+LR +  + I + +GPK+I++ +M+ DVFFFL   S+++++YG  + ++ +P+     ++   + YRPY Q +G++ LD+  +    C+T   +++ +                  FLL+TN+LL+NLLIAMF YTF  +QG ++ F+ F +  L+ E+H +P + PP    + +L  L  + + +F  +++ K   L + L D  + K+  +E
Sbjct:   53 FDLLLAEWHLPAPNLVVSLVGE-EQPFAMKSWLRDVLRKGLVKAAQSTGAWILTSALRVGLARHVGQAVRDHSLASTSTKVRVVAVGMASLGRVLHRRILEEAQEDFPVHYPEDDGGSQGPLCSLDSNLSHFILVEPGPPGKGDGLTELRLRLEKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILVGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDIVRWTKLLQNITS-HQHLLTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLDELKLAVAWDRVDIAKSEIFNGDVEWKSCDLEEVMV-----DALVSNKPEFVRLFVDNGADVADFLTYGRLQELYRSVSRK------SLLFDLLQRKQEEARLTLAGLGTQQAREPPAGPPAFSLHEVSRVLKDFLQDACRGFYQDGRPGDRRRAEKGPAKRPTGQKWLLDLNQKSENPWRDLFLWAVLQNRHEMATYFWAMGQEGVAAALAACKILKEMSHLETE-----AEAARATREAKYERLALDLFSECYSNSEARAFALLVRRNRCWSKTTCLHLATEADAKAFFAHDGVQAFLTRIWWGDMAAGTPILRLLGAF-LCPALVYTNLITFSEEAPLRTGL--EDLQDLDSLDTEKSPLYGLQSRVEELVEAPRAQGDRGPRAVFLLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSGPEVT----LYFWVFTLVLEEIRQGFFTDEDTHLVKKFTLYVGDNWNKCDMVAIFLFIVGVTCRMLPS--AFEAGRTVLAMDFMVFTLRLIHIFAIHKQLGPKIIVVERMMKDVFFFLFFLSVWLVAYGVTTQALLHPHDGRLEWIFRRVLYRPYLQIFGQIPLDEIDEARVNCSTHPLLLEDSPSCPSLYANWLVILLLVTFLLVTNVLLMNLLIAMFSYTFQVVQGNADMFWKFQRYNLIVEYHERPALAPP----FILLSHLSLTLRRVFKKEAEHKREHLERDLPDPLDQKVVTWE 1055          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Celegans
Match: gtl-2 (Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:Q20766])

HSP 1 Score: 172.17 bits (435), Expect = 4.680e-43
Identity = 247/1122 (22.01%), Postives = 476/1122 (42.42%), Query Frame = 2
Query:  212 SNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGT--CAYD-NSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDIGAFAVQI-----LYEGGKRAIESI--YRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSD---IYSNYKERITIHDLL-------DQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQEN-LQDLY----MTSLRSIK-------------CRCTEMISDLILR-EDKSFKIDNINNPGKNLLKVIYKIICNLS-----DNILKFESFNLRSSNSHNANQNS-------YRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDT--LLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIR-----KKSPKSWK-------------------------SYHSESDQVSFCRA--------LIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVE--LKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFV--------RCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSK-WNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGF-------GIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNI---AYYILRKLWQSGKIIFHGDSKR-KNTFLIKY-LNDDQNLKIRGFEHLCMES 3235
            +  S    FG I F G          Q++R       ++     +   L+ K W    P+L+I+++GG      +    +   K G+++  +    WII  G   G+ + V++A+++  I S    +Q+  I I+ WGV+K    L        YD +S ++      L+  +  +L  D+GT   +  ++  R + E ++   G    ++     L EGG  +I +I  Y +++  IP +V   SGRAAD+I         +     +  E+LR    + I+++   +D   ++    E +   DLL       ++   +D  IL  ++  +++   ++ L L + +N VD+A   +F + R    S   L     + L  ++ + ++  L N  S+  F+  N L++LY    + S  S++                  MI  ++ +    +F++   +   K      YK I   S       I++ E F  +S +  N N+         + +L +W++++    MA   W +G++ +   L+ +I L K  + I    + D+ +   L   ++K +E A +++ + Y+ + ++T  +L   L  W N  CL +A+  N   FL    C+    E W G L     +   ++T    P  I    + Y       + L  E+  ++  + +E I           K P+  K                         S +  +  + F R            FY +PI KF  + ++++ FL     + L+E  LKP K          E + +I+ +   VE I ++  +E + +  K+K + +  +N++          S  + F + G  F  V        R   + +  LF ++  ++  +   +GP + M  KM+  + +   +  + ++++G    ++  PN K W+  L+  +FY+PYF  YGE+   +           C  +      G+        IFLL+ NILLLNLLIA+F   +N    +S++ + F + Q + E+H+ P +PPP +I    Y+ +  L+     +   D+KR ++   IK  + +D+  +I+ FE  C+++
Sbjct:  148 TQTSTTDAFGTIVFQGGAHAH---KAQYVRL------SYDSEPLDVMYLMEKVWGLEAPRLVITVHGGMSNFELEERLGRLFRK-GMLKAAQTTGAWIITSGLDSGVVRHVAKALDEAGI-SARMRSQIVTIGIAPWGVIKRKERLIRQNEHVYYDVHSLSVNANVGILNDRHSYFLLADNGTVGRFGADLHLRQNLENHIATFGCNGRKVPVVCTLLEGGISSINAIHDYVTMKPDIPAIVCDGSGRAADIISFAARYINSDGTFAAEVGEKLR----NLIKMVFPETDQEEMFRKITECVIRDDLLRIFRYGQEEEEDVDFVILSTVL-QKQNLPPDEQLALTLSWNRVDLAKSCLFSNGRK--WSSDVLEKAMNDALYWDRVDFVECLLENGVSMKNFLSINRLENLYNMDDINSAHSVRNWMENFDSMDPHTYLTIPMIGQVVEKLMGNAFQLYYTSRSFKGKYDR-YKRINQSSYFHRKRKIVQKELFKKKSDDQINDNEEEDFSFAYPFNDLLIWAVLTSRHGMAECMWVHGEDAMAKCLL-AIRLYKATAKIAEDEYLDVEEAKRLFDNAVKCREDAIELLDQCYRADHDRTLRLLRMELPHWGNNNCLSLAVLANTKTFLAHPCCQILLAELWHGSLKVRSGSNVRVLTALICPPAI--LFMAYKPKHSKTARLLSEETPEQLPYPRESITSTTSNRYRYSKGPEEQKETLLEKGSYTKKVTIISSRKNSGVASVYGSASSMMFKREPQLNKFERFRAFYSSPITKFWSWCIAFLIFLTTQTCILLLETSLKPSK---------YEWITFIYTVTLSVEHIRKLMTSEGSRINEKVKVFYAKWYNIW---------TSAALLFFLVGYGFRLVPMYRHSWGRVLLSFSNVLFYMKIFEYLSVHPLLGPYIQMAAKMVWSMCYICVLLLVPLMAFGVNRQALTEPNVKDWHWLLVRNIFYKPYFMLYGEVYAGEID--------TCGDEGIRCFPGYFIPPLLMVIFLLVANILLLNLLIAIFNNIYNDSIEKSKEIWLFQRYQQLMEYHDSPFLPPPFSIFAHVYHFIDYLYN----LRRPDTKRFRSEHSIKLSVTEDEMKRIQDFEEDCIDT 1217          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Celegans
Match: gtl-1 (GTL-1; Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:G5ECM4])

HSP 1 Score: 95.1301 bits (235), Expect = 2.068e-19
Identity = 111/456 (24.34%), Postives = 203/456 (44.52%), Query Frame = 2
Query:  233 TFGKIKFLG------YEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKN-------NRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFER-----NVRDIGAFAVQILYEGGKRAIESI--YRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQL-----RLTDDDKIRIIEILSDIY--SNYKERITIHDLLDQNVH-LDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYK 1513
             +G I F G      Y  IS +++P+ I                   L+ K W    P+L+I+INGG  +      +  + F++G+M++ +    WII  G   G+ K +  A++D    +  ++N V  I I++WG++K        + ++T  T  ++N+   E     L+ N+  +LF D+GT   Y  EI  R   E      + +      V ++ EGG   I+ +  Y +    IP++V   SGRAAD++    +    N  + D    QL     R+   D     +++  I   S  K  +TI  L + +   LD  I+  ++   ++ +  + L LA+ +N  DIA  ++F  +  +  + + L     E LS ++ + + L L N  S+ +F+    L+ LY T     K     + ++L++      K+  +    +NL+  +YK
Sbjct:  195 AYGNIVFEGTAHHAQYARISFDSDPRDI-----------------VHLMMKVWKLKPPKLIITINGGLTKF-DLQPKLARTFRKGIMKIAKSTDAWIITSGLDEGVVKHLDSALHDHG--NHTSKNHVVAIGIASWGMLKQRSRFVGKDSTVTYATNVFNNTRLKE-----LNDNHSYFLFSDNGTVNRYGAEIIMRKRLEAYLAQGDKKRSAIPLVCVVLEGGAFTIKMVHDYVTTIPRIPVIVCDGSGRAADILAFAHQAVSQNGFLSDNIRNQLVNIVRRIFGYDPKTAQKLIKQIVECSTNKSLMTIFRLGESSREDLDHVIMSCLLKG-QNLSPPEQLQLALAWNRADIARTEIF--ANGTEWTTQDLHNAMIEALSNDRIDFVHLLLENGVSMQKFLTYGRLEHLYNTD----KGPQNTLRTNLLVDSKHHIKLVEVGRLVENLMGNLYK 618          

HSP 2 Score: 86.6557 bits (213), Expect = 9.659e-17
Identity = 102/431 (23.67%), Postives = 201/431 (46.64%), Query Frame = 2
Query: 2117 DKFLFEKEKIELNIRKKSPKSWKSYHSESDQV------SFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNT----EKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSF--IFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELML--------------DDFKIP-SPCNTT--VCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI--LRKLWQSGKIIFHGDSKRKNTF---LIKYLNDDQNLKIRGFEHLCMESAMLENHQSTNVANINLNSDNLFDT 3307
            D ++   E+++   R+KS + + S  + + QV      S+ + +++FY+API  + ++  ++I FL++  Y  LV+ + I          +E  V+ +I  + +E   ++ +T        ++ +L+ +     N      +  ++I+  +R +    +   I + C   +    +SL+ + +  + + +GP + ++ +MI  +     +  + + ++G L  SI  P   W+  L+  +F +PYF  YGE+                +D  IP S  N T   C+       +G  +F+L TN+LL+N+++A   Y F K    + + F F +   V E+ + P +PPP  I Y++  L KL +S   +F    +RKN F   L  +L+ D+  K+  FE   +E    E    T   N++ N + +  T
Sbjct: 1027 DMYIDPSEELDTQTRQKSSREFSSSRNVTVQVYTQRPLSWKKKIMEFYKAPITTYWLWFFAFIWFLILLTYNLLVKTQRIASW-------SEWYVFAYIFVWTLEIGRKVVSTIMMDTSKPVLKQLRVFFFQYRNGLLAFGLLTYLIAYFIRLSPTTKTLGRILIICNSVI----WSLKLVDYLSVQQGLGPYINIVAEMIPTMIPLCVLVFITLYAFGLLRQSITYPYEDWHWILVRNIFLQPYFMLYGEVYAAEIDTCGDEIWQTHEDENIPISMLNVTHETCVPGYWIAPVGLTVFMLATNVLLMNVMVAGCTYIFEKHIQSTREIFLFERYGQVMEYESTPWLPPPFTIIYHVIWLFKLIKSSSRMF----ERKNLFDQSLKLFLSPDEMEKVHTFEEESVEDMKRE----TEKKNLSSNDERIHRT 1438          

HSP 3 Score: 65.0846 bits (157), Expect = 3.035e-10
Identity = 37/130 (28.46%), Postives = 66/130 (50.77%), Query Frame = 2
Query: 1601 YRELFLWSLISGYTEMALIFWENGKENVGSALIGS-IILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDL 1987
            Y +L +W++++   +MA + W +G+E +  AL+ S + +S  K+   + G   MS    + S +F ELA +++    K  +++T  +LT  L  W + TCL +A       FL    C+    + W G L
Sbjct:  717 YSDLMIWAVLTKRQKMAKLMWTHGEEGMAKALVASRLYVSLAKTASLATGEIGMSQDFTEFSDEFSELAVEVLEYCTKHGRDQTLRLLTCELANWGDETCLSLAANNGHRKFLAHPCCQMLLSDLWQGGL 846          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 87.8113 bits (216), Expect = 3.859e-17
Identity = 98/387 (25.32%), Postives = 177/387 (45.74%), Query Frame = 2
Query: 2207 QVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLS---------LFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGI------------------FXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNT---FLIK-YLNDDQNLKIRGFEHLCMESAMLENHQSTNVAN 3274
            ++   R   +FY API  F  + +S+I F+  F Y  LV+  P   V        E ++  ++  F +E++ +I  ++      K+++YV   WN   +L I          F + G    F+RCF +V            L++++ + +  +   +GP V M  KMI ++ + + +  + ++S+G    SI  P+  W+  L+  +F +PYF  YGE+  D+            +     +I+G G                   FLL+ NILL+++LIA+F + F+     S++ + F + + V E+ + P +PPPL   Y+ +  L      +    S+ +N    F +K +L++DQ  K+  FE  CME    +     N +N
Sbjct:  886 KIKMRRRFYEFYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTV-------IEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAII---------FYIVG---FFMRCFGSVAYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEYESTPFLPPPLTPLYHGVLILQFVRTRLSCSKSQERNPMFDFSLKLFLDNDQIEKLHDFEEDCMEDLARQKLNEKNTSN 1253          

HSP 2 Score: 77.0258 bits (188), Expect = 7.265e-14
Identity = 94/368 (25.54%), Postives = 165/368 (44.84%), Query Frame = 2
Query:  356 LITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVG---TCAYDNSNTIEKGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI-----GAFAVQIL---YEGGKRAIESI--YRSLQKSIPLVVIKESGRAADLIC--------EILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVH-LDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMT 1387
            L    W    P+L+I+++GG    + +    +   K GL++       WII  G   G+ K V+ A+   +       N++  I I+ WG++K      +G   T  Y  S++  KG+ T L+  +  +L  D+GT   Y  E+  R   E  +        G  +V ++    EGG   I S+  Y +    +P+VV   SGRAADL+         + L  D +  +++   E     ++    R++  L+ + + +K  +TI  L +Q  H +D  IL A++   ++ +    L LA+ +N VDIA   VF  +      Q  L     E L  ++ + ++L L    ++ +F+    L +LY T
Sbjct:    3 LFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRK-GLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQ---SAQRNKIVCIGIAPWGLLKKREDF-IGQDKTVPYYPSSS--KGRFTGLNNRHSYFLLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFAHQNVTEDGLLPDDIRRQVLLLVETTFGCSEAAAHRLLHELT-VCAQHKNLLTIFRLGEQGEHDVDHAILTALLKG-QNLSAADQLALALAWNRVDIARSDVF--AMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNT 359          

HSP 3 Score: 63.5438 bits (153), Expect = 9.669e-10
Identity = 35/134 (26.12%), Postives = 71/134 (52.99%), Query Frame = 2
Query: 1601 YRELFLWSLISGYTEMALIFWENGKENVGSALIG-----SIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDL 1987
            Y EL +W++++   +MA+  W++G+E +  AL+      S+     + Y++     ++ + L K + +F+ L+ +++   Y ++  +T  +LT  L+ W+N TCL +A+  N   FL    C+    + W G L
Sbjct:  547 YSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEV----EICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGL 676          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 87.0409 bits (214), Expect = 6.519e-17
Identity = 98/387 (25.32%), Postives = 177/387 (45.74%), Query Frame = 2
Query: 2207 QVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLS---------LFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGI------------------FXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNT---FLIK-YLNDDQNLKIRGFEHLCMESAMLENHQSTNVAN 3274
            ++   R   +FY API  F  + +S+I F+  F Y  LV+  P   V        E ++  ++  F +E++ +I  ++      K+++YV   WN   +L I          F + G    F+RCF +V            L++++ + +  +   +GP V M  KMI ++ + + +  + ++S+G    SI  P+  W+  L+  +F +PYF  YGE+  D+            +     +I+G G                   FLL+ NILL+++LIA+F + F+     S++ + F + + V E+ + P +PPPL   Y+ +  L      +    S+ +N    F +K +L++DQ  K+  FE  CME    +     N +N
Sbjct: 1231 KIKMRRRFYEFYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTV-------IEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAII---------FYIVG---FFMRCFGSVAYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEYESTPFLPPPLTPLYHGVLILQFVRTRLSCSKSQERNPMFDFSLKLFLDNDQIEKLHDFEEDCMEDLARQKLNEKNTSN 1598          

HSP 2 Score: 80.4925 bits (197), Expect = 6.991e-15
Identity = 103/420 (24.52%), Postives = 181/420 (43.10%), Query Frame = 2
Query:  224 ACKTFGKIKFLG--------YEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVG---TCAYDNSNTIEKGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI-----GAFAVQIL---YEGGKRAIESI--YRSLQKSIPLVVIKESGRAADLIC--------EILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVH-LDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMT 1387
            A   FG+++F G        Y  ++ +T P +I                   L    W    P+L+I+++GG    + +    +   K GL++       WII  G   G+ K V+ A+   +       N++  I I+ WG++K      +G   T  Y  S++  KG+ T L+  +  +L  D+GT   Y  E+  R   E  +        G  +V ++    EGG   I S+  Y +    +P+VV   SGRAADL+         + L  D +  +++   E     ++    R++  L+ + + +K  +TI  L +Q  H +D  IL A++   ++ +    L LA+ +N VDIA   VF  +      Q  L     E L  ++ + ++L L    ++ +F+    L +LY T
Sbjct:  313 ATNAFGQVEFQGGPHPYKAQYVRVNFDTEPAYI-----------------MSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRK-GLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQ---SAQRNKIVCIGIAPWGLLKKREDF-IGQDKTVPYYPSSS--KGRFTGLNNRHSYFLLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFAHQNVTEDGLLPDDIRRQVLLLVETTFGCSEAAAHRLLHELT-VCAQHKNLLTIFRLGEQGEHDVDHAILTALLKG-QNLSAADQLALALAWNRVDIARSDVF--AMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNT 704          

HSP 3 Score: 63.1586 bits (152), Expect = 1.233e-9
Identity = 35/134 (26.12%), Postives = 71/134 (52.99%), Query Frame = 2
Query: 1601 YRELFLWSLISGYTEMALIFWENGKENVGSALIG-----SIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDL 1987
            Y EL +W++++   +MA+  W++G+E +  AL+      S+     + Y++     ++ + L K + +F+ L+ +++   Y ++  +T  +LT  L+ W+N TCL +A+  N   FL    C+    + W G L
Sbjct:  892 YSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEV----EICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGL 1021          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 87.0409 bits (214), Expect = 6.676e-17
Identity = 98/387 (25.32%), Postives = 177/387 (45.74%), Query Frame = 2
Query: 2207 QVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLS---------LFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGI------------------FXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNT---FLIK-YLNDDQNLKIRGFEHLCMESAMLENHQSTNVAN 3274
            ++   R   +FY API  F  + +S+I F+  F Y  LV+  P   V        E ++  ++  F +E++ +I  ++      K+++YV   WN   +L I          F + G    F+RCF +V            L++++ + +  +   +GP V M  KMI ++ + + +  + ++S+G    SI  P+  W+  L+  +F +PYF  YGE+  D+            +     +I+G G                   FLL+ NILL+++LIA+F + F+     S++ + F + + V E+ + P +PPPL   Y+ +  L      +    S+ +N    F +K +L++DQ  K+  FE  CME    +     N +N
Sbjct: 1292 KIKMRRRFYEFYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTV-------IEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAII---------FYIVG---FFMRCFGSVAYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEYESTPFLPPPLTPLYHGVLILQFVRTRLSCSKSQERNPMFDFSLKLFLDNDQIEKLHDFEEDCMEDLARQKLNEKNTSN 1659          

HSP 2 Score: 80.1073 bits (196), Expect = 9.699e-15
Identity = 104/420 (24.76%), Postives = 182/420 (43.33%), Query Frame = 2
Query:  224 ACKTFGKIKFLG--------YEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVG---TCAYDNSNTIEKGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI-----GAFAVQIL---YEGGKRAIESI--YRSLQKSIPLVVIKESGRAADLIC--------EILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVH-LDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMT 1387
            A   FG+++F G        Y  ++ +T P +I                   L    W    P+L+I+++GG    + +    +   K GL++       WII  G   G+ K V+ A+   +       N++  I I+ WG++K  R   +G   T  Y  S++  KG+ T L+  +  +L  D+GT   Y  E+  R   E  +        G  +V ++    EGG   I S+  Y +    +P+VV   SGRAADL+         + L  D +  +++   E     ++    R++  L+ + + +K  +TI  L +Q  H +D  IL A++   ++ +    L LA+ +N VDIA   VF  +      Q  L     E L  ++ + ++L L    ++ +F+    L +LY T
Sbjct:  374 ATNAFGQVEFQGGPHPYKAQYVRVNFDTEPAYI-----------------MSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRK-GLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQ---SAQRNKIVCIGIAPWGLLKK-REDFIGQDKTVPYYPSSS--KGRFTGLNNRHSYFLLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFAHQNVTEDGLLPDDIRRQVLLLVETTFGCSEAAAHRLLHELT-VCAQHKNLLTIFRLGEQGEHDVDHAILTALLKG-QNLSAADQLALALAWNRVDIARSDVF--AMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNT 765          

HSP 3 Score: 63.5438 bits (153), Expect = 1.110e-9
Identity = 35/134 (26.12%), Postives = 71/134 (52.99%), Query Frame = 2
Query: 1601 YRELFLWSLISGYTEMALIFWENGKENVGSALIG-----SIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDL 1987
            Y EL +W++++   +MA+  W++G+E +  AL+      S+     + Y++     ++ + L K + +F+ L+ +++   Y ++  +T  +LT  L+ W+N TCL +A+  N   FL    C+    + W G L
Sbjct:  953 YSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEV----EICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGL 1082          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339082)

HSP 1 Score: 202.986 bits (515), Expect = 2.212e-52
Identity = 267/1120 (23.84%), Postives = 493/1120 (44.02%), Query Frame = 2
Query:  164 SFNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGK---VTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI--------GAFAVQILYEGGKRAIESI--YRSLQKSIPLVVIKESGRAADLIC------------EILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLD----QNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTS----------LRSIKCRCTE----MISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNS------------------YRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDT-----LLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPT-WKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSF--------------------CRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPC----NTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIA----YYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMES 3235
            S   + +    + PQ ++      +G I+F G    +  T  Q++R       +F        +L TK WN   P+LLI++ GG K       + KK  ++GL++  +    WI  GG + G+ K V +A+    +   +   +V  I I+ WG+V+ N  L +G       ++I   +     L+  +  +L  D+GT+ +Y  E+  R   E+ + ++            V ++ EGG   I ++  Y +    +P+VV   SGRAADL+              +LE+  M   ++   ++   +  D   ++ + L     N K  IT+  + +    +   LD+ IL A+  S+     E+ L+LA+ +N VDIA  ++F            L     + L  ++ + ++L L N  S+ +F+    L++LY T           LR ++    +     + D+ L  +K       +   +   + IY  + N   N  + +S   +      AN  S                  + EL +W++++   +MAL+ W +G+E    AL  S++  K+   +  +   D  DT     L   + +F+     ++  +Y+ + EK   +LT  L+ W+N +CL +A+  N    L     +    + WMG L     T +K+++       L  PF I  + + KS   L      ++   E + ++ +   +S    +   ++SD   F                     +   +FY API KF    ++Y+ FL++F++  LV+++ +   +   ++      YI  LGF  E++ +I ++E   + +K   +    WN  D   I +F+I +  RF  N  +    R  Y V    + LR +    +++ +GP V M+ KM+ ++ +F+ + ++ ++S+G    +I  PN +    LI E+ ++PYF  YGE+   D  I  PC    +   C+       I   ++LL+ NILL+NLLIA+F   FN++   S + + F +  +V E+  KP++PPP  IA    Y +L+   +  K    G   +++  L  +L  D   ++  FE  C+E 
Sbjct:   57 SPGDLWLPTKHTRPQPTD-----AYGTIEFQGG---AHPTKAQYVRL------SFDTRPELLVQLFTKEWNLELPKLLITVQGG-KANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL---LLEGQQRTGRVVSIGIAPWGIVERNHEL-LGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLES--MRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRN-KNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQ-LSLALTWNRVDIARSEIF--VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACR-KSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEE----ALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILG------LAMPFYIRQL-DFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSI-----AYITTLGF--EKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFREN--TMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD--IDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPF-IALCHFYSLLKYCVRKAK----GLEVQRDNGLKLFLEKDDLERLYDFEEECVEG 1123          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339076)

HSP 1 Score: 193.356 bits (490), Expect = 2.232e-49
Identity = 269/1135 (23.70%), Postives = 496/1135 (43.70%), Query Frame = 2
Query:  164 SFNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGK---VTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI--------GAFAVQILYEGGKRAIESI--YRSLQKSIPLVVIKESGRAADLIC------------EILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLD----QNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTS----------LRSIKCRCTE----MISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNS------------------YRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDT-----LLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPT-WKILVTIPFSPLLIKPF---------IIPYVSNKK-SCSNLSHE-----------------KVKDKFLFEKEKIELNIRKKSPKSWKSY-----HSESDQVSFCRALIKFYR---APIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPC----NTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIA----YYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMES 3235
            S   + +    + PQ ++      +G I+F G    +  T  Q++R       +F        +L TK WN   P+LLI++ GG K       + KK  ++GL++  +    WI  GG + G+ K V +A+    +   +   +V  I I+ WG+V+ N  L +G       ++I   +     L+  +  +L  D+GT+ +Y  E+  R   E+ + ++            V ++ EGG   I ++  Y +    +P+VV   SGRAADL+              +LE+  M   ++   ++   +  D   ++ + L     N K  IT+  + +    +   LD+ IL A+  S+     E+ L+LA+ +N VDIA  ++F            L     + L  ++ + ++L L N  S+ +F+    L++LY T           LR ++    +     + D+ L  +K       +   +   + IY  + N   N  + +S   +      AN  S                  + EL +W++++   +MAL+ W +G+E    AL  S++  K+   +  +   D  DT     L   + +F+     ++  +Y+ + EK   +LT  L+ W+N +CL +A+  N    L     +    + WMG L     T +K+++ +   P  I+            +P    +     NL ++                  V+D  + E  K+ L     +   ++ +     ++E  Q    R   KFY    API KF    ++Y+ FL++F++  LV+++ +   +   ++      YI  LGF  E++ +I ++E   + +K   +    WN  D   I +F+I +  RF  N  +    R  Y V    + LR +    +++ +GP V M+ KM+ ++ +F+ + ++ ++S+G    +I  PN +    LI E+ ++PYF  YGE+   D  I  PC    +   C+       I   ++LL+ NILL+NLLIA+F   FN++   S + + F +  +V E+  KP++PPP  IA    Y +L+   +  K    G   +++  L  +L  D   ++  FE  C+E 
Sbjct:   57 SPGDLWLPTKHTRPQPTD-----AYGTIEFQGG---AHPTKAQYVRL------SFDTRPELLVQLFTKEWNLELPKLLITVQGG-KANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL---LLEGQQRTGRVVSIGIAPWGIVERNHEL-LGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLES--MRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRN-KNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQ-LSLALTWNRVDIARSEIF--VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACR-KSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEE----ALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAM-PFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTA--QFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSI-----AYITTLGF--EKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFREN--TMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD--IDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPF-IALCHFYSLLKYCVRKAK----GLEVQRDNGLKLFLEKDDLERLYDFEEECVEG 1142          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339074)

HSP 1 Score: 192.586 bits (488), Expect = 3.254e-49
Identity = 269/1135 (23.70%), Postives = 496/1135 (43.70%), Query Frame = 2
Query:  164 SFNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGK---VTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI--------GAFAVQILYEGGKRAIESI--YRSLQKSIPLVVIKESGRAADLIC------------EILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLD----QNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTS----------LRSIKCRCTE----MISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNS------------------YRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDT-----LLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPT-WKILVTIPFSPLLIKPF---------IIPYVSNKK-SCSNLSHE-----------------KVKDKFLFEKEKIELNIRKKSPKSWKSY-----HSESDQVSFCRALIKFYR---APIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPC----NTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIA----YYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMES 3235
            S   + +    + PQ ++      +G I+F G    +  T  Q++R       +F        +L TK WN   P+LLI++ GG K       + KK  ++GL++  +    WI  GG + G+ K V +A+    +   +   +V  I I+ WG+V+ N  L +G       ++I   +     L+  +  +L  D+GT+ +Y  E+  R   E+ + ++            V ++ EGG   I ++  Y +    +P+VV   SGRAADL+              +LE+  M   ++   ++   +  D   ++ + L     N K  IT+  + +    +   LD+ IL A+  S+     E+ L+LA+ +N VDIA  ++F            L     + L  ++ + ++L L N  S+ +F+    L++LY T           LR ++    +     + D+ L  +K       +   +   + IY  + N   N  + +S   +      AN  S                  + EL +W++++   +MAL+ W +G+E    AL  S++  K+   +  +   D  DT     L   + +F+     ++  +Y+ + EK   +LT  L+ W+N +CL +A+  N    L     +    + WMG L     T +K+++ +   P  I+            +P    +     NL ++                  V+D  + E  K+ L     +   ++ +     ++E  Q    R   KFY    API KF    ++Y+ FL++F++  LV+++ +   +   ++      YI  LGF  E++ +I ++E   + +K   +    WN  D   I +F+I +  RF  N  +    R  Y V    + LR +    +++ +GP V M+ KM+ ++ +F+ + ++ ++S+G    +I  PN +    LI E+ ++PYF  YGE+   D  I  PC    +   C+       I   ++LL+ NILL+NLLIA+F   FN++   S + + F +  +V E+  KP++PPP  IA    Y +L+   +  K    G   +++  L  +L  D   ++  FE  C+E 
Sbjct:   75 SPGDLWLPTKHTRPQPTD-----AYGTIEFQGG---AHPTKAQYVRL------SFDTRPELLVQLFTKEWNLELPKLLITVQGG-KANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL---LLEGQQRTGRVVSIGIAPWGIVERNHEL-LGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLES--MRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRN-KNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQ-LSLALTWNRVDIARSEIF--VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACR-KSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEE----ALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAM-PFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTA--QFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSI-----AYITTLGF--EKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFREN--TMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD--IDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPF-IALCHFYSLLKYCVRKAK----GLEVQRDNGLKLFLEKDDLERLYDFEEECVEG 1160          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339079)

HSP 1 Score: 192.586 bits (488), Expect = 3.412e-49
Identity = 269/1135 (23.70%), Postives = 496/1135 (43.70%), Query Frame = 2
Query:  164 SFNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGK---VTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI--------GAFAVQILYEGGKRAIESI--YRSLQKSIPLVVIKESGRAADLIC------------EILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLD----QNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTS----------LRSIKCRCTE----MISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNS------------------YRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDT-----LLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPT-WKILVTIPFSPLLIKPF---------IIPYVSNKK-SCSNLSHE-----------------KVKDKFLFEKEKIELNIRKKSPKSWKSY-----HSESDQVSFCRALIKFYR---APIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPC----NTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIA----YYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMES 3235
            S   + +    + PQ ++      +G I+F G    +  T  Q++R       +F        +L TK WN   P+LLI++ GG K       + KK  ++GL++  +    WI  GG + G+ K V +A+    +   +   +V  I I+ WG+V+ N  L +G       ++I   +     L+  +  +L  D+GT+ +Y  E+  R   E+ + ++            V ++ EGG   I ++  Y +    +P+VV   SGRAADL+              +LE+  M   ++   ++   +  D   ++ + L     N K  IT+  + +    +   LD+ IL A+  S+     E+ L+LA+ +N VDIA  ++F            L     + L  ++ + ++L L N  S+ +F+    L++LY T           LR ++    +     + D+ L  +K       +   +   + IY  + N   N  + +S   +      AN  S                  + EL +W++++   +MAL+ W +G+E    AL  S++  K+   +  +   D  DT     L   + +F+     ++  +Y+ + EK   +LT  L+ W+N +CL +A+  N    L     +    + WMG L     T +K+++ +   P  I+            +P    +     NL ++                  V+D  + E  K+ L     +   ++ +     ++E  Q    R   KFY    API KF    ++Y+ FL++F++  LV+++ +   +   ++      YI  LGF  E++ +I ++E   + +K   +    WN  D   I +F+I +  RF  N  +    R  Y V    + LR +    +++ +GP V M+ KM+ ++ +F+ + ++ ++S+G    +I  PN +    LI E+ ++PYF  YGE+   D  I  PC    +   C+       I   ++LL+ NILL+NLLIA+F   FN++   S + + F +  +V E+  KP++PPP  IA    Y +L+   +  K    G   +++  L  +L  D   ++  FE  C+E 
Sbjct:   64 SPGDLWLPTKHTRPQPTD-----AYGTIEFQGG---AHPTKAQYVRL------SFDTRPELLVQLFTKEWNLELPKLLITVQGG-KANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL---LLEGQQRTGRVVSIGIAPWGIVERNHEL-LGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLES--MRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRN-KNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQ-LSLALTWNRVDIARSEIF--VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACR-KSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEE----ALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAM-PFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTA--QFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSI-----AYITTLGF--EKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFREN--TMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD--IDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPF-IALCHFYSLLKYCVRKAK----GLEVQRDNGLKLFLEKDDLERLYDFEEECVEG 1149          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339077)

HSP 1 Score: 191.43 bits (485), Expect = 9.171e-49
Identity = 269/1134 (23.72%), Postives = 496/1134 (43.74%), Query Frame = 2
Query:  164 SFNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGK---VTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI--------GAFAVQILYEGGKRAIESI--YRSLQKSIPLVVIKESGRAADLIC------------EILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLD----QNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTS----------LRSIKCRCTE----MISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNS------------------YRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDT-----LLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPT-WKILVTIPFSPLLIKPF---------IIPYVSNKK-SCSNLSHE-----------------KVKDKFLFEKEKIELNIRKKSPKSWKSY-----HSESDQVSFCRALIKFYR---APIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPC----NTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIA----YYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCME 3232
            S   + +    + PQ ++      +G I+F G    +  T  Q++R       +F        +L TK WN   P+LLI++ GG K       + KK  ++GL++  +    WI  GG + G+ K V +A+    +   +   +V  I I+ WG+V+ N  L +G       ++I   +     L+  +  +L  D+GT+ +Y  E+  R   E+ + ++            V ++ EGG   I ++  Y +    +P+VV   SGRAADL+              +LE+  M   ++   ++   +  D   ++ + L     N K  IT+  + +    +   LD+ IL A+  S+     E+ L+LA+ +N VDIA  ++F            L     + L  ++ + ++L L N  S+ +F+    L++LY T           LR ++    +     + D+ L  +K       +   +   + IY  + N   N  + +S   +      AN  S                  + EL +W++++   +MAL+ W +G+E    AL  S++  K+   +  +   D  DT     L   + +F+     ++  +Y+ + EK   +LT  L+ W+N +CL +A+  N    L     +    + WMG L     T +K+++ +   P  I+            +P    +     NL ++                  V+D  + E  K+ L     +   ++ +     ++E  Q    R   KFY    API KF    ++Y+ FL++F++  LV+++ +   +   ++      YI  LGF  E++ +I ++E   + +K   +    WN  D   I +F+I +  RF  N  +    R  Y V    + LR +    +++ +GP V M+ KM+ ++ +F+ + ++ ++S+G    +I  PN +    LI E+ ++PYF  YGE+   D  I  PC    +   C+       I   ++LL+ NILL+NLLIA+F   FN++   S + + F +  +V E+  KP++PPP  IA    Y +L+   +  K    G   +++  L  +L  D   ++  FE  C+E
Sbjct:  159 SPGDLWLPTKHTRPQPTD-----AYGTIEFQGG---AHPTKAQYVRL------SFDTRPELLVQLFTKEWNLELPKLLITVQGG-KANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL---LLEGQQRTGRVVSIGIAPWGIVERNHEL-LGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLES--MRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRN-KNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQ-LSLALTWNRVDIARSEIF--VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACR-KSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEE----ALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAM-PFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTA--QFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSI-----AYITTLGF--EKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFREN--TMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD--IDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPF-IALCHFYSLLKYCVRKAK----GLEVQRDNGLKLFLEKDDLERLYDFEEECVE 1243          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Zebrafish
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 269.24 bits (687), Expect = 1.923e-73
Identity = 267/999 (26.73%), Postives = 486/999 (48.65%), Query Frame = 2
Query:  344 NAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTC---AYDNSNTIEKGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNV-------RDIGAF--AVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEI--LETDKMNVEIVDKYEEQLRLTDDD---KIRIIEILSDIYS--NYKERITIHDL-LDQNVHLDKKILDAII-SSREDRNL-----EKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ--ENLQDLY--MTS---LRSIKCR-------------------CTEMISDLILREDKSFK----IDNINNPGKN--LLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDT--LLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSN--KKSCSNLSHEKVKDKFLFEKE---KIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI-NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGEL-----------------MLDDFKIPSP---CNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPP 3079
            N Y+L+T+ W    P LLIS+ GG K    K + + K  + GL++V +    WI+ GG H G+ K V  AV D+ + S   E Q+ +I ++ WGV+ N  +L        AY + +   +G+++ LD N+  +L  DDGT+  Y  EI+ R   E+ +       R+ G     V ++ +GG   + +IY S+    P VV++ SGR AD+I  +  +   K+ + ++++  ++  + +     +++IIE    I         +T+  +  D+N  +D  IL A++ +SR D +      E+ L LAV +N VDIA+ ++F      T S     ++    L  ++ E ++L L N   + EF++  E L +LY  + S   LR +  R                   C   +S+ +     SF     I +   P K+   LKV  K   +L  +  ++         S +   +  R+LFLW+++    E+A I WE  ++ + +AL  S IL K+    +  G +D  +   +L+ +  +++ A  + ++ +  + ++   +L R    W   TCL +A+  +   F+  +  ++   + W G+LS   P WK+L+ + F PL+   F+        ++       +K+  + +F  +   KI+ ++R  S KS      E   ++    L+ F ++P VKF   + SY  FL +FA + +++ +     +       ELL+Y+++   + EEI Q+ ++ + +G   K K Y+   WN+ D+L+I +FI  +I R   +   F   +    +   +F LR M  + ISR++GPK+I++R+M++D+FFF+ + S+++++YG     I   N +   ++I    Y PY   +G                     D  K   P    + T    +  T+++   ++LL  NILLLNLLIA+F YTF ++Q  ++  + F + +L+ E+H++P +PPP
Sbjct:  125 NLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRR-GLIKVAQTTGAWILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVEIELRARLEKLISKLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIAHVASVPVSKVTMALINRLLKRFFMQEYKNFTELQIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMF--SALVGDKPEFVRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEW---------SADTVWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLA---QESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGKIKRHLRGFSQKS------ELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQTSPSWR-------ELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQASDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWVVAYGVAKQGILIENEERLNWIIRGAVYEPYITIFGNFPTNIDNTLFDISSCSVNASDPLKPKCPMLNADNTPVFPEWLTIMM-LCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWKFQRYELIKEYHSRPALPPP 1094          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 259.225 bits (661), Expect = 9.076e-71
Identity = 261/1034 (25.24%), Postives = 494/1034 (47.78%), Query Frame = 2
Query:  236 FGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEK---GKV-TLDPNYDCYLFCDD-----GTEKEYDKEIDFRLDFER-NVRDIGAFAVQIL---YEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERI-------TIHDLLDQNVHLDKKILDAII-----SSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTE--MISDLILREDKSFKIDNI-----NNPGKNL--------LKVIYKIICNLSDNILK--FESFNLRSSNSHNAN--------QNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKS---YHSESDQVSFCRALIK----FYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKN-GLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELML---DDFKIPSP-CNTTVCIVQSATLIIGFGIFX------------XXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKL 3112
             G I F G       T  +F+R   T   +  E+    Y+++TK W    P L++++ GG   +       +   ++GL++  +    WI+  G   GI K + +AV D  + S   + +V  I I+ W +++N   L      +  +   E    G V +LD N+  ++  D+     G   E   ++   +  +R      G+  + +L     G  R ++ +Y+++Q SIP +++  SG  AD++  +++    + +IV   +E L  T  D +   EI S  ++   +RI       T+HD  +Q+  LD  IL A++      S+E ++    L LAV +N VDIA  ++F  S     S + L     E L  ++ + ++LF+ N  +I +F+    LQ+LY        C  +E  ++  L+L++++  +          NP   L           + K++ +  D+  K  ++     S   H  N        ++ +R+LFLW+++    EMA  FW  G E V +AL+G  I+ +M +++ ++  +  S      + K+++ A D+ ++ Y  ++++ + +L R    W+  T L IA       F   +  ++   + W G +       ++++T  F P L+   +I + + ++  S    E   +    E E+  L +    P + +      + S   +F R +++    F+ AP+  F+  ++ Y  FL++F+Y+ L++ +P           AE+++Y ++   ++EEI Q   T+++  ++ K+K YV  +WN  DM+ I +F++ +  R  ++  ++   R   A+   +F+LR +  + I + +GPK+I++ +MI DVFFFL   S+++I+YG  + ++ +PN     ++     YRPY   +G++ L   D  K+P   C T V  +   TL     I+             L+TN+LLLNLLIAMF YTF  +Q  ++ F+ F +  L+ E+H++P + PP  I  +I + L
Sbjct:   17 LGDIDFTGVS----RTRGKFVRV--TSSTDPAEI----YQILTKQWGLAPPHLVVALMGG-DEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSAKPDHPATYPTEDLPYGAVYSLDCNHSHFILVDEDPKRPGATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADILVTLMDRGCWDADIV---QELLINTFPDGLHSTEITS--WTKLIQRILDHGHLLTVHDP-EQDSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIF--SGDVQWSAQDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELY--------CSVSEKNLLHTLLLKKNQERQAQLARKRMSGNPNNELGDRKFRFTFHEVSKVLKDFLDDTCKGFYQKLPAVSKALHQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEM-AHLATEAESARS----MKNAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTF-FIPPLVWTSLIKF-NPEEQVSKDEGEPFAELDSLETEQ-ALLLTDGDPVAGEGSAETAARSCSATFIRVVLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRPPPPYG---PSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAMS--TYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDWVFRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISHITQAL 1010          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 252.677 bits (644), Expect = 1.599e-68
Identity = 259/1039 (24.93%), Postives = 491/1039 (47.26%), Query Frame = 2
Query:  236 FGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEK---GKV-TLDPNYDCYLFCDD-----GTEKEYDKEIDFRLDFER-NVRDIGAFAVQIL---YEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERI-------TIHDLLDQNVHLDKKILDAII-----SSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTE--MISDLILREDKSFKIDNI-----NNPGKNL--------LKVIYKIICNLSDNILKFESFNLRSSNSHNAN---------------QNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKS---YHSESDQVSFCRALIK----FYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKN-GLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELML---DDFKIPSP-CNTTVCIVQSATLIIGFGIFX------------XXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKL 3112
             G I F G       T  +F+R   T   +  E+    Y+++TK W    P L++++ GG   +       +   ++GL++  +    WI+  G   GI K + +AV D  + S   + +V  I I+ W +++N   L      +  +   E    G V +LD N+  ++  D+     G   E   ++   +  +R      G+  + +L     G  R ++ +Y+++Q SIP +++  SG  AD++  +++    + +IV   +E L  T  D +   EI S  ++   +RI       T+HD  +Q+  LD  IL A++      S+E ++    L LAV +N VDIA  ++F  S     S + L     E L  ++ + ++LF+ N  +I +F+    LQ+LY        C  +E  ++  L+L++++  +          NP   L           + K++ +  D+  K     L +                      ++ +R+LFLW+++    EMA  FW  G E V +AL+G  I+ +M +++ ++  +  S      + K+++ A D+ ++ Y  ++++ + +L R    W+  T L IA       F   +  ++   + W G +       ++++T  F P L+   +I + + ++  S    E   +    E E+  L +    P + +      + S   +F R +++    F+ AP+  F+  ++ Y  FL++F+Y+ L++ +P           AE+++Y ++   ++EEI Q   T+++  ++ K+K YV  +WN  DM+ I +F++ +  R  ++  ++   R   A+   +F+LR +  + I + +GPK+I++ +MI DVFFFL   S+++I+YG  + ++ +PN     ++     YRPY   +G++ L   D  K+P   C T V  +   TL     I+             L+TN+LLLNLLIAMF YTF  +Q  ++ F+ F +  L+ E+H++P + PP  I  +I + L
Sbjct:   17 LGDIDFTGVS----RTRGKFVRV--TSSTDPAEI----YQILTKQWGLAPPHLVVALMGG-DEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSAKPDHPATYPTEDLPYGAVYSLDCNHSHFILVDEDPKRPGATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADILVTLMDRGCWDADIV---QELLINTFPDGLHSTEITS--WTKLIQRILDHGHLLTVHDP-EQDSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIF--SGDVQWSAQDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELY--------CSVSEKNLLHTLLLKKNQERQAQLARKRMSGNPNNELGDRKFRFTFHEVSKVLKDFLDDTCKGFYQKLPAERMGKGRLFHSQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEM-AHLATEAESARS----MKNAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTF-FIPPLVWTSLIKF-NPEEQVSKDEGEPFAELDSLETEQ-ALLLTDGDPVAGEGSAETAARSCSATFIRVVLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRPPPPYG---PSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAMS--TYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDWVFRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISHITQAL 1015          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 252.677 bits (644), Expect = 1.903e-68
Identity = 260/1065 (24.41%), Postives = 499/1065 (46.85%), Query Frame = 2
Query:  158 FKSFNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEK---GKV-TLDPNYDCYLFCDD-----GTEKEYDKEIDFRLDFER-NVRDIGAFAVQIL---YEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERI-------TIHDLLDQNVHLDKKILDAII-----SSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTE--MISDLILREDKSFKIDNI-----NNPGKNL--------LKVIYKIICNLSDNILKFESFNLRSSNSHNAN---------------QNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKS---YHSESDQVSFCRALIK----FYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKN-GLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELML---DDFKIPSP-CNTTVCIVQSATLIIGFGIFX------------XXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKL 3112
            +    Q ++     + ++ +       G I F G       T  +F+R   T   +  E+    Y+++TK W    P L++++ GG   +       +   ++GL++  +    WI+  G   GI K + +AV D  + S   + +V  I I+ W +++N   L      +  +   E    G V +LD N+  ++  D+     G   E   ++   +  +R      G+  + +L     G  R ++ +Y+++Q SIP +++  SG  AD++  +++    + +IV   +E L  T  D +   EI S  ++   +RI       T+HD  +Q+  LD  IL A++      S+E ++    L LAV +N VDIA  ++F  S     S + L     E L  ++ + ++LF+ N  +I +F+    LQ+LY        C  +E  ++  L+L++++  +          NP   L           + K++ +  D+  K     L +                      ++ +R+LFLW+++    EMA  FW  G E V +AL+G  I+ +M +++ ++  +  S      + K+++ A D+ ++ Y  ++++ + +L R    W+  T L IA       F   +  ++   + W G +       ++++T  F P L+   +I + + ++  S    E   +    E E+  L +    P + +      + S   +F R +++    F+ AP+  F+  ++ Y  FL++F+Y+ L++ +P           AE+++Y ++   ++EEI Q   T+++  ++ K+K YV  +WN  DM+ I +F++ +  R  ++  ++   R   A+   +F+LR +  + I + +GPK+I++ +MI DVFFFL   S+++I+YG  + ++ +PN     ++     YRPY   +G++ L   D  K+P   C T V  +   TL     I+             L+TN+LLLNLLIAMF YTF  +Q  ++ F+ F +  L+ E+H++P + PP  I  +I + L
Sbjct:   40 YTPLTQSVVSMVEKSSERFDKQMAGRLGDIDFTGVS----RTRGKFVRV--TSSTDPAEI----YQILTKQWGLAPPHLVVALMGG-DEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSAKPDHPATYPTEDLPYGAVYSLDCNHSHFILVDEDPKRPGATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADILVTLMDRGCWDADIV---QELLINTFPDGLHSTEITS--WTKLIQRILDHGHLLTVHDP-EQDSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIF--SGDVQWSAQDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELY--------CSVSEKNLLHTLLLKKNQERQAQLARKRMSGNPNNELGDRKFRFTFHEVSKVLKDFLDDTCKGFYQKLPAERMGKGRLFHSQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEM-AHLATEAESARS----MKNAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTF-FIPPLVWTSLIKF-NPEEQVSKDEGEPFAELDSLETEQ-ALLLTDGDPVAGEGSAETAARSCSATFIRVVLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRPPPPYG---PSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAMS--TYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDWVFRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISHITQAL 1064          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Zebrafish
Match: trpm6 (transient receptor potential cation channel, subfamily M, member 6 [Source:ZFIN;Acc:ZDB-GENE-111212-1])

HSP 1 Score: 237.654 bits (605), Expect = 3.701e-63
Identity = 257/1145 (22.45%), Postives = 509/1145 (44.45%), Query Frame = 2
Query:  146 IGQHFKSFNQMLIDNNSSAP---------QKSNLSACKTFGKIKFLG---------YEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTV--GTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVR--------DIGAFAVQILYEGGKRAIESI--YRSLQKSIPLVVIKESGRAADLICEI---------LETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVH-LDKKILDAIISSREDR-NLEKTLNLAVRFNCVDIADFKVF---QSSRASTLSQKTLG------IYFKEMLSKNQHEML---------QLFLVNNFSIDEFVQENLQDLYMTSLRSIKCRCTEMISDLILR-----------EDKSFKI--DNINNPGKN-------LLKVIYKIICNLSDNILKFESFNLRSSNSHNANQN-----------SYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFND-MSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSH-EKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFC-----RALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI---LRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMESAMLENHQSTNVANIN 3280
            I +H   ++ +L  +  S           Q ++LS    FG + F G         Y  +S ++ P+ +                  +L+ + W+   P+L+I+++GG           +     GL+        WI+  G + G+ K V +AV   ++    +  +  ++ I+ WG+++NN  L    G   Y         + +L+  +  +L  DDGT  +   +I+ R   ER++               V ++ EGG   +  +  Y      +P++V + +GRAAD++  I         L++D +  +++ + ++   +   +   +++IL +    ++E I+I D   +++   D  IL    S R  R + E+ L+L + ++  DIA   +    Q  +  +L Q  L       + F ++L +N   M          QL+ +   S   F++  + D   T L ++  R + +   +++              K F+     ++NP K          KV          +  +  +   R      A Q+           ++ +LF+W+++    EMAL+ W++G++ +  A++   +   +    K     D M++ L K S++F +LA D++ +A++ N+     +LT  +  W+N TCLQ+A+   L  F+  N  +    + WMG L+    +W  ++     P+ I+      +   KS + +SH  ++++   F  + +      +   + K+   + ++ S C     R +  FY AP+VKF  + ++++ FL++FAY  LV L    E   IQ    E LV  +IL   VE+  ++   E      KLK + S  WN+ D L I +F++ + +R+  + ++ +     Y++    +S+R +  + +++  GP + MI KM+ ++F+ + I +L ++S+GT   SI +PN   +  L+ ++ ++PY+  +GE+   +  I +  N   C+  +   I    ++L +  I+++NLLIA F   +N++   S K + + + + +  +  KP +PPPL    +I   L  +WQ  +      SKR  T L   L  D   ++  FE  C+     +  +S   + IN
Sbjct:   48 IAEHVGPYSGLLGHDPGSGSAEEEEWSVLQHTSLSPTDAFGSLDFQGSSKRACRAKYVRLSCDSPPELL-----------------VQLMLREWHMEIPKLVITVHGGTDNFLLSPRVCQAFST-GLVTAAESTGAWILTDGINTGVSKYVGDAV---KMYGSHDHRKRNVVGITPWGIIENNSDLIGRDGLRHYQALGNPLSKRASLNGMHSHFLLVDDGTIGKSGCQIELRKRLERHIHYQKIHPRLPQHVPLVCVVVEGGPSVLSVVLEYVCRTSPVPVLVFEGTGRAADMLALIHKQTAVDRKLDSD-IKEDVLQRIQDSFGVERSESTELLDILMECM-EHRELISIFDSESEDLQEADVAILST--SLRGTRASPEEQLSLTLAWDRADIAKDHILVYGQQWQVGSLEQIMLDALIMDRVNFVKLLIENGMTMSHFLTISRLEQLYNIQTGSSHHFLRHVIADAKQTRLPAVY-RISLIDIGMVIEYLIGGAYRSTYTRKRFRTMYSRLHNPAKETSSPFSKAKKVAPAPEATPPRSHFRRTAQPYRHQEGGVAPQDQKSDPIPDFVCTFNDLFVWAVLKHRQEMALLLWQHGEQAMARAVVACKLYRTLAMEAKESNMGDTMAEELKKNSLEFGQLAVDVLDQAFRENERMAMKLLTWEMKDWSNFTCLQMAVSSGLRPFVAHNCTQMLLTDLWMGRLNLSKNSWFKIIGSILMPVAIQ------LLEFKSQAEMSHVPQLQEALQFGWDTVP----SEQEGAEKAVPGDEERGSSCLYPWTRKVYDFYTAPVVKFWFHTMAFLGFLMMFAYTCLVRL---NETPNIQ----ECLVMTYILAMAVEKAREVLVLEPRKFTKKLKVWFSEYWNINDFLGILLFLVGVSLRW--HQETRLASHIVYSLDFVFWSVRLLDLFAVNQHAGPYLTMITKMMSNMFYIVIIMALVLVSFGTSRKSILSPNEDPSWTLLRDVVFQPYWMIFGEVYAGE--IDACANPETCVPGAFLTIFLQAVYLFIQYIIMVNLLIAFFNNVYNEMSTISRKLWKYNRYRYIMTYQEKPWLPPPLIFLSHITLCLSSMWQKHR----KASKRGRTGLKLILAPDDLKRLYEFEEKCVAGYFRDQKESQQGSQIN 1141          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 285.804 bits (730), Expect = 5.205e-80
Identity = 270/984 (27.44%), Postives = 473/984 (48.07%), Query Frame = 2
Query:  326 FQELTYN----AYELITKYWNFPKPQLLISINGG---FKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNS---NTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNV--RDIGAFA------------VQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLR--LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKT-----LNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSI-DEFVQENLQDLYMTSLRS------IKCRCTEMIS-------DLILRED----KSFKIDNINNPGKNLLKVI-----YKIICNLSDNILKFES-FNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELK-PIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI 3100
            FQ++  N     Y LIT  W  P P L++S+ GG   FK         K   ++GL++  +    WI+ GG  VGI K V EAV D    +  +  +V  + I+ WG+V N +SL     ++  +   + ++    +LD NY  +L  DDGT  +   E  FR   E ++  +  GA              V ILY       + +Y + +  IP +++  SG  AD + EILE       I    EE+L+    +++  +++E    I  N ++ +T++   D     +  IL A++ + +  + +       L LAV +N  DIA  ++F      +A+ L          + L  N+ + ++LF+ N  +I D      L++LY + L +      +K +  E  +       +L+  E     + FK+  ++   ++LL  +       ++ N+  ++ K  S +  R S S       + +LF+W+++    EMA  FWE G E V SAL    IL ++ S ++S+   + S  +   + KF++LA  +  + Y+ ++ +   +L R   +W   TCLQ+A   +  +F   +  +S   E W G ++   P W +++T  F P LI   +I + S        S ++++   L    K  +  R +  + WK                +F+ AP+  F   ++ Y  FL +F+Y+ L+E K P  +        +E ++Y +I   + EEI Q        +  K+K Y+  SWN  D++ + +FII +I R  +  +SF   R        +F+LR +  + +++ +GPK+I++RKM+ DVFFFL    +++I+YG  +  + +P      ++   +FYRPY Q +G++  ++F    PC  T     +  +I+   +FLL+ NILLLNLLIAMF YTF+K+QG S+ ++ F +  L+ E+HN+P + PP  I  +I
Sbjct:    1 FQDIKGNRYSSVYSLITYNWKIPPPNLVVSVVGGDGDFK----MKTWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGRFDYGPLNDNRNVAILY------FQRVYNATKSPIPCLLVAGSGGVADCLAEILEESIALESIRGLIEEKLKHYFPNENLTKMVE---RIVEN-RDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATDLDDT-----MTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTHVLGNMKGSVNKRNSGYQPRKSTS------PWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKEL-SRMESEA--EESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTF-FCPPLIYTDLITFKSIDHENGIESAQRMEMDSLDTDIKTTVKQRPRWMQRWK----------------QFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPD----GPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICR--MFNESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLLHPTDMRLSWIFRRVFYRPYLQIFGQIPQEEFDEAEPCTNTYA---NWLVILLLVVFLLVANILLLNLLIAMFSYTFSKVQGNSDIYWKFQRYNLIVEYHNRPALAPPFIIISHI 930          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 284.263 bits (726), Expect = 6.042e-79
Identity = 300/1116 (26.88%), Postives = 525/1116 (47.04%), Query Frame = 2
Query:  167 FNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGG---FKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNS---NTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNV--RDIGAFA--------VQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLR--LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKT-----LNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSI-DEFVQENLQDLYMTSLRS------IKCRCTEMISDLILREDKSFKIDNINNPGKNL-LKVIYKIICNL-SDNILKFESF---NLRSS-NSHNANQNS-YRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKE--KIELNIRKKSPKSWKSYHS-------ESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELK-PIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDF---KIPS----------------PCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEH----LCMESAMLENHQSTNVANINLNSDN 3295
            F   ++   +SA + +       +G ++F+G    +   + +FIR      N+    +   Y LIT  W  P P L++S+ GG   FK         K   ++GL++  +    WI+ GG  VGI K V EAV D    +  +  +V  + I+ WG+V N +SL     ++  +   + ++    +LD NY  +L  DDGT  +   E  FR   E ++  +  GA          + +L  G  + +  +Y + +  IP +++  SG  AD + EILE       I    EE+L+    +++  +++E    I  N ++ +T++   D     +  IL A++ + +  + +       L LAV +N  DIA  ++F      +A+ L          + L  N+ + ++LF+ N  +I D      L++LY + L +      +K +  E  +    ++         N  G+   L  + KI+ +L  D    F +    N++ S N  N+   S + +LF+W+++    EMA  FWE G E V SAL    IL ++ S ++S+   + S  +   + KF++LA  +  + Y+ ++ +   +L R   +W   TCLQ+A   +  +F   +  +S   E W G ++   P W +++T  F P LI   +I +  N+     LS E++   F  EK+    E+ ++K S K  K+  +       E  +  + +   +F+ AP+  F   ++ Y  FL +F+Y+ L+E K P  +        +E ++Y +I   + EEI Q        +  K+K Y+  SWN  D++ + +FII +I R     +SF   R        +F+LR +  + +++ +GPK+I++RKM+ DVFFFL    +++I+YG  +  + +P      ++   +FYRPY Q +G++  ++F   KI S                PC  T     +  +I+   +FLL+ NILLLNLLIAMF YTF+K+QG S+ ++ F +  L+ E+HN+P + PP  I  +I                   NTF+ + +    + KIR F      L  E+   EN+   +VA    +SD 
Sbjct:   56 FGAAMVSTWNSA-EHTTEEPTDAYGDVEFVG----AGRKHSKFIRL----SNDTDPAS--VYSLITYNWKIPPPNLVVSVVGGDGDFK----MKTWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNATKSPIPCLLVAGSGGVADCLAEILEESIALESIRGLIEEKLKHYFPNENLTKMVE---RIVEN-RDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATDLDDT-----MTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNTLLYQLLKSKHDEHRNSKT-KDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTHVLGNMKGSVNKRNSGSTSPWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKEL-SRMESEA--EESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTF-FCPPLIYTDLITF--NR----TLSSEELYFSFREEKDDNAEEVPLKKMSVKKSKTKKAPEAEIIKEKQRPRWMQRWKQFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPD----GPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICRMF--NESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLLHPTDMRLSWIFRRVFYRPYLQIFGQIPQEEFDASKIASSNCTNDPIAIMLEEAEPCTNTYA---NWLVILLLVVFLLVANILLLNLLIAMFSYTFSKVQGNSDIYWKFQRYNLIVEYHNRPALAPPFIIISHI-------------------NTFIKRKIRKVASQKIRHFSEYNRMLIWEAVQKENYM-VSVAKHKRDSDT 1107          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 280.796 bits (717), Expect = 7.449e-78
Identity = 292/1117 (26.14%), Postives = 514/1117 (46.02%), Query Frame = 2
Query:  167 FNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGG---FKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNS---NTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNV--RDIGAFA--------VQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLR--LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKT-----LNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSI-DEFVQENLQDLYMTSLRS------IKCRCTEMIS-------DLILRED----KSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPY------VSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELK-PIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDF---KIPS----------------PCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEH----LCMESAMLENHQSTNVANINLNSDN 3295
            F   ++   +SA + +       +G ++F+G    +   + +FIR      N+    +   Y LIT  W  P P L++S+ GG   FK         K   ++GL++  +    WI+ GG  VGI K V EAV D    +  +  +V  + I+ WG+V N +SL     ++  +   + ++    +LD NY  +L  DDGT  +   E  FR   E ++  +  GA          + +L  G  + +  +Y + +  IP +++  SG  AD + EILE       I    EE+L+    +++  +++E    I  N ++ +T++   D     +  IL A++ + +  + +       L LAV +N  DIA  ++F      +A+ L          + L  N+ + ++LF+ N  +I D      L++LY + L +      +K +  E  +       +L+  E     + FK+  ++   ++LL     +      + +  E +  R S S       + +LF+W+++    EMA  FWE G E V SAL    IL ++ S ++S+   + S  +   + KF++LA  +  + Y+ ++ +   +L R   +W   TCLQ+A   +  +F   +  +S   E W G ++   P W +++T  F P LI   +I +      +S+  S     H    +  L  +E       +  P+ WK                +F+ AP+  F   ++ Y  FL +F+Y+ L+E K P  +        +E ++Y +I   + EEI Q        +  K+K Y+  SWN  D++ + +FII +I R  +  +SF   R        +F+LR +  + +++ +GPK+I++RKM+ DVFFFL    +++I+YG  +  + +P      ++   +FYRPY Q +G++  ++F   KI S                PC  T     +  +I+   +FLL+ NILLLNLLIAMF YTF+K+QG S+ ++ F +  L+ E+HN+P + PP  I  +I                   NTF+ + +    + KIR F      L  E+   EN+   +VA    +SD 
Sbjct:   56 FGAAMVSTWNSA-EHTTEEPTDAYGDVEFVG----AGRKHSKFIRL----SNDTDPAS--VYSLITYNWKIPPPNLVVSVVGGDGDFK----MKTWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNATKSPIPCLLVAGSGGVADCLAEILEESIALESIRGLIEEKLKHYFPNENLTKMVE---RIVEN-RDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATDLDDT-----MTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLG---DVCTTFYTHQIAVEKYQPRKSTS------PWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKEL-SRMESEA--EESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTF-FCPPLIYTDLITFKPNNYMISSHLSIDPTPHTVTINSNLLGRE----GCCRLLPERWK----------------QFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPD----GPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICR--MFNESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLLHPTDMRLSWIFRRVFYRPYLQIFGQIPQEEFDASKIASSNCTNDPIAIMLEEAEPCTNTYA---NWLVILLLVVFLLVANILLLNLLIAMFSYTFSKVQGNSDIYWKFQRYNLIVEYHNRPALAPPFIIISHI-------------------NTFIKRKIRKVASQKIRHFSEYNRMLIWEAVQKENYM-VSVAKHKRDSDT 1086          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 279.641 bits (714), Expect = 1.621e-77
Identity = 276/1042 (26.49%), Postives = 491/1042 (47.12%), Query Frame = 2
Query:  167 FNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGG---FKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNS---NTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNV--RDIGAFA--------VQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLR--LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKT-----LNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSI-DEFVQENLQDLYMTSL------RSIKCRCTEMIS-------DLILRED----KSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELK-PIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDF---KIPS----------------PCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI 3100
            F   ++   +SA + +       +G ++F+G    +   + +FIR      N+    +   Y LIT  W  P P L++S+ GG   FK         K   ++GL++  +    WI+ GG  VGI K V EAV D    +  +  +V  + I+ WG+V N +SL     ++  +   + ++    +LD NY  +L  DDGT  +   E  FR   E ++  +  GA          + +L  G  + +  +Y + +  IP +++  SG  AD + EILE       I    EE+L+    +++  +++E    I  N ++ +T++   D     +  IL A++ + +  + +       L LAV +N  DIA  ++F      +A+ L          + L  N+ + ++LF+ N  +I D      L++LY + L      + +K +  E  +       +L+  E     + FK+  ++   ++LL     +      + +  E +  R S S       + +LF+W+++    EMA  FWE G E V SAL    IL ++ S ++S+   + S  +   + KF++LA  +  + Y+ ++ +   +L R   +W   TCLQ+A   +  +F   +  +S   E W G ++   P W +++T  F P LI   +I + S +++ +             E E I+   R +  + WK                +F+ AP+  F   ++ Y  FL +F+Y+ L+E K P  +        +E ++Y +I   + EEI Q        +  K+K Y+  SWN  D++ + +FII +I R  +  +SF   R        +F+LR +  + +++ +GPK+I++RKM+ DVFFFL    +++I+YG  +  + +P      ++   +FYRPY Q +G++  ++F   KI S                PC  T     +  +I+   +FLL+ NILLLNLLIAMF YTF+K+QG S+ ++ F +  L+ E+HN+P + PP  I  +I
Sbjct:   56 FGAAMVSTWNSA-EHTTEEPTDAYGDVEFVG----AGRKHSKFIRL----SNDTDPAS--VYSLITYNWKIPPPNLVVSVVGGDGDFK----MKTWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNATKSPIPCLLVAGSGGVADCLAEILEESIALESIRGLIEEKLKHYFPNENLTKMVE---RIVEN-RDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATDLDDT-----MTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLG---DVCTTFYTHQIAVEKYQPRKSTS------PWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKEL-SRMESEA--EESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTF-FCPPLIYTDLITFNSVEQNGAP------------EAEIIKEKQRPRWMQRWK----------------QFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPD----GPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICR--MFNESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLLHPTDMRLSWIFRRVFYRPYLQIFGQIPQEEFDASKIASSNCTNDPIAIMLEEAEPCTNTYA---NWLVILLLVVFLLVANILLLNLLIAMFSYTFSKVQGNSDIYWKFQRYNLIVEYHNRPALAPPFIIISHI 1023          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 248.054 bits (632), Expect = 1.801e-67
Identity = 241/974 (24.74%), Postives = 442/974 (45.38%), Query Frame = 2
Query:  167 FNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGG---FKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNS---NTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNV--RDIGAFA--------VQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLR--LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKT-----LNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSI-DEFVQENLQDLYMTSLRS------IKCRCTEMIS-------DLILRED----KSFKIDNINNPGKNLLKVI-----YKIICNLSDNI-------------------------LKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSH-EKVKDKFLFEKEKIELNIRKKSPK---SWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELK-PIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDF 2851
            F   ++   +SA + +       +G ++F+G    +   + +FIR      N+    +   Y LIT  W  P P L++S+ GG   FK         K   ++GL++  +    WI+ GG  VGI K V EAV D    +  +  +V  + I+ WG+V N +SL     ++  +   + ++    +LD NY  +L  DDGT  +   E  FR   E ++  +  GA          + +L  G  + +  +Y + +  IP +++  SG  AD + EILE       I    EE+L+    +++  +++E    I  N ++ +T++   D     +  IL A++ + +  + +       L LAV +N  DIA  ++F      +A+ L          + L  N+ + ++LF+ N  +I D      L++LY + L +      +K +  E  +       +L+  E     + FK+  ++   ++LL  +       ++ N+  ++                         +  E +  R S S       + +LF+W+++    EMA  FWE G E V SAL    IL ++ S ++S+   + S  +   + KF++LA  +  + Y+ ++ +   +L R   +W   TCLQ+A   +  +F   +  +S   E W G ++   P W +++T  F P LI   +I +     SC         +  FLF   + E+   K+ P+    WK                +F+ AP+  F   ++ Y  FL +F+Y+ L+E K P  +        +E ++Y +I   + EEI Q        +  K+K Y+  SWN  D++ + +FII +I R  +  +SF   R        +F+LR +  + +++ +GPK+I++RKM+ DVFFFL    +++I+YG  +  + +P      ++   +FYRPY Q +G++  ++F
Sbjct:   53 FGAAMVSTWNSA-EHTTEEPTDAYGDVEFVG----AGRKHSKFIRL----SNDTDPAS--VYSLITYNWKIPPPNLVVSVVGGDGDFK----MKTWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNATKSPIPCLLVAGSGGVADCLAEILEESIALESIRGLIEEKLKHYFPNENLTKMVE---RIVEN-RDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATDLDDT-----MTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTHVLGNMKGSVNKRNSGVSSIWKPPKSVYIKKSMEQIAVEKYQPRKSTS------PWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKEL-SRMESEA--EESLAMRDLAAKFEQLAI-VFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTF-FCPPLIYTDLITFKDAVGSCRKSGELTSGEGPFLFLAPEAEIIKEKQRPRWMQRWK----------------QFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPD----GPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICR--MFNESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLLHPTDMRLSWIFRRVFYRPYLQIFGQIPQEEF 969          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Mouse
Match: Trpm4 (transient receptor potential cation channel, subfamily M, member 4 [Source:MGI Symbol;Acc:MGI:1915917])

HSP 1 Score: 254.988 bits (650), Expect = 3.668e-69
Identity = 257/1025 (25.07%), Postives = 460/1025 (44.88%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSL--TVGT--CAYDNSNTIEKG-KVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRD----IGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDD-DKIR---------IIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAII---SSREDRNLEKTLNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQE-NLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKN------------LLKVIYKIIC-------NLSDNILK----------FESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVS-----------------FCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI------------NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFK----IPSPCN-------------TTVCIVQSA--TLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI 3100
            Y L+T+ W F  P L++S+ GG           +   ++GL+   +    WI+ GG H GI + V  AV D +  S    ++V  + ++ WGVV+N   L    G+    Y      E G +  LD NY  +   DDGT      E  FRL FE  V      +G   + I     L +G ++ ++ I  + Q  +P +++  SG AAD + E LE      + +      LR  +  D+IR         +++   +     KE +T++   D +   +  +L A++    S E       L LAV +N VDIA  ++F+     R+  L    +     + L  ++ E ++L + +  S+  F+    L  LY             +I +L+   D++    +  +P  N            +L+ +    C       N  D+ L            +  N + S   +  Q  + +L +W+L+    +MA+ FWE G  +V SAL G+ +L ++ + ++S+         L  +  F+ ++ D+  + Y  ++E+   +L R   LW   TCLQ+A+  +   F   +  +S   + W G++    P W +L+   F P LI   +I +   +KS      E  +    F+   ++ +I    P         S +V+                 F +    F+ AP+  F+  ++SY+ FL++FA++ LV+ +P K         +ELL+Y +    + EE+ Q                ++  L ++L  Y+S +WN  D+L +  F++ +  R T     F   R    +   +F+LR +  + +++ +GPK++++ KM+ DVFFFL    +++++YG  +  I  P  +    ++  +FYRPY Q +G++  ++      IP  C+                C+ Q A   +++   +FLL+ NILLLNLLIAMF YTF+K+ G S+ ++   +  L+ EFH++P + PPL I  ++
Sbjct:  104 YSLVTRSWGFRAPNLVVSVLGG-SGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTAS-TGSSKVVAMGVAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGENRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLE------DTLAPGSGGLRRGEARDRIRRYFPKGDPEVLQAQVERIMTRKELLTVYSSEDGSEEFETIVLRALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQWRSFHLEASLM-----DALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYSA------VSPNSLIRNLL---DQASHASSSKSPPVNGTVELRPPNVGQVLRTLLGETCAPRYPARNTRDSYLGQDHRENDSLLMDWANKQPSTDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASAL-GACLLLRVMARLESEAEEAARRKDLAAT--FESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKWWGEMDSTTPIWALLLAF-FCPPLIYTNLIVF---RKS----EEEPTQKDLDFD---MDSSINGAGPPG---TVEPSAKVALERRQRRRPGRALCCGKFSKRWSDFWGAPVTAFLGNVVSYLLFLLLFAHVLLVDFQPTKPS------VSELLLYFWAFTLLCEELRQGLGGGWGSLASGGRGPDRAPLRHRLHLYLSDTWNQCDLLALTCFLLGVGCRLTPG--LFDLGRTVLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSILRRVFYRPYLQIFGQIPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANWLVVLLLIVFLLVANILLLNLLIAMFSYTFSKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHV 1081          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Mouse
Match: Trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:MGI Symbol;Acc:MGI:1351901])

HSP 1 Score: 245.743 bits (626), Expect = 7.582e-66
Identity = 242/982 (24.64%), Postives = 439/982 (44.70%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIE---KGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFER----NVRDIGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEI--LETDKMNVEIVDK-----YEEQLR-LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDR------NLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ--------ENLQD--LYMTSLRSIKC-----------------RCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRA--LIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI-NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELM-----------------LDDFKIPSP----CNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNK 3061
            Y+L+T++W    P LLIS+ GG K  N K   +    + GL++V +    WII GG H G+ K V EAV DF + S   E +V  I ++TWG + N   L      +     ++   +G +T LD N+  ++  DDGT  +Y  EI  R   E+      ++ G  A++I     + EGG   + +IY ++    P V+++ SGR AD+I ++  L   ++ + ++ +     ++E     T++  +   + + DI    +      +  D    +D  IL A++ +   +      N +  L LAV +N VDIA  ++F  +         L       L  N+ E ++LFL N   + EFV         ENL+   L+ + L+ +                      +++ +L+    +             L   +  I  N+    L+  S   RS+       +  R+L +W++I  + E+A I W   ++   +AL  S IL ++    K +   D S+ +L  + +F+  A  + T+ Y+ ++E+   +L R    W   TCLQ+A+    + F++    +++  + W G L      W+I++ +   PLL   FI                       F +++++                     + CR   +  F+ AP+V F + +LSY  FL +FAY+ +V+ +P            E L+Y+++   + EE  Q+  + +  GL+     Y S  WN  D+  I +FI+ +  R      +    R   ++   +F LR M  + IS+++GPK+I++++M+ DVFFFL + +++++S+G    +I   N     ++   + Y  Y   +G++                   D +K   P            +  T+ +   ++LL  NILLLNLLIAMF YTF ++Q  +++ + F +  L++E+H +
Sbjct:  154 YQLMTQHWGLDVPNLLISVTGGAKNFNMKLRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSCKEGEVITIGVATWGTIHNREGLIHPMGGFPAEYMLDEEGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTKLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNAINNGTPCVIVEGSGRVADVIAQVATLPVSEITISLIQQKLSIFFQEMFETFTENQIVEWTKKIQDIVRRRQLLTIFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIF--TDEWQWKPADLHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYENLEPSCLFHSKLQKVLAEEQRLAYASATPRLHMHHVAQVLRELLGDSTQLLYPRPRYTDRPRLSMTVPHIKLNVQGVSLR--SLYKRSTGHVTFTIDPVRDLLIWAVIQNHRELAGIIWAQSQDCTAAALACSKILKELS---KEEEDTDSSEEMLALADEFEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLCVDNGLWRIILCMLAFPLLFTGFIS----------------------FREKRLQ---------------------ALCRPARVRAFFNAPVVIFHMNILSYFAFLCLFAYVLMVDFQP-------SPSWCEYLIYLWLFSLVCEETRQLFYDPDGCGLMKMASLYFSDFWNKLDVGAILLFIVGLTCRLIPA--TLYPGRIILSLDFIMFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNESRVDWIFRGVVYHSYLTIFGQIPTYIDGVNFSMDQCSPNGTDPYKPKCPESDWTGQAPAFPEWLTVTL-LCLYLLFANILLLNLLIAMFNYTFQEVQEHTDQIWKFQRHDLIEEYHGR 1074          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Mouse
Match: Trpm4 (transient receptor potential cation channel, subfamily M, member 4 [Source:MGI Symbol;Acc:MGI:1915917])

HSP 1 Score: 238.039 bits (606), Expect = 5.497e-64
Identity = 238/964 (24.69%), Postives = 434/964 (45.02%), Query Frame = 2
Query:  497 TWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSL--TVGT--CAYDNSNTIEKG-KVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRD----IGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDD-DKIR---------IIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAII---SSREDRNLEKTLNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQE-NLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKN------------LLKVIYKIIC-------NLSDNILK----------FESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFC-----RALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI------------NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFK----IPSPCN-------------TTVCIVQSA--TLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI 3100
             WI+ GG H GI + V  AV D +  S    ++V  + ++ WGVV+N   L    G+    Y      E G +  LD NY  +   DDGT      E  FRL FE  V      +G   + I     L +G ++ ++ I  + Q  +P +++  SG AAD + E LE      + +      LR  +  D+IR         +++   +     KE +T++   D +   +  +L A++    S E       L LAV +N VDIA  ++F+     R+  L    +     + L  ++ E ++L + +  S+  F+    L  LY             +I +L+   D++    +  +P  N            +L+ +    C       N  D+ L            +  N + S   +  Q  + +L +W+L+    +MA+ FWE G  +V SAL G+ +L ++ + ++S+         L  +  F+ ++ D+  + Y  ++E+   +L R   LW   TCLQ+A+  +   F   +  +S   + W G++    P W +L+   F P LI   +I +  +++  +    +   D  +         +   +  + +         + C     +    F+ AP+  F+  ++SY+ FL++FA++ LV+ +P K         +ELL+Y +    + EE+ Q                ++  L ++L  Y+S +WN  D+L +  F++ +  R T     F   R    +   +F+LR +  + +++ +GPK++++ KM+ DVFFFL    +++++YG  +  I  P  +    ++  +FYRPY Q +G++  ++      IP  C+                C+ Q A   +++   +FLL+ NILLLNLLIAMF YTF+K+ G S+ ++   +  L+ EFH++P + PPL I  ++
Sbjct:    5 AWIVTGGLHTGIGRHVGVAVRDHQTAS-TGSSKVVAMGVAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGENRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLE------DTLAPGSGGLRRGEARDRIRRYFPKGDPEVLQAQVERIMTRKELLTVYSSEDGSEEFETIVLRALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQWRSFHLEASLM-----DALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYSA------VSPNSLIRNLL---DQASHASSSKSPPVNGTVELRPPNVGQVLRTLLGETCAPRYPARNTRDSYLGQDHRENDSLLMDWANKQPSTDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASAL-GACLLLRVMARLESEAEEAARRKDLAAT--FESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKWWGEMDSTTPIWALLLAF-FCPPLIYTNLIVFRKSEEEPTQKDLDFDMDSSI-NGAGPPGTVEPSAKVALERRQRRRPGRALCCGKFSKRWSDFWGAPVTAFLGNVVSYLLFLLLFAHVLLVDFQPTKPS------VSELLLYFWAFTLLCEELRQGLGGGWGSLASGGRGPDRAPLRHRLHLYLSDTWNQCDLLALTCFLLGVGCRLTPG--LFDLGRTVLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSILRRVFYRPYLQIFGQIPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANWLVVLLLIVFLLVANILLLNLLIAMFSYTFSKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHV 934          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Mouse
Match: Trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:MGI Symbol;Acc:MGI:1861718])

HSP 1 Score: 232.646 bits (592), Expect = 5.012e-62
Identity = 251/1037 (24.20%), Postives = 485/1037 (46.77%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNS--------NTIEKGKVTLDPNYDCYLFCDDGT-EKEYDKEIDFRLDFERNVRDI-----GAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLR-------LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVH-LDKKILDAIIS-----SREDRNLEKTLNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKID------------NINNPGKNLLKVIYKIICNLSDNILKF----ESFNLRSSNSHNANQ-----------NSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKI-----ELNIRKKSPKSWKSYHSESDQVSFCRA-LIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQ-INNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDF-KIPSPCNTTVCIVQSAT----------LIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFE 3217
            +EL+   W+ P P L++S+ G  +R     +  +   ++GL++  +    WI+    HVG+ + V +AV D  + S   + +V  I +++   + + R L  G    +++          I+     LD N   ++  + G      D   + +L  E+++        G   +QI     L  G    +E I R+++++ P +++  SG  AD++  ++    + V  V   E+Q R        + +  +   E+L +I + +   +T++D   +    LD  IL A++      S+E ++    L LAV ++ VDIA  ++F      ++  L +        + L  N+ + ++LF+ +   + EF+    LQ LY     S+  +   ++ +L+ R+ +  ++              I  P  +L +V   +   L D    F         R      A Q           + +R+LFLW+++    EMA  FW  G+E V +AL    I+ +M S+++ +   +++ T+ +   K+++LA D+ ++ Y  ++++   +L R  + W+  TCL +A   +   F   +  +++  + W GD++   P  ++L      P LI   +I +  +     +L   +  D    EK  +     +L    ++P++         Q +F      KF+ AP+  F+  ++ Y  FL +F Y+ LV+ +P  +      VT    +Y ++   ++EEI Q     E   L+ K   YV  +WN  DM+ IF+FI+ +  R   +   F   R   A+   +F+LR +  + I + +GPK+I++ +M+ DVFFFL   S+++++YG  + ++ +P+     ++   + YRPY Q +G++ LD+  +    C+    +++S+           +I+    FLL+TN+LL+NLLIAMF YTF  +QG ++ F+ F +  L+ E+H +P + PP    + +L  L    K +F  +++ K   L + L D  + KI  +E
Sbjct:   53 FELLLTEWHLPAPNLVVSLVGE-ERPLAMKSWLRDVLRKGLVKAAQSTGAWILTSALHVGLARHVGQAVRDHSLASTSTKIRVVAIGMASLDRILH-RQLLDGVHQKEDTPIHYPADEGNIQGPLCPLDSNLSHFILVESGALGSGNDGLTELQLSLEKHISQQRTGYGGTSCIQIPVLCLLVNGDPNTLERISRAVEQAAPWLILAGSGGIADVLAALVSQPHLLVPQV--AEKQFREKFPSECFSWEAIVHWTELLQNI-AAHPHLLTVYDFEQEGSEDLDTVILKALVKACKSHSQEAQDYLDELKLAVAWDRVDIAKSEIFNGDVEWKSCDLEE-----VMTDALVSNKPDFVRLFVDSGADMAEFLTYGRLQQLY----HSVSPK--SLLFELLQRKHEEGRLTLAGLGAQQARELPIGLPAFSLHEVSRVLKDFLHDACRGFYQDGRRMEERGPPKRPAGQKWLPDLSRKSEDPWRDLFLWAVLQNRYEMATYFWAMGREGVAAALAACKIIKEM-SHLEKEA--EVARTMREA--KYEQLALDLFSECYGNSEDRAFALLVRRNHSWSRTTCLHLATEADAKAFFAHDGVQAFLTKIWWGDMATGTPILRLLGAF-TCPALIYTNLISFSEDAPQRMDLEDLQEPDSLDMEKSFLCSRGGQLEKLTEAPRAPGDL---GPQAAFLLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSGSEVT----LYFWVFTLVLEEIRQGFFTDEDTHLVKKFTLYVEDNWNKCDMVAIFLFIVGVTCRMVPS--VFEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLVAYGVTTQALLHPHDGRLEWIFRRVLYRPYLQIFGQIPLDEIDEARVNCSLHPLLLESSASCPNLYANWLVILLLVTFLLVTNVLLMNLLIAMFSYTFQVVQGNADMFWKFQRYHLIVEYHGRPALAPP----FILLSHLSLVLKQVFRKEAQHKRQHLERDLPDPLDQKIITWE 1054          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Mouse
Match: Trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:MGI Symbol;Acc:MGI:1861718])

HSP 1 Score: 207.994 bits (528), Expect = 1.673e-54
Identity = 210/903 (23.26%), Postives = 411/903 (45.51%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNS--------NTIEKGKVTLDPNYDCYLFCDDGT-EKEYDKEIDFRLDFERNVRDI-----GAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLR-------LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVH-LDKKILDAIIS-----SREDRNLEKTLNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKID------------NINNPGKNLLKVIYKIICNLSDNILKF----ESFNLRSSNSHNANQ-----------NSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKI-----ELNIRKKSPKSWKSYHSESDQVSFCRA-LIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQ-INNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDD 2848
            +EL+   W+ P P L++S+ G  +R     +  +   ++GL++  +    WI+    HVG+ + V +AV D  + S   + +V  I +++   + + R L  G    +++          I+     LD N   ++  + G      D   + +L  E+++        G   +QI     L  G    +E I R+++++ P +++  SG  AD++  ++    + V  V   E+Q R        + +  +   E+L +I + +   +T++D   +    LD  IL A++      S+E ++    L LAV ++ VDIA  ++F      ++  L +        + L  N+ + ++LF+ +   + EF+    LQ LY     S+  +   ++ +L+ R+ +  ++              I  P  +L +V   +   L D    F         R      A Q           + +R+LFLW+++    EMA  FW  G+E V +AL    I+ +M    K     +++ T+ +   K+++LA D+ ++ Y  ++++   +L R  + W+  TCL +A   +   F   +  +++  + W GD++   P  ++L      P LI   +I +  +     +L   +  D    EK  +     +L    ++P++         Q +F      KF+ AP+  F+  ++ Y  FL +F Y+ LV+ +P  +      VT    +Y ++   ++EEI Q     E   L+ K   YV  +WN  DM+ IF+FI+ +  R   +   F   R   A+   +F+LR +  + I + +GPK+I++ +M+ DVFFFL   S+++++YG  + ++ +P+     ++   + YRPY Q +G++ LD+
Sbjct:   53 FELLLTEWHLPAPNLVVSLVGE-ERPLAMKSWLRDVLRKGLVKAAQSTGAWILTSALHVGLARHVGQAVRDHSLASTSTKIRVVAIGMASLDRILH-RQLLDGVHQKEDTPIHYPADEGNIQGPLCPLDSNLSHFILVESGALGSGNDGLTELQLSLEKHISQQRTGYGGTSCIQIPVLCLLVNGDPNTLERISRAVEQAAPWLILAGSGGIADVLAALVSQPHLLVPQV--AEKQFREKFPSECFSWEAIVHWTELLQNI-AAHPHLLTVYDFEQEGSEDLDTVILKALVKACKSHSQEAQDYLDELKLAVAWDRVDIAKSEIFNGDVEWKSCDLEE-----VMTDALVSNKPDFVRLFVDSGADMAEFLTYGRLQQLY----HSVSPK--SLLFELLQRKHEEGRLTLAGLGAQQARELPIGLPAFSLHEVSRVLKDFLHDACRGFYQDGRRMEERGPPKRPAGQKWLPDLSRKSEDPWRDLFLWAVLQNRYEMATYFWAMGREGVAAALAACKIIKEMSHLEKEA---EVARTMREA--KYEQLALDLFSECYGNSEDRAFALLVRRNHSWSRTTCLHLATEADAKAFFAHDGVQAFLTKIWWGDMATGTPILRLLGAFT-CPALIYTNLISFSEDAPQRMDLEDLQEPDSLDMEKSFLCSRGGQLEKLTEAPRAPGDL---GPQAAFLLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSGSEVT----LYFWVFTLVLEEIRQGFFTDEDTHLVKKFTLYVEDNWNKCDMVAIFLFIVGVTCRMVPS--VFEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLVAYGVTTQALLHPHDGRLEWIFRRVLYRPYLQIFGQIPLDE 924          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. UniProt/SwissProt
Match: sp|A7T1N0|TMP2L_NEMVE (Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 1.261e-87
Identity = 295/1114 (26.48%), Postives = 514/1114 (46.14%), Query Frame = 2
Query:  149 GQHFKSFNQMLIDNNSSAPQKSNLSACKT------FGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVG-----TCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVR-----------DIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILE------TDKMNVEIVD-KYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTL------------NLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQEN-LQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESF---------------------NLRSSNSHNANQN-------SYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKG-FNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFI--IPYVSNKKSCSNLSHEKV----KDKFLFEKEKIELNI----RKKSPKSWK--------SYHSESD-----------------------QVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNV-TAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNP-------NSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATL-IIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYIL---RKLWQ 3118
            G+  +  +Q  +++   + ++ N+++C T      +G+I F GY        P       TD N           L+ K WN   P L+IS+ GG K    K   ++   + GL++  +    WII GG + G+ K V EAV + +++   ++ QV +I I+TWG+V     L           Y    T       LDPN+  +   DDGTE +Y  EI  R   E  +             IG   V ++ EGG   + ++Y  ++K +P VVI  SGRAA ++            D   + ++D +YE+++R       +++E+     ++ K    I D+L+    +    LD  IS   D  + K L            NLA+ +N +D+A   +F   +  T   +TL       L  ++ E  +LFL N  S+ EF+  + L  LY       +      I  L+ +E    ++  I+      + V+ ++I  L  ++  FES+                     N +SS    AN N        Y ++FLW+++    E+A + WE G+E + +AL+ S +L +M S  +      D+S  L   +  F+E A  ++ + +  N+  +  +L R L+ ++ +T L++A+     DF+   +C+      WMG ++     WK+LV + + P+LI P I  +P   +++  +   H+K       K    KEK +  +    R K  K+          + + E D                       ++ FC  ++ FY AP  KFV  ++ Y+ F+ ++AY+ L         K +  +   E+++Y ++   ++EEI Q+       +  K+  Y S +WN  D+ ++ +FII+II+RF  N   F   R   ++ +  F +R++Q + ++R +GPK++MI+KM+ D+  F+ I ++F I+YG   H++  P       N+ W    I+ +   PY+Q YGEL LD+ +   P            L  +   I+++ TNILLLNLLIA+F YTF ++Q +S+K + F +  LV E+H++P+  PPL +  +IL   R +W+
Sbjct:   61 GRPRERHSQQALESGQGS-EEWNVASCTTKHPTNAYGEIDFEGYG--GQKRAPYLRMSHDTDANL-------VITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRR-GLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMFG-SDTQVNVIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQGAMLDPNHSHFFLVDDGTEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAYNHTIKRNVDGQTINVIDPQYEDEVR------AKVVEVFGAKGAD-KTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLKANRSSPVAQLNLALAWNRIDLAKSDIFTEEQQWT--TETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYA------EVPGNTTIKPLLQKEMGKRQVKTID------MDVVGEVIEELMGDM--FESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCL-YLPVLIFPIIYFVPDEQHERQAAEREHQKSLNQKSSKVKSHKEKNDAPVVPVYRSKEEKAVSNDEEARVGTENEEEDFQLEDYIPEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYFSDTWNFVDIFSLTVFIIAIILRFFTNSRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTW--VTITSVVQYPYWQMYGELFLDEIQGEKPKEFGEVDPDGRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHILIFIRWVWR 1136          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. UniProt/SwissProt
Match: sp|A0A0R4IMY7|TRPM2_DANRE (Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2)

HSP 1 Score: 269.24 bits (687), Expect = 1.452e-72
Identity = 267/999 (26.73%), Postives = 486/999 (48.65%), Query Frame = 2
Query:  344 NAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTC---AYDNSNTIEKGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNV-------RDIGAF--AVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEI--LETDKMNVEIVDKYEEQLRLTDDD---KIRIIEILSDIYS--NYKERITIHDL-LDQNVHLDKKILDAII-SSREDRNL-----EKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ--ENLQDLY--MTS---LRSIKCR-------------------CTEMISDLILREDKSFK----IDNINNPGKN--LLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDT--LLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSN--KKSCSNLSHEKVKDKFLFEKE---KIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI-NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGEL-----------------MLDDFKIPSP---CNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPP 3079
            N Y+L+T+ W    P LLIS+ GG K    K + + K  + GL++V +    WI+ GG H G+ K V  AV D+ + S   E Q+ +I ++ WGV+ N  +L        AY + +   +G+++ LD N+  +L  DDGT+  Y  EI+ R   E+ +       R+ G     V ++ +GG   + +IY S+    P VV++ SGR AD+I  +  +   K+ + ++++  ++  + +     +++IIE    I         +T+  +  D+N  +D  IL A++ +SR D +      E+ L LAV +N VDIA+ ++F      T S     ++    L  ++ E ++L L N   + EF++  E L +LY  + S   LR +  R                   C   +S+ +     SF     I +   P K+   LKV  K   +L  +  ++         S +   +  R+LFLW+++    E+A I WE  ++ + +AL  S IL K+    +  G +D  +   +L+ +  +++ A  + ++ +  + ++   +L R    W   TCL +A+  +   F+  +  ++   + W G+LS   P WK+L+ + F PL+   F+        ++       +K+  + +F  +   KI+ ++R  S KS      E   ++    L+ F ++P VKF   + SY  FL +FA + +++ +     +       ELL+Y+++   + EEI Q+ ++ + +G   K K Y+   WN+ D+L+I +FI  +I R   +   F   +    +   +F LR M  + ISR++GPK+I++R+M++D+FFF+ + S+++++YG     I   N +   ++I    Y PY   +G                     D  K   P    + T    +  T+++   ++LL  NILLLNLLIA+F YTF ++Q  ++  + F + +L+ E+H++P +PPP
Sbjct:  125 NLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRR-GLIKVAQTTGAWILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVEIELRARLEKLISKLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIAHVASVPVSKVTMALINRLLKRFFMQEYKNFTELQIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMF--SALVGDKPEFVRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEW---------SADTVWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLA---QESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGKIKRHLRGFSQKS------ELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQTSPSWR-------ELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQASDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWVVAYGVAKQGILIENEERLNWIIRGAVYEPYITIFGNFPTNIDNTLFDISSCSVNASDPLKPKCPMLNADNTPVFPEWLTIMM-LCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWKFQRYELIKEYHSRPALPPP 1094          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. UniProt/SwissProt
Match: sp|Q7TN37|TRPM4_MOUSE (Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus OX=10090 GN=Trpm4 PE=1 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 2.566e-68
Identity = 257/1025 (25.07%), Postives = 460/1025 (44.88%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSL--TVGT--CAYDNSNTIEKG-KVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRD----IGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDD-DKIR---------IIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAII---SSREDRNLEKTLNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQE-NLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKN------------LLKVIYKIIC-------NLSDNILK----------FESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVS-----------------FCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI------------NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFK----IPSPCN-------------TTVCIVQSA--TLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI 3100
            Y L+T+ W F  P L++S+ GG           +   ++GL+   +    WI+ GG H GI + V  AV D +  S    ++V  + ++ WGVV+N   L    G+    Y      E G +  LD NY  +   DDGT      E  FRL FE  V      +G   + I     L +G ++ ++ I  + Q  +P +++  SG AAD + E LE      + +      LR  +  D+IR         +++   +     KE +T++   D +   +  +L A++    S E       L LAV +N VDIA  ++F+     R+  L    +     + L  ++ E ++L + +  S+  F+    L  LY             +I +L+   D++    +  +P  N            +L+ +    C       N  D+ L            +  N + S   +  Q  + +L +W+L+    +MA+ FWE G  +V SAL G+ +L ++ + ++S+         L  +  F+ ++ D+  + Y  ++E+   +L R   LW   TCLQ+A+  +   F   +  +S   + W G++    P W +L+   F P LI   +I +   +KS      E  +    F+   ++ +I    P         S +V+                 F +    F+ AP+  F+  ++SY+ FL++FA++ LV+ +P K         +ELL+Y +    + EE+ Q                ++  L ++L  Y+S +WN  D+L +  F++ +  R T     F   R    +   +F+LR +  + +++ +GPK++++ KM+ DVFFFL    +++++YG  +  I  P  +    ++  +FYRPY Q +G++  ++      IP  C+                C+ Q A   +++   +FLL+ NILLLNLLIAMF YTF+K+ G S+ ++   +  L+ EFH++P + PPL I  ++
Sbjct:  104 YSLVTRSWGFRAPNLVVSVLGG-SGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTAS-TGSSKVVAMGVAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGENRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLE------DTLAPGSGGLRRGEARDRIRRYFPKGDPEVLQAQVERIMTRKELLTVYSSEDGSEEFETIVLRALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQWRSFHLEASLM-----DALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYSA------VSPNSLIRNLL---DQASHASSSKSPPVNGTVELRPPNVGQVLRTLLGETCAPRYPARNTRDSYLGQDHRENDSLLMDWANKQPSTDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASAL-GACLLLRVMARLESEAEEAARRKDLAAT--FESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKWWGEMDSTTPIWALLLAF-FCPPLIYTNLIVF---RKS----EEEPTQKDLDFD---MDSSINGAGPPG---TVEPSAKVALERRQRRRPGRALCCGKFSKRWSDFWGAPVTAFLGNVVSYLLFLLLFAHVLLVDFQPTKPS------VSELLLYFWAFTLLCEELRQGLGGGWGSLASGGRGPDRAPLRHRLHLYLSDTWNQCDLLALTCFLLGVGCRLTPG--LFDLGRTVLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSILRRVFYRPYLQIFGQIPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANWLVVLLLIVFLLVANILLLNLLIAMFSYTFSKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHV 1081          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. UniProt/SwissProt
Match: sp|O94759|TRPM2_HUMAN (Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens OX=9606 GN=TRPM2 PE=1 SV=2)

HSP 1 Score: 254.988 bits (650), Expect = 6.602e-68
Identity = 254/987 (25.73%), Postives = 446/987 (45.19%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIE---KGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFER----NVRDIGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEI--LETDKMNVEIVDK-----YEEQLR-LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDR------NLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ--------ENLQD--LYMTSLRSI------KCRCTEMISDL-------ILRE------DKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI-NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGEL--MLDDFKI-PSPCNT-------TVCIVQSAT----------LIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPP 3079
            Y L+T++W    P LLIS+ GG K  N K   +    + GL++V +    WII GG H G+ K V EAV DF + S   E ++  I ++TWG V     L   T ++     ++   +G +T LD N+  ++  DDGT  +Y  EI  R   E+      ++ G  A++I     + EGG   + +I  +     P VV++ SGR AD+I ++  L    + + ++ +     ++E     T+   +   + + DI    +      +  D    +D  IL A++ +   +      N +  L LAV +N VDIA  ++F        S   L       L  N+ E ++LFL N   + EFV         ENL    L+ + L+ +      +  C      L       +LRE         +     N+  + LL V +     L+   +   S   RSS       +  R+L +W+++    E+A I W   ++ + +AL  S IL ++    K +   D S+ +L  + +++  A  + T+ Y+ ++E+   +LTR    W   TCLQ+A+    + F++    +++  + W G LS     W++ + +   PLL+   I                       F +++++                  D  +       F+ AP+V F + +LSY  FL +FAY+ +V+ +P+           E  +Y+++   + EE+ Q+  + ++ GL+ K   Y S  WN  D+  I +F+  +  R      +    R   ++   LF LR M  + IS+++GPK+I++++M+ DVFFFL + +++++S+G    +I   N +   +L     Y  Y   +G++   +D     P  C+          C    AT           ++   ++LL TNILLLNLLIAMF YTF ++Q  +++ + F +  L++E+H +P  PPP
Sbjct:  155 YHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSD--LHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPH---VKLNVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELS---KEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLIS----------------------FREKRLQ------------------DVGTPAARARAFFTAPVVVFHLNILSYFAFLCLFAYVLMVDFQPVPS-------WCECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPA--TLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNERRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPP 1083          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. UniProt/SwissProt
Match: sp|E9PTA2|TRPM2_RAT (Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3)

HSP 1 Score: 252.677 bits (644), Expect = 3.219e-67
Identity = 246/983 (25.03%), Postives = 448/983 (45.57%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIE---KGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFER----NVRDIGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEI--LETDKMNVEIVDK-----YEEQLR-LTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDR------NLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ--------ENLQD--LYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLL----KVIY---------KIICNLSDNILKFESFNLRSSNSHNANQNSY-----RELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCR-ALIK-FYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI-NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELM-----------------LDDFKIPSP----CNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNK 3061
            Y+L+T++W    P LLIS+ GG K  N K   +    + GL++V +    WII GG H G+ K V EAV DF + S   E  V  I I+TWG + N  +L      +     ++   +G +T LD N+  ++  DDGT  +Y  EI  R   E+      ++ G  A++I     + EGG   + +IY ++    P V+++ SGR AD+I ++  L   ++ + ++ +     ++E     T++  +   + + DI    +      +  D    +D  IL A++ +   +      N +  L LAV +N VDIA  ++F        S   L       L  N+ E ++LFL N   + EFV         ENL+   L+ + L+ +     E ++     E    ++ ++    + LL    +++Y         ++   +    L  +  +LRS    +    ++     R+L +W++I  + E+A I W   ++   +AL  S IL ++    K +   D S+ +L  + +F+  A  + T+ Y+ ++E+   +L R    W   TCLQ+A+    + F++    +++  + W G L      W+I++ +   PLL   FI                       F +++++                     + CR A ++ F+ AP+V F + +LSY  FL +FAY+ +V+ +P            E L+Y+++   + EE  Q+  + +  GL+     Y S  WN  D+  I +FI  +  R      +    R   ++   +F LR M  + IS+++GPK+I++++M+ DVFFFL + +++++S+G    +I   N     ++   + Y  Y   +G++                   D +K   P            +  T+ +   ++LL  NILLLNLLIAMF YTF ++Q  +++ + F +  L++E+H +
Sbjct:  154 YQLMTQHWGLDVPSLLISVTGGAKNFNMKLRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSCKEGDVITIGIATWGTIHNREALIHPMGGFPAEYMLDEEGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTKLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNAITNGTPCVIVEGSGRVADVIAQVAALPVSEITISLIQQKLSVFFQEMFETFTENQIVEWTKKIQDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFTDEWQWKPSD--LHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYENLEPSCLFHSKLQKVLAEEHERLA--YASETPRLQMHHVAQVLRELLGDSTQLLYPRPRYTDRPRLSLPMPHIKLNVQGVSLRSLYKRSTGHVTFTIDPVRDLLIWAIIQNHRELAGIIWAQSQDCTAAALACSKILKELS---KEEEDTDSSEEMLALADEFEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLCVDNGLWRIILCMLAFPLLFTGFIS----------------------FREKRLQ---------------------ALCRLARVRAFFNAPVVIFYLNILSYFAFLCLFAYVLMVDFQP-------SPSWCEYLIYLWLFSLVCEETRQLFYDPDGCGLMKMASLYFSDFWNKLDVGAILLFIAGLTCRLIPA--TLYPGRIILSLDFIMFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNESRVDWIFRGVIYHSYLTIFGQIPTYIDGVNFSMDQCSPNGTDPYKPKCPESDWTGQAPAFPEWLTVTL-LCLYLLFANILLLNLLIAMFNYTFQEVQEHTDQIWKFQRHDLIEEYHGR 1075          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. TrEMBL
Match: A0A267F5R1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006430g1 PE=4 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 2.681e-114
Identity = 308/1123 (27.43%), Postives = 551/1123 (49.07%), Query Frame = 2
Query:  182 IDNNSSAPQKSNLSACKT------FGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVG----------TCAYDNSNTIE--KGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNV---------RDIGA------FAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLI---CEILETDKMNVEIV--DKYEEQLRLTDDDKIRIIEILSDIY-SNYKERITIHDL--LDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKT---LGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLY----------MTSLRSIKCRCTEMISDLILREDKSFKIDNINNPG----KNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFII-------PYV-------SNKKSCSNLSHEKVKDKFLFEKEKIELN----------------IRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEV--KVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELML-----DDFKIPS------PCNTT------------VCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI---LRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNL 3199
            +   +  P++  +  C        +G ++F  +E   L  N ++IR      +         ++L+TK W  P+P+L++S+ GG K+M   +++  K  +QG++ +  K  TWI+ GGF++G +KLV EA+ D++ L+  +E  V LI +  WG V++   L V              Y N +     KG+  L+P++  +L CDDGTE  +  EIDFR  FE+ V         R  G+        V ++ EGG++ +++   S++   P+VV+K SGRAA++I   CE  E ++  +E +  + +  +      +   +++ L  +    Y+  + ++D   +D N  LD+ IL   +  +   ++   LNLA+ +N  D+A  ++F S R +   Q T   L       L++NQ E + L   +  +I   +  E L  LY          M  LR      +  +S  ++ E K+      N       + LL+ +   +   S  +L+   +  R  +S+ A      +L +WS++   T+MA I W    + + SAL+ +++L  MKS  +S+G  + S  L   +  F+ LA  ++   Y  +++KT   L R L +W+  T L +A  G  ++F++  A ++   + W+     +LP W+ L+ +   P+LI   I        P         S++ S   +    V+ K +  ++  + +                +RK   +   S        SF + +  FY +P VKF+  + S + FL++F+++ LV LK   E   +  Q    E ++  +++  I EEI QI +  K   + KLK + + +W+++D++   + I  I++R  V  + F++VR  YA+TL++F +R MQFY I +++GPKV+M+ +MI D  FF +I  +F+++YG  + ++  PNS  +  LI ++ Y PY+Q YGEL L     DD K+        P N T               V S  +I+ F  ++L+TN+LLLNLLIAMF +TF+ +Q  S K +++ + QL+ EFH++P +  PL +  +I   L +LW++        +  ++ F++ Y +  Q +
Sbjct:  136 LSRTARMPKRWTVDGCTATARTDAYGVLRFENFEFTRLGQNAKYIRL-----DCLNSRPNLLWKLLTKTWRIPEPELIVSVTGGAKKMRPMSDKIIKKLRQGIINIATKTKTWIVTGGFNLGTNKLVGEAIRDYQ-LAGGSERDVVLIGVCPWGSVRDKECLLVSEDKSLEDDLPVSTYRNPDNTAPVKGQAVLEPHHTHFLLCDDGTESMFGAEIDFRASFEKKVAEQMVRRRSRGDGSDLRSVTPCVHLIIEGGRKDVQAALVSVETGSPVVVVKGSGRAANVIAYICENTELERYEIEAITEEHFSSEFEPDSSEMRSLVDWLMKLAEPAYQRMLNVYDAESMDPNEQLDRVILTTFLR-QTSLSVVTQLNLAMAWNRPDLAAQEIFSSERKAKWEQLTGRDLEYSMLRALARNQTEFVSLLFDHGINIGTLLNLETLAGLYSSLINKPDPQMMRLREQLDYLSSPLSSWLMTESKTVGYATHNESQTAYQERLLRAVGLYVSAKSGGVLR-SPYPRRDRSSYQAE-----DLLIWSIVVQRTDMARIIWRQTSDTIASALVSAMMLRNMKSLAESEGSLEASAQLGAAADSFEGLAAGVLATCYAQDKQKTLDTLVRRLPVWDGQTLLTLADQGECMEFMSQQAVQTKISDIWIAGSKTYLPLWRTLICM-LLPMLIPALIFDKWLLTSPPAGESTGAGSDRHSSVRMKRSSVQPKTVSTRQSFDRHQQQQQQQQKQQGATPSLRKSQQQQQVSSGGHIQNPSFLQCVFMFYTSPQVKFISTVASAVVFLLLFSFVTLVTLKHPNEATEEEPQPSVLEFVLIGWMVSLIAEEIRQIFDRNKVSALEKLKDWFAHAWDVFDLVLNLMMISCILVRVFVTEEYFVWVRMTYALTLTMFYIRFMQFYLIHQTLGPKVVMVTRMINDTVFFFAILVVFLLAYGVAAQALLYPNSPLSWKLIKDVVYLPYWQMYGELQLGDILADDDKVSPDSPPIMPSNVTGRGFEGGGEGEESEAVHSPLVIVLFAFYMLITNVLLLNLLIAMFQHTFDLVQESSRKLWAYSRYQLIFEFHHRPFLCHPLTVLCHIANVLERLWRAA---CGRKAPTRDAFMVDYDSRTQRM 1241          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. TrEMBL
Match: A0A267G848 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004998g1 PE=4 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 2.515e-113
Identity = 306/1123 (27.25%), Postives = 551/1123 (49.07%), Query Frame = 2
Query:  182 IDNNSSAPQKSNLSACKT------FGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVG----------TCAYDNSNTIE--KGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNV---------RDIGA------FAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLI---CEILETDKMNVEIV--DKYEEQLRLTDDDKIRIIEILSDIY-SNYKERITIHDL--LDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKT---LGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLY----------MTSLRSIKCRCTEMISDLILREDKSFKIDNINNPG----KNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFII-------PYV-------SNKKSCSNLSHEKVKDKFLFEKEKIEL----------------NIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEV--KVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELML-----DDFKIPS------PCNTT------------VCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI---LRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNL 3199
            +   +  P++  +  C        +G ++F  +E   L  N ++IR      +         ++L+TK W  P+P+L++S+ GG K+M   +++  K  +QG++ +  K  TWI+ GGF++G +KLV EA+ D++ L+  +E  V LI +  WG V++   L V              Y N +     KG+  L+P++  +L CDDGTE  +  EIDFR  FE+ V         R  G+        V ++ EGG++ +++   S++   P+VV+K SGRAA++I   CE  E ++  +E +  + +  +      +   +++ L  +   +Y+  + ++D   +D N  LD+ IL   +  +   ++   LN+A+ +N  D+A  ++F S R +   Q T   L       L++NQ E + L   +  +I   +  E L  LY          M  LR      +  +S  ++ E K+      N       + LL+ +   +   S  +L+   +  R  +S+ A      +L +WS++   T+MA I W    + + SAL+ +++L  MKS  +S+G  + S  L   +  F+ LA  ++   Y  +++KT   L R L +W+  T L +A  G  ++F++  A ++   + W+     +LP W+ L+ +   P+LI   I        P          ++ S   +    V+ K +  ++  +                 ++RK   +   S        SF + +  FY +P VKF+  + S + FL++F+++ LV LK   E   +  Q    E ++  +++  I EEI QI +  K   + KLK + + +W+++D++   + I  I++R  V  + F++VR  YA+TL++F +R MQFY I +++GPKV+M+ +MI D  FF +I  +F+++YG  + ++  PNS  +  LI ++ Y PY+Q YGEL L     DD K+        P N T               V S  +I+ F  ++L+TN+LLLNLLIAMF +TF+ +Q  S K +++ + QL+ EFH++P +  PL +  +I   L +LW++        +  ++ F++ Y +  Q +
Sbjct:  137 LSRTARLPKRWTVDGCTATTRTDAYGVLRFENFEFTRLGQNAKYIRL-----DCLNSRPNLLWKLLTKTWRIPEPELIVSVTGGAKKMRPMSDKIIKKLRQGIINIATKTKTWIVTGGFNLGTNKLVGEAIRDYQ-LAGGSERDVVLIGVCPWGSVRDKECLLVSEDKSLEDDLPVSTYRNPDNTAPVKGQAVLEPHHTHFLLCDDGTESMFGAEIDFRASFEKKVAEQMVRRRSRGDGSDLRSVTPCVHLIIEGGRKDVQAALVSVETGSPVVVVKGSGRAANVIAYICENTELERYEIEAITEEHFSSEFEPNSSEMRSLVDWLMKLAEPDYQRMLNVYDAESMDPNEQLDRVILTTFLR-QTSLSVVTQLNMAMAWNRPDLAAQEIFSSERKAKWEQLTGRDLEYSMLRALARNQTEFVSLLFDHGINIGTLLNLETLAGLYSSLINKPDPQMMRLREQLDYLSSPLSSWLMTESKTVGYATHNESQTAYQERLLRAVGLYVSAKSGGVLR-SPYPRRDRSSYQAE-----DLLIWSIVVQRTDMARIIWRQTSDTIASALVSAMMLRNMKSLAESEGSLEASAQLGAAADSFEGLAAGVLATCYAQDKQKTLDTLVRRLPVWDGQTLLTLADQGECMEFMSQQAVQTKISDIWIAGSKTYLPLWRTLICM-LLPMLIPALIFDKWLLTSPPAGESTGAGGDRHSSVRMKRSSVQPKTVSTRQSFDRHQQQQQQQHKQQGATPSLRKSQQQQQVSSGGHIQNPSFLQCVFMFYTSPQVKFISTVASAVVFLLLFSFVTLVTLKHPNEATEEEPQPSVLEFVLIGWMVSLIAEEIRQIFDRNKVSALEKLKDWFAHAWDVFDLVLNLMMISCILVRVFVTEEYFVWVRMTYALTLTMFYIRFMQFYLIHQTLGPKVVMVTRMINDTVFFFAILVVFLLAYGVAAQALLYPNSPLSWKLIKDVVYLPYWQMYGELQLGDILADDDKVSPDSPPIMPSNVTGRGFEGGGEGEESEAVHSPLVIVLFAFYMLITNVLLLNLLIAMFQHTFDLVQESSRKVWAYSRYQLIFEFHHRPFLCHPLTVLCHIANVLERLWRAA---CGRKAPTRDAFMVDYDSRTQRM 1242          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. TrEMBL
Match: A0A210PMT1 (Transient receptor potential cation channel subfamily M member 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05997 PE=4 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 3.355e-97
Identity = 311/1107 (28.09%), Postives = 552/1107 (49.86%), Query Frame = 2
Query:  227 CKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQ-ELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSN----------TIEKGKVT--LDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVR-------------DIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLIC-------EILETDKMNV---------EIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKER--ITIHDLLD-QNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTEMISDLILREDKSF-------KIDNINNP-------GKNLLKVIYKIICNLSDNILKFESFNL-------------RSSNSHNANQN----------SYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIP---YVSNKKSCS-----------NLSHEKVKD-KFLFEKEKIELNIRKKSPKSWKSYHSES------DQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKI--PSPCNT----------TVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPP---LNIAYYILRKLWQSG--KIIFHGD-----SKRKNTFL 3169
            C ++G+I+F GY      ++P +IR      N+ Q EL     ++I  YW  P P+LLIS+ GG KR + K    +K  + GL+        WII GG H G+ ++V E V ++ +L+   +  +  + +  WGV+ N  +L       +N N            EKGK T  LD N+  ++  DDG+  ++  EI+FR + E+ +               +    + ++ EGG   ++++  S++  IP++V++ +GRAAD I        +I+  D+ +          EI     E      +   +I   L  + S  K R  IT+ +L D +N  LDK IL+A++ + +  N    L+LA+ +N  D+A   +F SS+  T+   +L       L +N+   ++LFL N   + +F+  +NL +LY   L     R  ++ ++LI+   +++        ++++ N        GK ++ ++     N  D   K + F +             +++    A +             RELFLW+L+    ++A +FW+ GK+++G+AL+ + +L  +      +   ++S +L ++++ F++LA D+++  YK N+   H +L R L  + N T L +A    L+DF++  +C++     W G ++ +  T+KIL        ++ PF+IP   + SNK               NL      +   +    ++      +S +  +  +  S      D +S   A+  FY AP+ KF  Y ++Y+ FL IF+Y  L  L P   V    N+  E + + + +  ++EE+ Q+   ++  L++KL+S+ S  WN +D++   +F++S+I+RF ++ D+F + R  Y++TL+++ LR MQ +F+ ++IGPKVIMIRKM+ D+ FF +I ++F++S+G    +   PN   +  L+ ++ Y PY+Q YGEL L++ +   PS C T            C   +A + +   +++L+TNILL+NLLIAMF  TF K+Q  S K + F +  LV E++ +P + PP   LN A+  +R L      K+ +H D     S R NT L
Sbjct:  351 CDSYGEIEFHGYGH-DTESSP-YIRL----ANDTQPEL---VLDIILNYWKLPTPKLLISVTGGAKRFDMKPKLLEKFKR-GLINAATSTGAWIITGGTHTGVMEIVGEGVQEY-VLTYGKQKDIVCLGVPLWGVIANKDALDED----ENGNFPAIYSKEGLDAEKGKKTIPLDHNHTHFVIVDDGSRDKFGGEIEFRANLEKTISHMSCDSEGMSSNLQVNTPVISLIVEGGVGTMKTVSESIKNGIPVLVLEGTGRAADFIAAGYLFTKDIMNEDRSHFPPHYQQTMEEIATNNFEWKPGETNKPAKISLCLKQLESCLKSRRMITVFNLGDAENKDLDKAILNALLKANKS-NQSAQLSLALAWNRSDVARNTIFSSSK-KTIFGASLHDAMTTALIQNKKTFVKLFLENGVELKDFLTVKNLWNLYANCLNDKTDRSAQLFNNLIMYLKQTWGAYLCCRPVEHLGNQPELVELVGKTIVHIVGDEAINPYDGS-KTDRFKVCDVDPCMGYIVDDKATEKSMAGKKWRHVKHDFELPERELFLWALLLNRMDLAKLFWKLGKDHLGTALLAAALLKGLAKVADGEEEIELSVSLEESALMFEKLAVDVLSHCYKHNKALAHQLLVRQLVDYGNTTLLLLADAHELMDFMDHTSCQTKLNSVWKGRMALYTSTYKILAA------MVIPFLIPAIKFTSNKNPTEYLDDDDALDYDNLGEAMAGEGTAIISNSRVAPETESRSKQIKRKLYQVSLAGTGKDGISLVSAIYHFYTAPVTKFYWYTVAYLAFLAIFSYFVLTNLHPTSSVNSPSNI--EYVTWGWTITMVIEEVRQVLTRDQRSLVHKLRSWYSSVWNRFDLIMYLLFMLSVILRFVLSEDNFTWARMTYSITLAMYFLRFMQAFFVEKNIGPKVIMIRKMLTDLMFFFAILAVFVLSFGIAYQANLFPNDPPSWKLLRQVVYLPYWQMYGELFLENMEGEEPSSCTTNETLWRSGAQARCAENNAIVPLLLAVYMLLTNILLVNLLIAMFSDTFQKVQDNSLKVWRFYKFSLVYEYYERPSVFPPFIILNHAFRGVRWLMHKSFRKLNYHDDFKLHLSARDNTRL 1431          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. TrEMBL
Match: V4BKQ3 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_229069 PE=4 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 4.672e-92
Identity = 321/1149 (27.94%), Postives = 562/1149 (48.91%), Query Frame = 2
Query:  224 ACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDEN--ENQVKLISISTWGVVKNNRSLTVGTCA-------YDNSNTIEKGK-VTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFER-----------NVRDIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEIL---------ETDKMNVEIVDKYEEQLR----LTDDDKIR-IIEILSDIYSNYKERITIHDLLDQNV-HLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFV-QENLQDLY-MTSLRSIKCRCTEM-----------ISDLILREDKSFKIDNINNPGKNLLKVIYKIICNL-SDNILKF---ESF-------------------NLRS-------------------SNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYV----------------------------------SNKKSCSNLSHEKVKDK---FLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYI---FILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSP-C--NTTV--------CIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFH---GDSKRKNTFLIKYLNDDQNLKIRGFEHLCMES 3235
            AC +FG+I F G+   +  TN  ++R  P+   N      + ++++ ++W  P P+LLIS+ GG K+ + K   +    + GL+   +    WI+ GG   G+ + V EAV D  I S  N  +N+V  + I+TWGV+ NNR    G  A       Y   +T+++G    LD N+  ++  D+GT  +Y  EI+FR   E              + +    V ++ EGG   ++++  +L+++ P+VVI  +GR ADLI             E  + +VEI +  +EQ R    ++D +KIR +++ L++   N +  + +  L   +V  +D+ IL A++ + +  +    L LA+ +N  DIA  ++F +      +  +L       L +++ + +Q FL N     +F+ +E L ++Y +TS   +      M           +S    RE ++F      +   +LLK + K+I +L  D+ + F   E +                    L+S                    +SH+  +N  RELF+W+++     MA +FW+ G++ +G+A++ S +L  M    + +   ++S  L + +  ++ LA +++ + Y  +++    +L R   LW + T  QIA    L+DFL  + C++     W G ++ +    KI + I F      P ++P++                                  SN+    N       DK   F   K + + ++ KK       +  + + V+   AL+ FY AP+ KF   L++Y+ FL +F Y  LV+L+P     VI+  +  LL YI   ++   ++EE+ QI   ++   IYKL+++    WN +D+    +F+IS+++R+T+    F++ R  Y++TL++F LR MQ +FIS+++GPKVIMI KM+ D+FFF  I  +FI+S+G    +   PNS  +  ++  + Y PY+Q YGEL L+  +     C  N T+        C   +A + +   I++++TNILL+NLLIAMF YTF  IQ  S K + F ++ LV E  ++P + PPL I  +I R      K++ +   GD ++K+ F  K L  ++NL++  FE   ME+
Sbjct:  359 ACDSFGEITFRGFGHDT--TNSPYVRLDPSTNLN------DVWDILIEHWGLPVPKLLISVTGGAKKFDLKARLRTVLKQ-GLIHAAKSTGAWIVTGGTAAGVMEFVGEAVRD-HIFSTGNPEQNRVVALGIATWGVI-NNRLALDGEGANGLFPAVYAVEDTVDQGDGAPLDHNHTHFILVDNGTHGKYGGEIEFRSKLESYISQKVETGVATTQSVHVPCVLLVVEGGINTMKTVLETLRRNTPVVVINGTGRCADLIAYGYKLTKKKNDDEISRKSVEIDEILKEQTRKCLGVSDPEKIRSLVKELNECLHN-RRLVNVFSLERADVKEIDRAILYALLKANKS-DAHSQLALALAWNRCDIARHEIFTTDNRQKWNPSSLYDAMVTALVQDRTDFVQSFLDNGVDFHKFLTKETLWNIYCLTSNDMMDANGDVMRYMLGYIKQTWLSYFTCRETENF------DKSPSLLKNVSKVIVHLLKDSAMDFYHGEEYYVTAREVGMKWLGNTDTLKTLKSRITQQNLTATTKKTKKKKPKDSHDF-ENPARELFIWAILFNRRSMAHLFWKLGQDQIGAAVVASSLLKAMAEVAEHEEELELSADLNEHAEVYERLATNVLAECYGKDKKMAQQLLIREQTLWGDRTVFQIANNNTLMDFLEHSCCQTKLNTIWKGAMALYTSEPKICLCILF------PVLLPFIKFSTHKSLEDIIDDDDDDDDEEEEAEAENTESKDSNRPPPGNKVVPAETDKKKGFTPAKSRRKKDLVKKKMYGVDYFKCDRNNVNILSALVFFYSAPVTKFYTGLVAYLVFLGVFTYFVLVDLRP-----VIEENSPSLLEYITWVWLGTMVIEELRQIIVLDQPP-IYKLRNWFESVWNRFDLAMYMLFLISVVLRYTIFNTDFLWARISYSITLAMFYLRLMQSFFISKNMGPKVIMIEKMLTDLFFFFLILLVFIMSFGIAYQANLYPNSPSSWVILKNILYLPYWQMYGELFLERVEGEEEGCTYNETIWREDLSQRCPETNAFVPVLLAIYMILTNILLVNLLIAMFSYTFQTIQDNSLKVWRFYRLSLVQELFDRPTLVPPLVIINHIYRLF----KLMVNKTCGDFQKKDDFCEK-LTREENLRLSLFERGAMEN 1470          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. TrEMBL
Match: A0A077LAN8 (Transient receptor potential ion channel M b (Fragment) OS=Dugesia japonica OX=6161 GN=DjTRPMb PE=2 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 2.993e-90
Identity = 241/849 (28.39%), Postives = 413/849 (48.65%), Query Frame = 2
Query:  479 VMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVG------TCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDIGAFAV-QILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILE-TDKMNVEIVD-KYEEQLR----LTDDDKIRIIEILSDIYSNYKER---ITIHDLLDQNVHLDKKILDAIISSR-EDRNL--EKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQENL-QDLY---------------------------MTSLRSIKCRCTEMISDLILRE-----------------DKSFKIDNINN-PGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSY----------------RELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFL-----FEKEKIELNIRKKS------------------------------------PKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQ-INNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDS-FIFVRCFYAVTLSLFSLRTMQFYFISRSIG 2653
            V +   TWI+ GGF  G+ KLV EA  D+ ILS   +    ++ I TWG   NN+ L +       T   D+   ++KG+  L+P++D ++  DDGT+K++ +EI+FR  FE  +      +V Q++ EGGK  I +   +L  +IP+VV+K S RAAD+IC+++E +D M  E ++ KY E +      + DDK    + L +    YK++   + + ++ D   +LD  I++A  S   +D+NL  +  L LA+ FN  D+A+ ++F+       +   L +Y K+ L +NQ + +  FL    +++ F+ + L  DLY                           + ++  I  R T  I   + RE                 D    IDN  +   K+  K I   +   S N    +     +SN  N N+  Y                ++LFLW+L++   EMA IFW+NGK+++GSAL+ S+I + ++    +KG  ++ + L K    F+ ++ DI+++AY+ +Q +TH++L R L  W   +CL IA    +++FL  +AC++     W+G +   +  ++ILV IPF  L  + FI PY    K  ++ ++EK+ ++       F+  + E NI K++                                     K  K  H   D++ FC A+  FY AP+ KFV+ ++SY+ FL IF+Y  L+EL  +       N   E  VY++ + +++ EI Q     + N L  K  ++ S  WN +D+LT  +F +  I+R   +G+S  ++ R  +A++LS+F +         +++G
Sbjct:    1 VSKSAPTWIVTGGFEAGVSKLVGEASKDYSILS--KQQTFTVLGIGTWGCTYNNKKLLMNSENDKVTYHNDDIQKVKKGQSQLNPHHDAFILYDDGTDKKFGQEIEFRAQFEEFISKTAKCSVVQLIVEGGKNTIRTGAEALDSNIPVVVMKGSRRAADVICDVVEASDDMLDETIELKYSEFVDEWNMKSKDDKANFQQNLRNFAKRYKDKHKQVHLFNMRDFKNNLDTAIIEAAFSGTIDDKNLGDDAKLKLAMTFNRADVAEERIFEDK-----TDINLRLYMKQALVRNQWQFVDFFLRQGITVESFLTKKLLHDLYFDKEAIGYFIPAALLIFGNMNSKEIQNLKTVGKIISRLTSNIFPAMYREAEPDSCSCCCWNNVKITDTQLSIDNSTDYEVKDHEKYIEPKVITESSNCCHVKRDG--NSNGDNGNRIKYTIHPTRNREKEIIYTEQDLFLWALLTQRIEMAKIFWKNGKDHIGSALVASLICNSLQKKAGAKGEIEIQNNLKKFQEDFETMSIDILSEAYRRDQIRTHLLLIRGLPYWGRESCLDIANKNQMINFLFHSACQTRLNHIWLGKIPNIVNNFQILVNIPFGFLTSRLFIFPYNLFGKKQNDSANEKLNEEQQSISNKFQSPESEFNISKQTSSDNFFQNDYQIVNLKSKNWKKNKKSQEELKRTEYLSKFRKEEHFSMDKIHFCSAVKYFYTAPVTKFVMNIISYLAFLTIFSYFLLIELNIMSLSPNPINRATEYSVYVYFISYVIGEIRQFFMGGQANNLASKFNNWKSSMWNWFDLLTYIVFTVGYILR--CSGESNIVYCRTLFAMSLSMFFISLWNSIMFKKALG 838          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Cavefish
Match: trpm5 (transient receptor potential cation channel subfamily M member 5 [Source:NCBI gene;Acc:103047602])

HSP 1 Score: 247.284 bits (630), Expect = 8.802e-67
Identity = 241/995 (24.22%), Postives = 472/995 (47.44%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVG----TCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVR-------DIGAFAVQIL---YEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKY--EEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAII-----SSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTE--MISDLILR--EDKSFKIDNINNPG-----------KNLLKVIYKIICNL-------------SDNILKFESF----NLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVS-------FCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKN-GLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKI----PSPCNTTVCIVQSATLIIGFGIFX------------XXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI 3100
            Y+L+T+ W    P L++++ GG   ++      +   ++GL+   +    WI+  G   GI K + +AV D  + S  ++ +V  I I+ W ++ N   L         AY   +       +LD ++  ++  ++   +      D R+   +++          G+F + +L     G  + ++ +Y+++Q + P +++  SG  AD++  ++     + E+V +   E    L   D    ++++  I  N    +T+HD  +Q   LD  IL A++      S+E ++    L LAV +N VDIA  ++F        S + L     + L  ++ + ++LF+ N  ++ EF+    LQ+LY        C  +E  ++ DL+L+  ++K   + +   PG           +  L  + K++ +              ++ + K   F    +L   + H   +N +R+LFLW+++    +MA  FW  G E V +AL G  IL +M ++++S+  +  S        K+++ A D+ ++ Y  ++++ + +L R  + W+  T L +A   +   F   +  ++   + W G ++      K++++  F P LI   +I + S++   S    E+  +    + EK  L        S ++    +DQ           R   +F+ AP+  F+  +L Y  FLV+F Y+ L++ +P           AE+++Y ++   ++EEI Q   T+++  ++ K K YV  +WN  DM+ I +F++ +  R   N  ++   R   A+   +F+LR +  + I + +GPK+I++ +M+ DVFFFL   S+++I+YG  + ++ +PN     ++   + YRPY   +G++ L++       P  C   +  + + TL     I+             L+TN+LLLNLLIAMF YTF  +QG ++ F+ F +  L+ E+H++P + PP  I  ++
Sbjct:   96 YQLLTEQWGLSPPHLVVALVGG-DELDQMKPWLRDTVRKGLVRATQSTGAWILTNGLQFGITKHLGQAVRDHSLASTSSKVRVVAIGIAPWTMIHNKEMLLTAKPDQPAAYPTEDLPHGSVYSLDCHHSHFILVEEEQHRS-GATGDMRVKLLKHISLQRTGYGGPGSFEIPVLCLLVHGEPKILQRMYKTIQNATPWLLLAGSGGVADILVTLIYRGCWDTEMVQELLLETFTGLHSTDITSWVKVIQKILEN-GHLLTVHDP-EQTADLDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIFNGD--VEWSPQDLEEVMMDALVNDKPDFVRLFVDNGVNLGEFLTYGRLQELY--------CSVSEKSLLFDLLLKKHQEKQMLLASARTPGPPYMEPVDRRPRFTLHEVSKVLKDFLHDSCKGFYQKLPAERVGKGRLFHSQKDLPDLDQHC--ENPWRDLFLWAVLQNRQKMANYFWAMGPEAVAAALAGCKILKEM-AHLESEAESARS----MKEAKYEQFALDLFSECYSNSEDRAYALLVRKTHCWSKSTVLNLATEADAKSFFAHDGVQALLTKIWWGAMTTDTSISKLVLSF-FCPPLIWTNLIKF-SDEILQSRGGGEQFAELDSLDTEKALLLSDDDPDDS-EAAGDPADQSCSQAWSQFLLRRWKRFWSAPVTVFLGNVLMYFAFLVLFTYVLLLDFRPPPPDG---PSIAEIILYFWVFTLVLEEIRQSFFTDEDMNILKKCKLYVEDNWNKCDMVAISLFVVGVSCRMMEN--TYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVATQALLHPNDPRLDWVFRRVLYRPYLHIFGQIPLEEIDAAKMQPDNCTMDLQDIITGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQGNTDIFWKFQRYNLIVEYHSRPALAPPFIIISHL 1061          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Cavefish
Match: trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:ZFIN;Acc:ZDB-GENE-060531-95])

HSP 1 Score: 233.032 bits (593), Expect = 6.245e-62
Identity = 280/1125 (24.89%), Postives = 509/1125 (45.24%), Query Frame = 2
Query:  356 LITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLT---VGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVR--------DIGAFAVQILYEGGKRAIESIYRSLQKS--IPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLT--------DDDKIRIIEILSDIYSNYKERITIHDLLDQNVH-LDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVF---QSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTS----------LRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICN--------LSDNIL--KFESFNLRSSNSHNANQN------------------SYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGF-NDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKK-----------------SPKSWKSYHSESDQ----VSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLV--ELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELML-------DDFKIP-SPCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYY---ILRKL---WQSGKIIFHGDSKRKNTFLIK-YLNDDQNLKIRGFEHLCMESAMLENHQSTNVAN---INLNSDNLFDTXXXXXXXXXXXXXXXSSDKAITSRLGVIEKHLQKM 3412
            L+TK W    P+LLIS++GG +    +   ++   K GL++       WI  GG + G+ + V +A+ D    + ++  ++  I I+ WG+V+N   L    V       SN + K  V L+  +  ++  D+GT  +Y  E+  R   E+++           G   V ++ EGG   I  +   L+ +  +P+VV   SGRA+D++    +  +    I +   +QL +T              +  IL +     KE IT+  +  +    +D  IL A++    + +    L+LA+ +N VDIA  ++F   Q     +L Q  L     + L  ++ + ++L + N  S+  F+    L++LY T           +R +K     +     L  D    + +I    + L+   Y+  CN        L  N+   K +   +R        +                    + EL +W+++    +MAL FW++G+E +  AL+   +   M           D+S  L   S +F +LA +++ ++YK +++    +LT  L  W+N TCLQ+A+     DF+     +    + WMG L     +    + +    LL    +     NK   S +  E  ++ +L EK+  E +   K                 S  S K    E       +   R + +FY APIVKF  + ++Y+ +L++F Y+ LV  +L P  +  ++       + YIF  G  +E++ +I  +E   L+ K+K ++   WN+ D++ I IF I +++R   +     + R  Y V +  + +R +  + +++ +GP V+MI KM++D+ +F+ I  + ++S+G    +I NPN   +  L   +F+ PY+  YGE          D   +P  PC T   IV +         +LL+ NILL+NLLIA+F  TF +++  S + + F + QL+  FH +P++PPPL I  +   +L+ L   W+      H D +R   F +K ++ +D+  K+  FE  C+E    E     N +N   I + S+ + +  ++  E+   +   K+S + +  RL  +E+ + +M
Sbjct:   18 LMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGK-GLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDH---ASKSRGKICTIGIAPWGIVENQEDLVGKDVVRPYQTMSNPLSKLTV-LNSLHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKK-KELITVFRMGSEGHQDIDLAILTALLKG-ANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAML-----DALVLDRVDFVKLLIENGVSMHRFLTLSRLEELYNTRHGPSNTLYHLVRDVKKSEETLYLQGNLPPDYRISLIDIGLVIEYLMGGAYR--CNYTRKRFRTLYHNLFGPKRDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFSFPFHELMVWAVLLKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVEDISQELNHNSREFGQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSG---LKVILGLLLPPSILSLEFKNKDEMSYMPQE--QEAYLQEKDSDEADKPAKDKDEEDMEFTAMLGNVSSEASRKKVVEEVQHRHRLIPVGRKIYEFYNAPIVKFWFHTMAYVGYLMLFNYIVLVKMDLWPSPQEWIV-------IAYIFTNG--IEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSIGMVLRLQ-DPPLMSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEAPCGQNITTEDGTIVPLPPCKTGAWIVPAI-----MACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMVLKHLCCRWRK-----HDDDERD--FGLKLFITEDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMAMRLEEVNEREHFMKASLQTVDIRLAQMEELIGRM 1101          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Cavefish
Match: trpm4a (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:103041664])

HSP 1 Score: 230.335 bits (586), Expect = 3.307e-61
Identity = 263/1086 (24.22%), Postives = 468/1086 (43.09%), Query Frame = 2
Query:  233 TFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDF-RILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIE---KGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRD-----IGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILE-----TDKMNVEIVDKYEEQLRLTDDDKIR-------IIEILSD----IYSNYKERITIHDLLDQNVHLDKKILDAIIS-----SREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNP------GKNLLKV-----------IYKIICNLSDNILK---FESFNL--RSSNSHNANQ----------------NSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESD-------QVSFCRALI-----------------------------------KFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSI---QNPNSKWNLFLISELFYRPYFQTYGELMLDDF----KIPSPCNTTVCIVQSAT-----------LIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNI 3088
             FG+++F G    +   +  F+R       +        Y ++T +W  P P L++S+ GG  R     +  +   +QGL+   +    WI+ GG   G+   V EAV D     S  ++++V  I ++ WG+V N + L     ++     I+        LD NY  +L  DDG+      E +F  + E  + +      G+  ++I     L  G    ++ +  SL+K+ P +V+  SG AAD+I E+L+         + ++ D    +LR    + I+       ++E L D    IY N       H   D     D  +L A++      S +     + L LAV +N VDIA  ++F          + L     + L  N+ + +++F+ N  +I E++  + L+ LY +   S        +    LRE  S    + ++P       K  LKV           + +++  L   + +   +   +L   +SN   A Q                + +  LF+W+++   +EMA+ FWE   E+V SAL    +L ++    K +   +   ++ + + KF+ LA D  +  Y+ ++ ++  +L R   +W  +TCLQ+A+  +   F + +  ++   + W GD++     WK++ +    PL+    I       +   +L         L   +          P+    +H ESD       +  F  A I                                   +F+ AP+  F+  +L Y  FL +FAY+ LVE KP            E L+Y ++   + EE  Q       GL   +  Y+   WN +D+  I +F + ++ R      S+ F R    V   +F+LR +  + I++ +GPK+I++ KM+ DVFFFL    +++++YG  + ++    +P   W   +   +FYRPY   YG++ LD+     +   PC   V ++               ++I   ++LL+TN+LLLNLLIAMF YTF+K+Q  S+  + F +  L+ E+H++P + PP  I
Sbjct:   87 AFGEVEFAG----AGRRHSHFLRLSCDTPASL------VYSIMTVHWGLPPPNLVVSVMGGGGR-EKVKSWVRDVLRQGLVLAAQSTGAWIMTGGLKEGVGHCVGEAVRDHVAAASSPSQSKVVAIGVAPWGLVANRQQLVNAQGSFPARYYIQNTSHDSCYLDNNYQAFLLVDDGSVGHRGGETNFITNMEDYISNQRTGIWGSGNIEIPVLCMLISGEASVLKRMDMSLKKATPWLVLDGSGPAADMISELLDDLSPAASPADGDVRDSSTAELRNRTKEIIKKHFPAEKVLEKLVDRALSIYQNRALITVFHGDQDSPDDFDTVLLKALVRACRQMSSDASEYTEELKLAVAWNRVDIAKSELFNGD--IQWQYEALKDCMTDALVNNKPQFVRVFIENGLNILEYLTYQRLESLYQSLSDS---SLAYSLLQKWLRERHSLVAMSPHSPDSPEKKSKKSLKVPPNVRELSLYEVSRLLGELFGGMCQPFYYSVLDLDPGASNRKAAKQLNKLQADGAYGKRSCNHPWASLFIWAVLQNRSEMAIYFWEMAGESVLSALCACKMLREL---CKLENETETKLSIKELAQKFETLAHDTFSACYQSSESRSFTLLIRTSPVWGGVTCLQMAMAADARLFFSHDGVQTLLSQIWWGDMNSRTEVWKLVASFLMPPLIYTNLINFREHQVRHTDSLEGPSTATAALSLADLTRHTEEDSRPED--GHHGESDHPDGGGEETPFSLADITQAEEDAEEYAALKKDPKGAKSNLNKHPFMLQRWRQFWFAPVTSFLGNVLMYFLFLFLFAYVLLVEFKPPPPEGPAH---IEYLLYFWVFTLVCEEFRQSFFVGNTGLCQSMSLYIQDMWNKFDLTAIMLFCVGLVCRMFPW--SYEFGRSVLCVDYMVFTLRLIHIFAINKQLGPKIIIVGKMVKDVFFFLFFLGVWLMAYGVANQALLYSYDPRPYW---VFRRVFYRPYLHIYGQIPLDEIDAYRRGDKPCTNNVTLIHEGAEPCPQSEANWLVLILLSVYLLVTNVLLLNLLIAMFSYTFSKVQEHSDVHWKFQRYNLIVEYHSRPCLAPPFII 1143          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Cavefish
Match: trpm4a (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:103041664])

HSP 1 Score: 229.95 bits (585), Expect = 3.858e-61
Identity = 263/1086 (24.22%), Postives = 468/1086 (43.09%), Query Frame = 2
Query:  233 TFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDF-RILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIE---KGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRD-----IGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILE-----TDKMNVEIVDKYEEQLRLTDDDKIR-------IIEILSD----IYSNYKERITIHDLLDQNVHLDKKILDAIIS-----SREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNP------GKNLLKV-----------IYKIICNLSDNILK---FESFNL--RSSNSHNANQ----------------NSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESD-------QVSFCRALI-----------------------------------KFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSI---QNPNSKWNLFLISELFYRPYFQTYGELMLDDF----KIPSPCNTTVCIVQSAT-----------LIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNI 3088
             FG+++F G    +   +  F+R       +        Y ++T +W  P P L++S+ GG  R     +  +   +QGL+   +    WI+ GG   G+   V EAV D     S  ++++V  I ++ WG+V N + L     ++     I+        LD NY  +L  DDG+      E +F  + E  + +      G+  ++I     L  G    ++ +  SL+K+ P +V+  SG AAD+I E+L+         + ++ D    +LR    + I+       ++E L D    IY N       H   D     D  +L A++      S +     + L LAV +N VDIA  ++F          + L     + L  N+ + +++F+ N  +I E++  + L+ LY +   S        +    LRE  S    + ++P       K  LKV           + +++  L   + +   +   +L   +SN   A Q                + +  LF+W+++   +EMA+ FWE   E+V SAL    +L ++    K +   +   ++ + + KF+ LA D  +  Y+ ++ ++  +L R   +W  +TCLQ+A+  +   F + +  ++   + W GD++     WK++ +    PL+    I       +   +L         L   +          P+    +H ESD       +  F  A I                                   +F+ AP+  F+  +L Y  FL +FAY+ LVE KP            E L+Y ++   + EE  Q       GL   +  Y+   WN +D+  I +F + ++ R      S+ F R    V   +F+LR +  + I++ +GPK+I++ KM+ DVFFFL    +++++YG  + ++    +P   W   +   +FYRPY   YG++ LD+     +   PC   V ++               ++I   ++LL+TN+LLLNLLIAMF YTF+K+Q  S+  + F +  L+ E+H++P + PP  I
Sbjct:   87 AFGEVEFAG----AGRRHSHFLRLSCDTPASL------VYSIMTVHWGLPPPNLVVSVMGGGGR-EKVKSWVRDVLRQGLVLAAQSTGAWIMTGGLKEGVGHCVGEAVRDHVAAASSPSQSKVVAIGVAPWGLVANRQQLVNAQGSFPARYYIQNTSHDSCYLDNNYQAFLLVDDGSVGHRGGETNFITNMEDYISNQRTGIWGSGNIEIPVLCMLISGEASVLKRMDMSLKKATPWLVLDGSGPAADMISELLDDLSPAASPADGDVRDSSTAELRNRTKEIIKKHFPAEKVLEKLVDRALSIYQNRALITVFHGDQDSPDDFDTVLLKALVRACRQMSSDASEYTEELKLAVAWNRVDIAKSELFNGD--IQWQYEALKDCMTDALVNNKPQFVRVFIENGLNILEYLTYQRLESLYQSLSDS---SLAYSLLQKWLRERHSLVAMSPHSPDSPEKKSKKSLKVPPNVRELSLYEVSRLLGELFGGMCQPFYYSVLDLDPGASNRKAAKQLNKLQADGAYGKRSCNHPWASLFIWAVLQNRSEMAIYFWEMAGESVLSALCACKMLREL---CKLENETETKLSIKELAQKFETLAHDTFSACYQSSESRSFTLLIRTSPVWGGVTCLQMAMAADARLFFSHDGVQTLLSQIWWGDMNSRTEVWKLVASFLMPPLIYTNLINFREHQVRHTDSLEGPSTATAALSLADLTRHTEEDSRPED--GHHGESDHPDGGGEETPFSLADITQAEEDAEEYAALKKDPKGAKSNLNKHPFMLQRWRQFWFAPVTSFLGNVLMYFLFLFLFAYVLLVEFKPPPPEGPAH---IEYLLYFWVFTLVCEEFRQSFFVGNTGLCQSMSLYIQDMWNKFDLTAIMLFCVGLVCRMFPW--SYEFGRSVLCVDYMVFTLRLIHIFAINKQLGPKIIIVGKMVKDVFFFLFFLGVWLMAYGVANQALLYSYDPRPYW---VFRRVFYRPYLHIYGQIPLDEIDAYRRGDKPCTNNVTLIHEGAEPCPQSEANWLVLILLSVYLLVTNVLLLNLLIAMFSYTFSKVQEHSDVHWKFQRYNLIVEYHSRPCLAPPFII 1143          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Cavefish
Match: hrc (transient receptor potential cation channel subfamily M member 4-like [Source:NCBI gene;Acc:103047479])

HSP 1 Score: 227.639 bits (579), Expect = 2.283e-60
Identity = 256/1070 (23.93%), Postives = 485/1070 (45.33%), Query Frame = 2
Query:  167 FNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRIL-SDENENQVKLISISTWGVVKNNRSLTVGTCAYDNS---NTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFE-----RNVRDIGAFAVQI-----LYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILE-------------------TDKMNV--EIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVH-LDKKILDAIISSREDR-----NLE-KTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKN--------LLKVIYKIICN-LSDNILKFESFNLRSSN----SHNANQNSYRE---------LFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDK---FLFEKEKIELNIRKK----------SPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQ---NPNSKWNLFLISELFYRPYFQTYGEL----MLDDFKIPSPCNTTVCIVQ-----------SATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNI 3088
            F+  ++ +  SA   S  +    FG+++F G      N    F+R       +       AY ++T  W  PKP L++S+ GG  R +    + ++  +QGL+   +    WI+ GG   GI + + EAV D     S ++  +V  I ++ WG+V     L     +Y          +    LD N+  +L  DDG+      E  FR   E     +    +G+ ++ I     L  G    +E +  SL+K IP +V+  SG  ADL+ ++LE                   T K+N+   + +K  +    ++ D  ++++ L +++ + ++ I+I+ L  +     D  +L A++ + + R     +L  + L LAV +N VDIA  ++F          ++L  +  + L  ++ + ++LF+ N  ++ E++    L++LY  S+       T +   L  R+  +       +P K         LL+ +   +C    D+ LK +    R       +    +  YR+         LF W+++   +EMA+ FWE   E+V SAL    +L ++    K +   +   +L + ++KF+ LA D+ +K Y+ ++ ++ ++L +   +W   TCLQ+A+  +   F + +  ++   + W GD+      WK+++T+ F P L    +I +   +++      E  K +   +L+ +        K+          +PK   +  S   Q        +F+ AP+  F   L + + + +       V L   K          ELL+Y ++   + EEI          +  +++ Y    W+  D++ I +F+I +  R      SF F R    +   +F+LR +  + I + +GPK+I++ KM+ DVFFFL   ++++++YG  +  +    +P++     ++  +FYRPY   +G++    M   F+    C T V  +            +  ++I   I+LL+TNILL+NLLIAMF YTF K+Q  S+ ++ F + +++ E+H++P + PP  I
Sbjct:   68 FSSAIVSHWDSALHSSE-APTDAFGEVEFGGVSKRHSN----FLRL------SSDTPPATAYTILTSNWGLPKPNLVLSVVGGVGR-SKVKPKLREVLRQGLVRAAQSTGAWILSGGLREGIDRCLGEAVRDHTTAASSDSLTKVVAIGVAPWGLVNLRDELVNPEGSYPAGYFVTNTSRDSYCLDTNHQAFLLVDDGSTGRRGGEARFRAGLENYISQQRTGKLGSGSMDIPVLCTLVSGELYMLERLDLSLKKCIPWMVLAGSGGLADLVTDVLENVAAAPVLPAGGAEGEGEATTKINLRERVAEKVVKHFP-SEPDVDKLVDKLLNVHKS-QDLISIYHLEQEGPEDFDTVLLKALVRASKQRLSSDASLSTEELKLAVTWNRVDIARSELFTGD--IQWKNESLESFMTDALVNDKPQFVRLFIENGLNVQEYMTFGRLEELY-RSISDSSVAYTLLQRHLSERQGVAGTGWPAADPAKGLTLYEVAQLLEDLLGDVCQPFYDDKLKIQGITSRRKTIKKLTTVLQEGEYRQQRCVFPWASLFTWAVLQNRSEMAVFFWEMTPESVLSALSACKLLREL---CKLENETETKHSLKELAMKFENLAHDVFSKCYQSSESRSFVLLKKKSVVWRGATCLQMAMEADARHFFSHDGVQTLLSQIWWGDMDRNTENWKLVLTL-FIPPLCYTSLISFREVEEAEDGTPEEAPKARDIDWLYAETVFSFADIKRIQTKQEELRFTPKGNPTKKSPQKQCFLLSRWKQFWYAPVTAF---LGNMLMYFLFLLLFAYVLLVDFKPPPPKGPSPMELLLYFWVFTIVCEEIRGTFFIGNMTVRQRIRQYTQDLWHKCDLIAITLFLIGLCCRMFRR--SFWFARAALCLDYMVFTLRLIHIFAIHKQLGPKIIIVGKMMKDVFFFLFFLAVWMMAYGVANQGLIYSFDPSAD---RILRRVFYRPYLHIFGQIPYEQMDSGFEWNVTCTTNVTEIDENMEPCRDTRYNWMVVILLMIYLLVTNILLINLLIAMFSYTFTKVQERSDVYWKFQRFKVIIEYHSRPCLAPPFII 1108          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Sea Lamprey
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 219.55 bits (558), Expect = 9.333e-59
Identity = 250/1024 (24.41%), Postives = 455/1024 (44.43%), Query Frame = 2
Query:  233 TFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRK---DTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIE---KGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKE--SGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSN------YKERITIHDLLDQNVHLDKKILDAIISSREDRN-----LEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLY----MTSLRSIKCR------------CTEMISDLILREDK--SFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNS---------------HNANQ----NSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI-NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRF---TVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELML----DDFKIPSPCNTTVCIVQSATLIIGFG--------IFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPL 3082
             FG I+F G          Q +  F   GN+ +      ++L+ ++W+   P LLIS+ GG K  + K   +      GL +  R       WII GG + G+ K V E+V DF + S   E ++  I I+TWG++ N   L      +     ++   +G+++ LD N+  ++  D+GT  +Y  EI  R   E+ +      + Q    GG+           +S   V ++   + R  D+   +    K+ + I+      +R  +     +I    +IY +      +  RI    LL    +    ++  I +SR + N      +  L LA+ +N VDIA  ++F   R        L       L +N+ E + LF+ +   + E++    L+ LY     +SL  I  R                IS L +   +   F + +I+   + LL     ++    + + +F   +  S N+               +N  Q    +  R+LF+W+++    E+A  FW  GK+ + +AL+ S +L   K+ ++ +  +D +  +L  +  +++LA  ++ + YK ++ +   +L R L+ W   TCL +A   N   F + +  ++   + W G +S  L TW++++ I F PLLI   II +                        +  L     +P  W++                F+ API  F   ++SY  FL +FAY+ +++ +   +         E ++Y ++L  I+EE+ Q+  + EK G       Y+   WN  D+L + +F I +I R    ++N  +F   R    V   +F LR M  + +++++GPK+I++++M+ D+FFFL +  +++++YG  +  I   N +   ++   + Y+PY   +G+         F   S  N  +   Q    ++G          ++LL  NILLLNLLIAMF YTF  +Q  ++  + F + +LV+E+H++P + PPL
Sbjct:   71 AFGDIQFTGL--------GQRLGKFVRVGNDTEPSVL--FKLMMEHWHLDVPNLLISVTGGAKNFHLKPQLRTIFRH-GLNKTARSTGIQGAWIITGGSYAGVMKYVGESVRDFALASGSKEGKIVAIGIATWGIIHNKEHLIDAQGKFPAEYPMDEAGQGRLSCLDNNHSHFILVDNGTHGQYGVEIVLRARLEQYI------STQHTGSGGE----------CRSSKAVGVRGNCAARLWDMCVRVRHCGKIVLIIMQAXSMVVREINSS---VIFEKQNIYFDVLICLFFLGRIISRALLT-GTYACAMVVVCISASRGEANKAQESCDHQLRLALAWNRVDIATSEIFTDDR--KWQTGDLEQVMDAALLENRPEFISLFVEHGLILREYLTWARLESLYNGAPASSLLHILLRRISEGEKSPADPHRRWISTLPMAPKRMNHFSLYHISLLIRELLGDSTSML--YGNKMSRFSKLSPSSKNTGSTKGGTSLEFKGQTYNEGQLYCPDPERDLFIWAVLLNRRELANFFWSQGKDCMAAALMASKLL---KAMVQEEDDSDRTSDMLAQADNYEQLAIGLLDECYKDDELRAQKLLIRQLHSWGGATCLSMAYHANNKSFFSHSGVQALLTQIWWGGMSVDLKTWRVILCIIF-PLLIYTRIITF------------------------RWVLYAHTCTPTRWRN----------------FWTAPITVFWANVVSYFIFLWLFAYVIIMDFQYTPD-------WPEYVLYAWVLSLILEELRQVFTDPEKAGQWKAAVRYIKDIWNRIDILALLLFTIGVICRLIPNSINESTFQAGRSVLCVDYMVFCLRLMHIFTVNKTLGPKIIIVKRMVKDIFFFLFLLGVWVVAYGVATQGILILNEQRLDWIFRGVVYQPYLLIFGQFPTRVDSTTFDTTSCTNNGINTSQPRCPVLGVDWLTILLTCLYLLFANILLLNLLIAMFNYTFQLVQDNTDTIWKFQRYELVNEYHSRPSLAPPL 1008          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 191.815 bits (486), Expect = 4.903e-50
Identity = 223/1029 (21.67%), Postives = 449/1029 (43.63%), Query Frame = 2
Query:  353 ELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPN---------YDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI--------GAFAVQILYEGGKRAIESIYRSL--QKSIPLVVIKESGRAADLICEILE--------TDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITI-HDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSK---NQHEMLQLFLVNNFSIDEFVQ-ENLQDLY-------MTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSN---SHNANQNSYR-------------------------------ELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMS-DTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTW-KILVTIPFSPLLIKPFIIPYVSNKKSCSNLSH----EKVKDKFLFEKEKIELNIR-------------------------------KKSPKSWKSYHSESDQV-------SFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLD------DFKIPSPCNTTVCI---VQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNK 3061
            +L+ K W    P+LLIS++GG +        ++   K GL++       WI  GG + G+   V  A+ +    +  + +++  I I+ WGV++N      G     +S+ +   +   +P          +  ++  DDGT  +Y  E   R + E+++  +        G   V ++ EGG   I ++   L  +  +P+VV + +GRAAD++  + +         D ++ EIV   ++    +    + +++ L +     KE IT+ H   + +  +D  IL A++      + ++ LNLA+ ++ VDIA   VF   +   + +     + + ML     ++ + ++L + N  S+ +F+    L++LY       M++LR +  R + +  D        +KI  I+     +  VI  ++     ++   + F L   N    H A+ ++ R                               EL  W+++     MA+ FW++G+E++  AL+   +   +    K    +++    L    +KF +LA D++ ++++ ++     +LT  L  W+N TCL++A+      F+     +    + WMG L+    +W K++++I   P ++   ++ Y    KS + +SH    E++      E+E      R                                 +    +S H E + +       S  R + +FY APIVKF    L+YI FL++F Y+ LV+L+ +  V+       E  V +++    +E + +I  +E      K+K ++ G WN+ D L I +F +++ +R        I  +  Y++ +  + +R +  + +++++GP ++MI KM+      + I ++ ++S+G    +I    +  + +L   + ++PY+  +GE+         D + P PC T   I   +Q+  L + + I         +NLLIA F   + + +  S+K + F +      +H K
Sbjct:   16 QLMVKEWQMELPRLLISVHGGLQNFELHPKLKQVFSK-GLIKAALTTGAWIFTGGVNTGVVNHVGNALKEH---ASRSSHKICTIGIAPWGVIENR-----GDLVGQDSHVVSPYQTLSNPLSKLNLLNSLHSHFILVDDGTVGKYGAEAQLRRELEKHIATVACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILAFLHKNTDDTGELCDGLHDEIVGTIKKTFNFSHGQAMHLLQTLLECMRR-KELITVFHTGSEDHSDVDLAILTALLKGTNFSSADQ-LNLALAWDRVDIAKNHVFVYGQ-HWMVRLEWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTSDHHQMSNLRILLHRFSHLPPD--------YKITLID-----VGLVIEFLMGGAFRSMYTRKRFRLLYHNLYGQHRASVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSREDELKWKRLWCARVKFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSILMPPSIL---MLEY----KSKAEMSHIPQSEELHQMGQEEREHRAAATRDIPMQRCLSRRVFLRLLSFAIRILLLRTVGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLPSVQ-------EWFVILYLFMSAIERVREIFMSEPGKFGQKIKVWLDGYWNINDSLGILLFFVAVALR--SQSHLLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMWQQCMLMIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFGEVYAPEIDNNTDDEYP-PCTTGAFITPFLQAVYLFVQYIIM--------VNLLIAFFNNIYLEAKNISDKLWKFHRYHFTMYYHQK 994          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 189.119 bits (479), Expect = 3.025e-49
Identity = 197/910 (21.65%), Postives = 406/910 (44.62%), Query Frame = 2
Query:  353 ELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPN---------YDCYLFCDDGTEKEYDKEIDFRLDFERNVR-------------DIGAFAVQILYEGGKRAIESIYRSL--QKSIPLVVIKESGRAADLICEILE-TDKMNVEIVDKYEEQLRLTDD--DKIRIIEILSDIYSNYKERITIHDLLDQNVHLDK-KILDAIISSREDRNLEKT-------LNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFK-------EMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKID---NINNPG-KNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQN-------------SYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIK-SKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTW-KILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQV-------SFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKN-----GL--------IYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGEL 2836
            +L+ K W    P+LLIS++GG +        ++   K GL++       WI  GG + G+   V  A+ +    +  + +++  I I+ WGV++N   L VG     +S+ +   +   +P          +  ++  DDGT  +Y  E   R + E+++                G   V ++ EGG   I ++   L  +  +P+VV + +GRAAD++  + + TD        ++ + + L     + +R  E++    +  + R   H     +  +     ++ +I+         T       LNLA+ ++ VDIA   VF         Q  + + +        + L  ++ + ++L + N  S+ +F+    L++LY T    +    T      +L   +S  +     +N P   NLL +I    C+    +        + S +                    + EL  W+++     MA+ FW++G+E++  AL+   +   +    K S+   D S+ L + S +F +LA D++ ++++ ++     +LT  L  W+N TCL++A+      F+     +    + WMG L+    +W K++++I   P ++   ++ Y    KS + +SH       + + E++       +    +S H E + +       S  R + +FY APIVKF    L+YI FL++F Y+ LV+L+ +  V+       E  V +++    +E + ++++  +      GL          K+K ++ G WN+ D L I +F +++ +R        I  +  Y++ +  + +R +  + +++++GP ++MI KM+ ++F  + I ++ ++S+G    +I    +  + +L   + ++PY+  +GE+
Sbjct:   15 QLMVKEWQMELPRLLISVHGGLQNFELHPKLKQVFSK-GLIKAALTTGAWIFTGGVNTGVVNHVGNALKEH---ASRSSHKICTIGIAPWGVIENRGDL-VG----QDSHVVSPYQTLSNPLSKLNLLNSLHSHFILVDDGTVGKYGAEAQLRRELEKHIALQKIHTLACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILAFLHKNTDDTGWAHTHRHGQAMHLLQTLLECMRRKELVG---TRARVRTHTHTCTHGSAAISGGPSVETLIALHRTGAAAGTNFSSADQLNLALAWDRVDIAKNHVF------VYGQHWMALMWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNT----VSGPLTNPPKRPLLANSRSPPVGLNCTLNPPVIGNLLLMILGGTCSAIQAVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSEAVEDSSEELKQYSTEFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSILMPPSIL---MLEY----KSKAEMSH-------IPQSEELHQMGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLPSVQ-------EWFVILYLFMSAIERVREVSDGARETRKAAGLRSDSEASAHRKIKVWLDGYWNINDSLGILLFFVAVALR--SQSHLLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMANMFSIVIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFGEV 879          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Nematostella
Match: EDO30135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1N0])

HSP 1 Score: 315.464 bits (807), Expect = 5.170e-89
Identity = 295/1114 (26.48%), Postives = 514/1114 (46.14%), Query Frame = 2
Query:  149 GQHFKSFNQMLIDNNSSAPQKSNLSACKT------FGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVG-----TCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVR-----------DIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILE------TDKMNVEIVD-KYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTL------------NLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQEN-LQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESF---------------------NLRSSNSHNANQN-------SYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKG-FNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFI--IPYVSNKKSCSNLSHEKV----KDKFLFEKEKIELNI----RKKSPKSWK--------SYHSESD-----------------------QVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNV-TAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNP-------NSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATL-IIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYIL---RKLWQ 3118
            G+  +  +Q  +++   + ++ N+++C T      +G+I F GY        P       TD N           L+ K WN   P L+IS+ GG K    K   ++   + GL++  +    WII GG + G+ K V EAV + +++   ++ QV +I I+TWG+V     L           Y    T       LDPN+  +   DDGTE +Y  EI  R   E  +             IG   V ++ EGG   + ++Y  ++K +P VVI  SGRAA ++            D   + ++D +YE+++R       +++E+     ++ K    I D+L+    +    LD  IS   D  + K L            NLA+ +N +D+A   +F   +  T   +TL       L  ++ E  +LFL N  S+ EF+  + L  LY       +      I  L+ +E    ++  I+      + V+ ++I  L  ++  FES+                     N +SS    AN N        Y ++FLW+++    E+A + WE G+E + +AL+ S +L +M S  +      D+S  L   +  F+E A  ++ + +  N+  +  +L R L+ ++ +T L++A+     DF+   +C+      WMG ++     WK+LV + + P+LI P I  +P   +++  +   H+K       K    KEK +  +    R K  K+          + + E D                       ++ FC  ++ FY AP  KFV  ++ Y+ F+ ++AY+ L         K +  +   E+++Y ++   ++EEI Q+       +  K+  Y S +WN  D+ ++ +FII+II+RF  N   F   R   ++ +  F +R++Q + ++R +GPK++MI+KM+ D+  F+ I ++F I+YG   H++  P       N+ W    I+ +   PY+Q YGEL LD+ +   P            L  +   I+++ TNILLLNLLIA+F YTF ++Q +S+K + F +  LV E+H++P+  PPL +  +IL   R +W+
Sbjct:   61 GRPRERHSQQALESGQGS-EEWNVASCTTKHPTNAYGEIDFEGYG--GQKRAPYLRMSHDTDANL-------VITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRR-GLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMFG-SDTQVNVIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQGAMLDPNHSHFFLVDDGTEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAYNHTIKRNVDGQTINVIDPQYEDEVR------AKVVEVFGAKGAD-KTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLKANRSSPVAQLNLALAWNRIDLAKSDIFTEEQQWT--TETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYA------EVPGNTTIKPLLQKEMGKRQVKTID------MDVVGEVIEELMGDM--FESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCL-YLPVLIFPIIYFVPDEQHERQAAEREHQKSLNQKSSKVKSHKEKNDAPVVPVYRSKEEKAVSNDEEARVGTENEEEDFQLEDYIPEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYFSDTWNFVDIFSLTVFIIAIILRFFTNSRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTW--VTITSVVQYPYWQMYGELFLDEIQGEKPKEFGEVDPDGRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHILIFIRWVWR 1136          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Nematostella
Match: EDO47658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT7])

HSP 1 Score: 142.895 bits (359), Expect = 1.920e-34
Identity = 136/522 (26.05%), Postives = 249/522 (47.70%), Query Frame = 2
Query: 1781 SIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDL-SPFLPTWKILVTIPFSPLL------------------------IKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEK-NGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQS--------ATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNI---AYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMES 3235
            S +F ++A  ++ + YK N      +L      W   T L +A+     +F+  + C+    E WMG L + +  + K+L+ I F PL+                        + P   PY   +   +  +   + D   F K +       KS  + +    E   +   + +I FY API KF   L+ Y+ FLV+F+++ L+EL P+  ++       E ++  F+     EE+ Q+      N   ++   + S  WNL D   + +F +++ +R  +N  +       Y++ + L+ +R +  + +S+ +GP V+MI +M +D+ +FL I  +F+++YG    +I  P+ K +  LI+++F+RPYFQ YGEL ++D    S    T               T+I+ F  +LL+ NILLLNLLIA+F  TF+++Q  S + + F +  LV E+  +P + PP  +   A+ + + +W+  +      S++ +     +L  ++  K+  FE  C E+
Sbjct:  592 SREFYDIALGLLDECYKANDVLAQRLLIYHPVYWGGRTSLSLAVASRHEEFVAHSCCQKKLTEIWMGALKTGYNGSLKVLLGILFPPLIFALEFRSREEMQRVPTTDDDSADDLPPDFDPYHHREPGSAQYNDGYLGDGVAFVKNR-------KSSGNEEEPIVEIRLLGLGKRIIGFYNAPITKFWSNLIVYLLFLVVFSHVILIELPPVPSIE-------EWVLIGFVFSLCAEEVRQVRVINVWNFSFFESSDWASNVWNLCDGFAMVLFFLAVGLR--LNPGTLRIGHLVYSLDIMLWIIRLLDIFSVSKDLGPYVVMIGRMTIDMMYFLVIMVVFLLAYGVAQQAILFPHEKPSWELITKIFFRPYFQVYGELFIEDVDYSSNSRETAFSTPKFDEYGGRLVTVIMAF--YLLVANILLLNLLIAIFNNTFSEVQANSNQIWKFQRFSLVMEYRQRPRLVPPFILIAHAHGLAKAIWK--RACGAPASRQADCKFKLFLGKEEYHKLMLFEEQCTET 1093          

HSP 2 Score: 123.635 bits (309), Expect = 1.640e-28
Identity = 104/426 (24.41%), Postives = 197/426 (46.24%), Query Frame = 2
Query:  233 TFGKIKFLG--------YEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENE-----NQVKLISISTWGVVKNNRSLT---VGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRD-------IGAFAVQILYEGGKRAIESIYRSLQK--SIPLVVIKESGRAADL-----------------ICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLY 1381
             FG+++F G        Y  ++ +T+P+ +                   L+   W    P+LLIS+ GG K        ++   + GL++  +    W+I GG + G+ + V EAV    ++S   +     +QV LI I++WG+V +   L    V    Y  +++++     LD N+  ++  D+GT+ EY  EI FR   E  +          G   V ++ EGG   I ++  S+ +  ++P+V+ + SGRAAD+                 + +++E  ++  +I   + E    + +D++ I + +    +  +E +TI  + D  + +DK IL A++ S+  + LE  L+LA+ ++  DIA  ++F   +   +    L     E L  ++ E + L L N  S+  F+  + L++LY
Sbjct:   19 AFGELEFQGAGQPSRAKYIRLAHDTDPELV-----------------LRLLCGEWALDLPKLLISVTGGAKNFILSPKIKRVLRE-GLLKAAQTTGAWVITGGTNTGVMRHVGEAVKGHTVMSRGEQLKNTAHQVHLIGIASWGIVDHKEMLVNPKVEVVPYQMTSSMQSRGACLDNNHSHFILVDNGTDGEYGGEISFRASLENLIASKKMAQKFHGVPVVLLVLEGGPNTIRTVLESVSRCPAVPVVIAEGSGRAADILAFAHRFIAPSNGEMSGVADVVEHRQLLHKIEKSFAE---CSPEDRLSIYQNVLKCVAK-REFVTIFCVDDGGLEVDKAILRALLKSQHSQ-LEDQLSLALVWDRADIAKTEIFTEDQKWEVPM--LETAMMEALLHDRVEFVDLLLDNGVSMANFLTVKRLEELY 419          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 256.529 bits (654), Expect = 1.868e-69
Identity = 262/1045 (25.07%), Postives = 491/1045 (46.99%), Query Frame = 2
Query:  233 TFGKIKFLG-------YEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDN---SNTIEKGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVR---------DIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEI--LETDKMNVEIVDKYEEQL------RLTDDDKIRIIEILSDIYSNYKERITIHDLL-DQNVHLDKKILDAII-SSREDRNL-----EKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ--ENLQDLY--MTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKII---------CNLSDNILKFESFNLRSSNSHN------ANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYH------SESDQVSFC-RALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI-NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYG---------ELMLDDF----------KIPSPCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYY---ILRKLW 3115
             FG+I+F G       Y  +S  T+P+ +                 Y+L+T+ W+   P LLIS+ GG K  N K + +    + GL++V +    WII GG + G+ K V +AV D+  LS+  + Q+  I ++TWGV+ N  +L      +     ++   +G+++ LD N+  +L  DDGT   Y  EI+ R   E+ +           +    V ++ EGG   + +I+ +++   P V+ + +GR AD+I ++  L   ++ + ++ +  E+       + T+   I   + + DI       +TI  +  D +  +D  IL A++ +SR    L     +  L LAV +N VDIA  ++F  +  S  S   L       L  N+ + + L L N  S+ +F+Q  E L +LY  M S   ++     + S   L +  +  + ++++  ++LL    + I         C  ++++    S +L  +N         A +++  ++FLW+++    ++A I WE  ++++ +AL  + IL K+      +   + ++ +L  +  ++E A  + ++ Y  ++E+   +L    N W   T L +A+      F+ L+  +++    W G+LS      ++L+ + F PL+   F+              H++     LF+KE  +    KK  +   + H      S  D+   C   L+  Y +P VKF   ++SY  FL +FA + +++      V        ELL+Y+++   + EE  Q+  N++  G   K K Y++  WN+ D+L+I +F++ +  R T   + F   +    +   +F LR M  + IS+++GPK+I++R+M+ D+FFF+ + S+++++YG     I   N     ++     Y PY   +G         +  LD            K P        +      I    ++LL  NILLLNLLIA+F +TF ++Q  +++ + F + +L+ E+H++P  PPP  I  +   ++R +W
Sbjct:   92 AFGEIQFDGLQQTTAKYARVSSETSPEVL-----------------YDLLTEQWHLLPPNLLISVTGGAKNFNLKPHLRNMFHR-GLIKVAQTTGAWIITGGTNAGVMKHVGQAVRDYS-LSNSIQGQIVAIGVATWGVIHNREALINEEGCFPALYMTDKTSQGRLSCLDKNHTHFLLVDDGTHGHYGVEIELRTCLEKCISGKQLGKKDSSVTIPVVCVVLEGGPGTLNTIFNAMKNGTPCVIFEGTGRIADVIAQVSGLPLQQITITLIHQLMEKFFGQEYKKFTELSVIEWTKKIQDIV-RMSHLLTIFRVTEDSHGDVDVAILKALLKASRSSETLTLDCWKTQLELAVAWNRVDIAKTEIF--TEDSLWSSADLHQAMFSALVGNKPQFVTLLLENGMSLRKFLQNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSNNITLTHVSDEVRHLLGNATRHIYPPYVEQRYCMSAEDL----SLSLSKNNGAPRPAGEVAQRDASSDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRILKKLAG---GESDAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVDNHILRVLICMLFFPLIYTGFLA-----------FRHDE-----LFQKEAKKQEAMKKVKRVTGNTHGAQSLGSAPDKPLSCWDRLVSLYGSPQVKFYWNIVSYFFFLNLFAGVLMMDFHATPSV-------PELLLYVWVFSLVCEEFRQLFCNSDGFGFKIKAKLYITDLWNILDVLSILLFLLGLAFRLT--SELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKIIIVRRMMKDLFFFMFLLSIWVVAYGVAKQGILIHNDTRLDWIFRGAIYEPYLIIFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPVFPEWLTITMLCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIFSHLSLLIRSIW 1082          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 255.373 bits (651), Expect = 4.028e-69
Identity = 262/1045 (25.07%), Postives = 491/1045 (46.99%), Query Frame = 2
Query:  233 TFGKIKFLG-------YEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDN---SNTIEKGKVT-LDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVR---------DIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEI--LETDKMNVEIVDKYEEQL------RLTDDDKIRIIEILSDIYSNYKERITIHDLL-DQNVHLDKKILDAII-SSREDRNL-----EKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ--ENLQDLY--MTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKII---------CNLSDNILKFESFNLRSSNSHN------ANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYH------SESDQVSFC-RALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQI-NNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYG---------ELMLDDF----------KIPSPCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYY---ILRKLW 3115
             FG+I+F G       Y  +S  T+P+ +                 Y+L+T+ W+   P LLIS+ GG K  N K + +    + GL++V +    WII GG + G+ K V +AV D+  LS+  + Q+  I ++TWGV+ N  +L      +     ++   +G+++ LD N+  +L  DDGT   Y  EI+ R   E+ +           +    V ++ EGG   + +I+ +++   P V+ + +GR AD+I ++  L   ++ + ++ +  E+       + T+   I   + + DI       +TI  +  D +  +D  IL A++ +SR    L     +  L LAV +N VDIA  ++F  +  S  S   L       L  N+ + + L L N  S+ +F+Q  E L +LY  M S   ++     + S   L +  +  + ++++  ++LL    + I         C  ++++    S +L  +N         A +++  ++FLW+++    ++A I WE  ++++ +AL  + IL K+      +   + ++ +L  +  ++E A  + ++ Y  ++E+   +L    N W   T L +A+      F+ L+  +++    W G+LS      ++L+ + F PL+   F+              H++     LF+KE  +    KK  +   + H      S  D+   C   L+  Y +P VKF   ++SY  FL +FA + +++      V        ELL+Y+++   + EE  Q+  N++  G   K K Y++  WN+ D+L+I +F++ +  R T   + F   +    +   +F LR M  + IS+++GPK+I++R+M+ D+FFF+ + S+++++YG     I   N     ++     Y PY   +G         +  LD            K P        +      I    ++LL  NILLLNLLIA+F +TF ++Q  +++ + F + +L+ E+H++P  PPP  I  +   ++R +W
Sbjct:   92 AFGEIQFDGLQQTTAKYARVSSETSPEVL-----------------YDLLTEQWHLLPPNLLISVTGGAKNFNLKPHLRNMFHR-GLIKVAQTTGAWIITGGTNAGVMKHVGQAVRDYS-LSNSIQGQIVAIGVATWGVIHNREALINEEGCFPALYMTDKTSQGRLSCLDKNHTHFLLVDDGTHGHYGVEIELRTCLEKCISGKQLGKKDSSVTIPVVCVVLEGGPGTLNTIFNAMKNGTPCVIFEGTGRIADVIAQVSGLPLQQITITLIHQLMEKFFGQEYKKFTELSVIEWTKKIQDIV-RMSHLLTIFRVTEDSHGDVDVAILKALLKASRSSETLTLDCWKTQLELAVAWNRVDIAKTEIF--TEDSLWSSADLHQAMFSALVGNKPQFVTLLLENGMSLRKFLQNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSNNITLTHVSDEVRHLLGNATRHIYPPYVEQRYCMSAEDL----SLSLSKNNGAPRPAGEVAQRDASSDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRILKKLAG---GESDAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVDNHILRVLICMLFFPLIYTGFLA-----------FRHDE-----LFQKEAKKQEAMKKVKRVTGNTHGAQSLGSAPDKPLSCWDRLVSLYGSPQVKFYWNIVSYFFFLNLFAGVLMMDFHATPSV-------PELLLYVWVFSLVCEEFRQLFCNSDGFGFKIKAKLYITDLWNILDVLSILLFLLGLAFRLT--SELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKIIIVRRMMKDLFFFMFLLSIWVVAYGVAKQGILIHNDTRLDWIFRGAIYEPYLIIFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPVFPEWLTITMLCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIFSHLSLLIRSIW 1082          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Medaka
Match: trpm5 (transient receptor potential cation channel subfamily M member 5 [Source:NCBI gene;Acc:101161300])

HSP 1 Score: 206.068 bits (523), Expect = 1.022e-53
Identity = 216/990 (21.82%), Postives = 442/990 (44.65%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVG----TCAYDNSNTIEKGKVTLDPNYDCYLFCDD-----GTEKEYDKEIDFRLDFER-NVRDIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEIL-----ETDKMNVEIVDKYEEQLRLTD-DDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAII-----SSREDRNLEKTLNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTEMISDLILR--EDKSFKIDNINNPGK-------------NLLKVIYKIICNLSDNILKF---------ESFNLRSSNSHNAN-----QNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALI---------------KFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNT-EKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPS---PCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI 3100
            Y+++T+ W    P L++++ GG   +       +   ++GL++  +    WI+  G   GI K + +AV D  + S  +  +V  I I+ W ++ N  +L          Y   +       +LD N+  ++  ++     G   E   ++   +  +R      G+F + +L        + +  S+  S P +++  SG  AD++  ++     +TD ++  ++D +       D  + +++I+ + D    +   +T+HD   +   LD  IL A++      S+E ++    L LAV +N VDIA   +F      +A  L +  +     + L  ++ + ++LF+ N  ++ EF+    LQ+LY +           ++ +L+L+  ++K   +     PG               L +V   +   L D+   F             L  S  +        ++ +R+LFLW+++    +MA  FW  G E V +AL G  IL +M + ++S+  +  S        K+++ A D+  + Y  ++++ + +L R  + W+  T L +A   +   F   +  ++   + W G ++      K++V+  F P LI   +I +          S E++ ++    K+ +EL+          S  +E   +   R+++               +F+ AP+  F+  ++ Y  FL +F Y+ L++ K   +   +     E+++Y ++   ++EEI Q   T E+  +I K K YV  +WN  DM+ I +F++ +  R      ++   R   A+   +F+LR +  + I + +GPK+I++ +M+ DVFFFL   S+++I+YG  + ++ +PN     ++     YRPY   +G++ L++  +     PC      + +  L+I   +              A  G     +QG ++ F+ F +  L+ E++++P + PP  I  ++
Sbjct:   72 YQMLTQEWGLSPPHLVVAVVGG-DELAQMKPWLRDTLRKGLVKAAQSTGAWILTNGLRFGITKHLGQAVRDHSLASTSSTVRVVAIGIAPWNMIHNREALLSAKVDEPVVYTPQDLPHGSVYSLDNNHSHFVLVEEDPARPGATSEMRVKLLKHISLQRTGYGGAGSFEIPVLCLLVHGEPKILKVSIANSTPWLILAGSGGVADILVTLMNRGCWDTDSVHELLLDTFPNAHHSADISNWVKLIQKILD----HGHLLTVHDPEQETSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSDIFNGDVEWKACDLEEVMM-----DALINDKPDFVRLFVDNGVNLGEFLTYGRLQELYWSVSEK------SLLHNLLLKKYDEKQLLLGAARTPGPPGHYPSEQGKPRFTLFEVAKVLKDFLHDSCKGFYQKVPTEKPPKGRLFQSQKNLPELEELCEHPWRDLFLWAVLQNRQQMANYFWAMGPEAVAAALAGCKILKEM-ARLESEAESARS----MKEAKYEQFALDVFGECYSNSEDRAYALLVRRTHCWSKSTVLNLATEADAKSFFAHDGVQALLTKIWWGAMTTDTAISKLVVSF-FCPPLIWTNLIKF----------SDEELDNRS-SNKQFVELD----------SLDTEKALIFLLRSILICASVWWRFFLRRWRRFWSAPVTVFLGNVIMYFAFLFLFTYVLLLDFKAPPQGPGV----PEIMLYFWVFTLVLEEIRQSFFTDEEMNIIKKFKLYVEDNWNKCDMVAILLFVVGVSCRMAAG--TYEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVATQALLHPNDPRIDWVFRRALYRPYLHIFGQIPLEEIDVMGLLPPCPN----IYANWLVILLSV------------RAADLGSRTKVVQGNTDIFWKFQRYNLIVEYYSRPALAPPFIIISHL 996          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Medaka
Match: trpm5 (transient receptor potential cation channel subfamily M member 5 [Source:NCBI gene;Acc:101161300])

HSP 1 Score: 205.297 bits (521), Expect = 1.589e-53
Identity = 236/995 (23.72%), Postives = 458/995 (46.03%), Query Frame = 2
Query:  350 YELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVG---TCAYDNSNTIEKGKVTLDPNYDCYLFCDD-----GTEKEYDKEIDFRLDFERNVRDIGAFAVQIL---YEGGKRAI---ESIYRSLQKSIPLVVIKESGRAADLICEIL-----ETDKMNVEIVDKYEEQLRLTD-DDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAII----SSREDRNLEKTLNLAVRFNCVDIADFKVFQSS---RASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMTSLRSIKCRCTEMISDLILR--EDKSFKIDNINNPGK-------------NLLKVIYKIICNLSDNILKF---------ESFNLRSSNSHNAN-----QNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNAC-RSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYH--SESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNT-EKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGF-----------------GIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI 3100
            Y+++T+ W    P L++++ GG   +       +   ++GL++   + T WI+  G   GI K + +AV D  + S  +  +V  I I+ W ++ N  +L         Y   +       +LD N+  ++  ++     G   E   ++   +  +R     G+F + +L     G  + +   + +Y+ +  S P +++  SG  AD++  ++     +TD ++  ++D +       D  + +++I+ + D    +   +T+HD   +   LD  IL A++     S+E ++    L LAV +N VDIA   +F      +A  L +  +     + L  ++ + ++LF+ N  ++ EF+    LQ+LY +           ++ +L+L+  ++K   +     PG               L +V   +   L D+   F             L  S  +        ++ +R+LFLW+++    +MA  FW  G E V +AL G  IL +M + ++S+  +  S        K+++ A D+  + Y  ++++ + +L R  + W+  T L +A   +   F   +   ++   + W G ++      K++V+  F P LI   +I                   KF F    +EL+    S  + K+     + D   F R   +F+ AP+  F+  ++ Y  FL +F Y+ L++ K   +   +     E+++Y ++   ++EEI Q   T E+  +I K K YV  +WN  DM+ I +F++ +     +   ++   R   A+   +F+LR +  + I + +GPK+I++ +M+ DVFFFL   S+++I+YG  + ++ +PN     ++     YRPY   +G++ L++     P     C   S  +++G                   IFLL+TN+LLLNLLIAMF YTF  +QG ++ F+ F +  L+ E++++P + PP  I  ++
Sbjct:   65 YQMLTQEWGLSPPHLVVAVVGG-DELAQMKPWLRDTLRKGLVKAA-QSTAWILTNGLRFGITKHLGQAVRDHSLASTSSTVRVVAIGIAPWNMIHNREALLSAKDEPVVYTPQDLPHGSVYSLDNNHSHFVLVEEDPARPGATSEMRVKLLKHISLQRTGYGAGSFEIPVLCLLVHGEPKILKFLQRMYKGIANSTPWLILAGSGGVADILVTLMNRGCWDTDSVHELLLDTFPNAHHSADISNWVKLIQKILD----HGHLLTVHDPEQETSELDTVILKALVKCKSQSQEAQDFLDELKLAVAWNRVDIAKSDIFNGDVEWKACDLEEVMM-----DALINDKPDFVRLFVDNGVNLGEFLTYGRLQELYWSVSEK------SLLHNLLLKKYDEKQLLLGAARTPGPPGHYPSEQGKPRFTLFEVAKVLKDFLHDSCKGFYQKVPTEKPPKGRLFQSQKNLPELEELCEHPWRDLFLWAVLQNRQQMANYFWAMGPEAVAAALAGCKILKEM-ARLESEAESARS----MKEAKYEQFALDVFGECYSNSEDRAYALLVRRTHCWSKSTVLNLATEADAKSFFAHDGVQQALLTKIWWGAMTTDTAISKLVVSF-FCPPLIWTNLI-------------------KFQF----VELD----SLDTEKALMLTDDDDPRFFLRRWRRFWSAPVTVFLGNVIMYFAFLFLFTYVLLLDFKAPPQGPGV----PEIMLYFWVFTLVLEEIRQSFFTDEEMNIIKKFKLYVEDNWNKCDMVAILLFVVGVS---CMAAGTYEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVATQALLHPNDPRIDWVFRRALYRPYLHIFGQIPLEEIDARMP--KINCTDDSNEIVMGLLPPCPNIYANWLVILLLVIFLLVTNVLLLNLLIAMF-YTFQVVQGNTDIFWKFQRYNLIVEYYSRPALAPPFIIISHL 999          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Medaka
Match: hrc (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:101158642])

HSP 1 Score: 168.703 bits (426), Expect = 7.131e-42
Identity = 178/716 (24.86%), Postives = 308/716 (43.02%), Query Frame = 2
Query:  167 FNQMLIDNNSSAPQKSNLSACKTFGKIKFLG-------YEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENE-NQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIE---KGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNV---------RDIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEIL-------------ETDKMNVEIVD----------KYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVH-LDKKILDAIIS------SREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQ-ENLQDLYMT--------SLRSIKCRCTEMISDLILREDKSFKIDNINNPGKN-----LLKVIYKIICNLSD------------NILKFESFNLRSSNSHNA-----NQNSYRE---------LFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLL 2044
            F+  +++   S    S L     +G+++F G       +  +S  TNP  I                 Y L+T  W+ P P L++S+ GG +      N  ++  ++GL++  ++   WII  GF  G+ K V EAV D    +     N+V  + I++WG+V N   L     +Y     I    K    LD NY  +L  DDG+      EI FR   E ++           I    + +L  G    ++ +  SL+KS+P +V+  SG  A+ + +++             E D     IVD          KY    + TD    +++E+   IY N K+ IT+++   + ++  DK +L A++       S +D    + L LAV +N VDIA  ++F          K L       L  ++ + ++LF  N F+I  ++  + L+ LY +         L   +      I+ L    D   + D+ N P ++     ++KV    +  + D            ++L+   F+ R      A      ++ YRE         LF+W+++    EMA  FWE   E+V  AL G  +L +M S ++++    +S  L + +  F+ LA DI +  Y  ++ +   +L +   +W   TCLQ+ +GG+   F + +  +S   + W GD+      WK+L+T  F P+L
Sbjct:   64 FSAAIVNYWDSVRHSSELPT-DAYGELQFAGASKRHSYFLRLSWGTNPSTI-----------------YNLMTVQWSLPSPNLVVSVVGG-ESQASVKNWVREVIRKGLVKSSQRAGAWIITEGFREGVGKCVGEAVRDHATAASSGSFNKVVAVGIASWGLVYNKEQLINPEGSYPAKYDIRNSPKDSCCLDNNYQAFLLVDDGSVGRKGGEISFRAKLEDHISHQPTGIQESGINVPVLCMLISGDTSMLKRVEISLKKSLPWLVLAGSGGLAEFLSDVVENLSSSPVVQTPSEADGDLSPIVDLKERVADRVKKYFPNEKETD----KVVELTLSIYQN-KDLITVYNGTQERLNDFDKVLLKALVRASKQRVSVDDSPYIEELRLAVTWNRVDIARSELFNGD--ILWKDKDLKDSMTNALINDKPQFVRLFTENGFNIRSYLTYKKLEKLYQSVPSGTLLYQLLERRLLIRHGITALSPAHDS--QPDSPNQPKESNQCQPVMKVTLFEVSGVLDMLLDDVCQPFYYDVLELGHFSSRRRALKQAAKLLVGESKYREERCVYPWASLFIWAILQRRNEMATFFWEMAGESVLCALSGCKMLREM-SKLETETEGKLS--LKEMAQSFENLAHDIFSSCYHSDENRAFTLLIKKSPVWGGTTCLQMGMGGDTRLFFSHDGVQSLLSQIWWGDMKRNTEVWKLLLTF-FCPIL 747          

HSP 2 Score: 103.219 bits (256), Expect = 1.027e-21
Identity = 90/309 (29.13%), Postives = 165/309 (53.40%), Query Frame = 2
Query: 2234 KFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSI-----QNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPS----PCNTTVCIVQSAT-----------LIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYI 3100
            +F+ AP+  F+  +L Y  FLV+FAY+ LV+ KP           +E ++Y ++   + EEI +           +L+SY+   WN  D++ I +FI+ +I R      S+ F R    V   +F+LR +  + I + +GPK+I++ KM+ DVFFFL    +++I+YG  + ++      NP+      +   +FYRPY   +G++ +++          C   + ++ S +           +++   I+LL+TNI+L+NLLIA+F +TF+++Q  S+ ++ F +  L+  +H +P + PP  I  +I
Sbjct:  831 QFWFAPVTSFLGNVLMYFLFLVLFAYVLLVDFKPQPP---WGPAVSEYVLYFWVFTIVCEEIRETAFLGTRNWRQRLRSYIQDVWNKIDIVAITLFIVGLICRMYER--SYEFGREVLCVDYMVFTLRLIHIFAIHKQLGPKIIIVGKMMKDVFFFLFFLGVWLIAYGVANQALIYSYDSNPDR-----IFRRVFYRPYLHIFGQIPVEEIDSGKNWDLECTNNMTMIDSGSEPCRVEHSNWVVVVLLIIYLLVTNIVLINLLIAIFSHTFSEVQANSDIYWKFQRYNLIVTYHFRPSLAPPFIIISHI 1129          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Planmine SMEST
Match: SMESG000004955.1 (SMESG000004955.1)

HSP 1 Score: 2090.08 bits (5414), Expect = 0.000e+0
Identity = 1096/1096 (100.00%), Postives = 1096/1096 (100.00%), Query Frame = 2
Query:  131 MDSEYIGQHFKSFNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMESAMLENHQSTNVANINLNSDNLFDTXXXXXXXXXXXXXXXSSDKAITSRLGVIEKHLQKMLS 3418
            MDSEYIGQHFKSFNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMNFKNNQQKKNFKQGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTIFIFIISIIMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVFFFLSIFSLFIISYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFLLMTNILLLNLLIAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMESAMLENHQSTNVANINLNSDNLFDTILKNLELINEKLNNKSSDKAITSRLGVIEKHLQKMLS
Sbjct:    1 MDSEYIGQHFKSFNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMNFKNNQQKKNFKQGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTIFIFIISIIMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVFFFLSIFSLFIISYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFLLMTNILLLNLLIAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMESAMLENHQSTNVANINLNSDNLFDTILKNLELINEKLNNKSSDKAITSRLGVIEKHLQKMLS 1096          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Planmine SMEST
Match: SMESG000004955.1 (SMESG000004955.1)

HSP 1 Score: 2058.11 bits (5331), Expect = 0.000e+0
Identity = 1081/1081 (100.00%), Postives = 1081/1081 (100.00%), Query Frame = 2
Query:  176 MLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMESAMLENHQSTNVANINLNSDNLFDTXXXXXXXXXXXXXXXSSDKAITSRLGVIEKHLQKMLS 3418
            MLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMNFKNNQQKKNFKQGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTIFIFIISIIMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVFFFLSIFSLFIISYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFLLMTNILLLNLLIAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMESAMLENHQSTNVANINLNSDNLFDTILKNLELINEKLNNKSSDKAITSRLGVIEKHLQKMLS
Sbjct:    1 MLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMNFKNNQQKKNFKQGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFVQENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTIFIFIISIIMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVFFFLSIFSLFIISYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFLLMTNILLLNLLIAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMESAMLENHQSTNVANINLNSDNLFDTILKNLELINEKLNNKSSDKAITSRLGVIEKHLQKMLS 1081          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Planmine SMEST
Match: SMESG000004977.1 (SMESG000004977.1)

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 493/1049 (47.00%), Postives = 686/1049 (65.40%), Query Frame = 2
Query:  197 SAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRD-IGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNV-----EIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFV-QENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFES------------------FNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSN--KKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQ---VSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSK-WNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTV-CIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMESAMLE 3247
            S    +    C TFG I F GY DI  N  P FIRF   D     E+    Y+L+  YWNF KPQL+IS+ GG KRMNF  NQQKKNFKQ L+EV++KD TWIIGGGF+VGIH L+SEAV ++R     + NQVKL+ I TWG + NN+ L      Y  +   EKGKV LD + D +LFCDDGTEK+YDKE +FRL FE+ VR+      VQILYEGG RA+ES Y SL+ SIPLV+IK SGRAAD+I  IL+    +       I+   +  + + + D  +  EIL +IY  Y+ +I +HDL D+++ LD+KI++A+ISS +D +LEK L + ++FNC DIA+ KVF ++   +L+QK L   FK +L  NQ E ++LFL NNFSI++F+ +E+L  LY  SL     RC  ++ D I   DK+F  D+     K LL  + +II  +S NIL+ E+                  F  +S    ++ + + ++LFLW+L++ +TE+A+IFW+ G+E++GSALI SIIL+KM+  I+ +G++D S  L + S KFQE+A  ++T+A+   QE T+ +L R L  WNN+TCLQIAI GNLL+FL+ +AC SY R+ W G+LSPFLP WKIL++IPFS +LIKP I+P V+   +   SN S E    +F++E           SP  +K ++S+S +   + +   +  FY+ PIVKFVI+L+SY+ FL++F YLNLVELK   +   IQN  AE+ ++ ++LG I EEI QI + E+ G IYKLK+Y+SGSWN+YD+  I ++II+  +R  ++ D FI  RCFY+VTLS+  LR MQ+YFIS ++GPKVIMI +MIVD+             +  L+ ++Q+  S+  NL LI+E+FYRPYFQTYGELMLD+F       T +   +   T+I GF +FLL+TNILL+NLLIAMFG+TFNKIQ ES KFFSFIQ+QLV+EF  KPL+PPP N+ +Y++  +   G    H  ++ +N+ L++ L  ++N K   FE L MES++LE
Sbjct:   45 SLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEV---VYKLMILYWNFFKPQLIISVTGGLKRMNFNTNQQKKNFKQSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTSYLEKIKSILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNF--DSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWKILISIPFSFILIKPLIMPSVNQPTQSERSNESAESQTPEFMYE---------ANSP--FKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLK---IQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDI-------------FFFLTIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNDENITDIDRTIGRMTIICGFAVFLLLTNILLINLLIAMFGHTFNKIQVESHKFFSFIQLQLVEEFLEKPLLPPPFNLLHYLITGIVYCGNRCCHKQTRNQNSLLLQDLPKEENKKFSYFEKLSMESSILE 1061          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Planmine SMEST
Match: SMESG000004911.1 (SMESG000004911.1)

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 470/1031 (45.59%), Postives = 682/1031 (66.15%), Query Frame = 2
Query:  185 DNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI-GAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNL-EKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFV-QENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILK--FESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKV--KDKFLFEKEKIELNIRKKSPKSWKSYHSESD--------QVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCME 3232
            D+ +S+P K   + C  FG I F G +++S + +P F+RF+    N   +    AYELI K W +P P L+IS+ GG K   FKN+Q ++NFK+ L E+M+  TTWIIG G  VG+ K+V E +  +R      +NQ  LI +S+ GVVKN   L    C Y  ++    G   L+  YDCYLFCDDG+      + +F +DFE+ +++I G   ++I+  G +  +E+I+ SL +++PL++IK SG  +D   EI E +K+N++ V+K      + DD+ ++  EI  +I+S  K  +TI  ++ +++ L K + D IIS  +D ++  K  +L++RFNC ++ + ++FQS   S L  + L      +LS+NQ + L+LF + N  I E +  ENL+ LYM SL S  C   ++++DLI+ ++K+F   N      NLL   YKI+  LS+NILK      ++++  SHN    +Y++LFLW+L++G+TEM+LIFW   K+NVG A++G+II +KMK+ I  KG   +S+ L+++S KF+ELA  +I +A + +Q  T  +LTRPL   NN++CLQIA+ GNLL FLN +ACRSYT+E WMGDLSPF P WKIL+TI FSP L+  F+I  +  K   ++ S +K    + F   KE  +++   K+ ++ K + + S+        +V   ++L  FY+AP+VKF+IYL+SY+ FL+ F YLNLVELKPI++VK  QN+T E  VYI+ILGFIV+E+ QINN  K    Y+ K+ +SG+WN+YD  TI + II +++RF+V  + FI  RC + +T  L+ LRTMQFYFIS SIGPKVIMI+KMIVD+FFFL IF LFI+SYGTL +S+QNPN ++   L++ +FYRP+FQT+GELMLD+F+  S C TT CI+Q  T+I GF IFLL+TN+LLLNLLIAMFG TFN+IQ ESEK FS IQIQLV+EFH KP++PPP N+ YY L+K+W +   IF   + RK++  IKYL D + ++I  FE + ME
Sbjct:   33 DSFTSSP-KLEFNPCDMFGTITFEGNDNLSSDQHPNFMRFYSPKTNTPHK---EAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTSTTWIIGSGLDVGVSKIVGETIGAYR-QGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQEIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITMENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQN--KTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSHNL-AVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYTKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSTDKFINGNSFSTNKEVFKISFASKNNEN-KRFSNISNGLIKTKYYEVITKKSLEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFILARCLFGLTFCLYCLRTMQFYFISPSIGPKVIMIKKMIVDIFFFLCIFLLFIVSYGTLFNSLQNPNCEFGFSLVANIFYRPFFQTFGELMLDEFQ-DSVCKTTSCIIQYRTVIFGFAIFLLLTNVLLLNLLIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERMSME 1053          
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Planmine SMEST
Match: SMESG000004911.1 (SMESG000004911.1)

HSP 1 Score: 806.594 bits (2082), Expect = 0.000e+0
Identity = 470/1031 (45.59%), Postives = 682/1031 (66.15%), Query Frame = 2
Query:  185 DNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMXXXXXXXXXXXXXGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI-GAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNL-EKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFV-QENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILK--FESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKV--KDKFLFEKEKIELNIRKKSPKSWKSYHSESD--------QVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTXXXXXXXXXMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVXXXXXXXXXXXXXYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFXXXXXXXXXXXXXAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCME 3232
            D+ +S+P K   + C  FG I F G +++S + +P F+RF+    N   +    AYELI K W +P P L+IS+ GG K   FKN+Q ++NFK+ L E+M+  TTWIIG G  VG+ K+V E +  +R      +NQ  LI +S+ GVVKN   L    C Y  ++    G   L+  YDCYLFCDDG+      + +F +DFE+ +++I G   ++I+  G +  +E+I+ SL +++PL++IK SG  +D   EI E +K+N++ V+K      + DD+ ++  EI  +I+S  K  +TI  ++ +++ L K + D IIS  +D ++  K  +L++RFNC ++ + ++FQS   S L  + L      +LS+NQ + L+LF + N  I E +  ENL+ LYM SL S  C   ++++DLI+ ++K+F   N      NLL   YKI+  LS+NILK      ++++  SHN    +Y++LFLW+L++G+TEM+LIFW   K+NVG A++G+II +KMK+ I  KG   +S+ L+++S KF+ELA  +I +A + +Q  T  +LTRPL   NN++CLQIA+ GNLL FLN +ACRSYT+E WMGDLSPF P WKIL+TI FSP L+  F+I  +  K   ++ S +K    + F   KE  +++   K+ ++ K + + S+        +V   ++L  FY+AP+VKF+IYL+SY+ FL+ F YLNLVELKPI++VK  QN+T E  VYI+ILGFIV+E+ QINN  K    Y+ K+ +SG+WN+YD  TI + II +++RF+V  + FI  RC + +T  L+ LRTMQFYFIS SIGPKVIMI+KMIVD+FFFL IF LFI+SYGTL +S+QNPN ++   L++ +FYRP+FQT+GELMLD+F+  S C TT CI+Q  T+I GF IFLL+TN+LLLNLLIAMFG TFN+IQ ESEK FS IQIQLV+EFH KP++PPP N+ YY L+K+W +   IF   + RK++  IKYL D + ++I  FE + ME
Sbjct:   24 DSFTSSP-KLEFNPCDMFGTITFEGNDNLSSDQHPNFMRFYSPKTNTPHK---EAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTSTTWIIGSGLDVGVSKIVGETIGAYR-QGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQEIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITMENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQN--KTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSHNL-AVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYTKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSTDKFINGNSFSTNKEVFKISFASKNNEN-KRFSNISNGLIKTKYYEVITKKSLEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFILARCLFGLTFCLYCLRTMQFYFISPSIGPKVIMIKKMIVDIFFFLCIFLLFIVSYGTLFNSLQNPNCEFGFSLVANIFYRPFFQTFGELMLDEFQ-DSVCKTTSCIIQYRTVIFGFAIFLLLTNVLLLNLLIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERMSME 1044          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM21.578e-6925.67transient receptor potential cation channel subfam... [more]
TRPM21.008e-6825.73transient receptor potential cation channel subfam... [more]
TRPM21.375e-6825.73transient receptor potential cation channel subfam... [more]
TRPM21.375e-6825.73transient receptor potential cation channel subfam... [more]
TRPM56.304e-6623.31transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtl-24.680e-4322.01Gon-Two Like (TRP subfamily) [Source:UniProtKB/Tr... [more]
gtl-12.068e-1924.34GTL-1; Gon-Two Like (TRP subfamily) [Source:UniPr... [more]
gon-23.859e-1725.32Transient receptor potential channel [Source:UniP... [more]
gon-26.519e-1725.32Transient receptor potential channel [Source:UniP... [more]
gon-26.676e-1725.32Transient receptor potential channel [Source:UniP... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm2.212e-5223.84gene:FBgn0265194 transcript:FBtr0339082[more]
Trpm2.232e-4923.70gene:FBgn0265194 transcript:FBtr0339076[more]
Trpm3.254e-4923.70gene:FBgn0265194 transcript:FBtr0339074[more]
Trpm3.412e-4923.70gene:FBgn0265194 transcript:FBtr0339079[more]
Trpm9.171e-4923.72gene:FBgn0265194 transcript:FBtr0339077[more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm21.923e-7326.73transient receptor potential cation channel, subfa... [more]
trpm59.076e-7125.24transient receptor potential cation channel, subfa... [more]
trpm51.599e-6824.93transient receptor potential cation channel, subfa... [more]
trpm51.903e-6824.41transient receptor potential cation channel, subfa... [more]
trpm63.701e-6322.45transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shc25.205e-8027.44SHC (Src homology 2 domain containing) transformin... [more]
shc26.042e-7926.88SHC (Src homology 2 domain containing) transformin... [more]
shc27.449e-7826.14SHC (Src homology 2 domain containing) transformin... [more]
shc21.621e-7726.49SHC (Src homology 2 domain containing) transformin... [more]
shc21.801e-6724.74SHC (Src homology 2 domain containing) transformin... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm43.668e-6925.07transient receptor potential cation channel, subfa... [more]
Trpm27.582e-6624.64transient receptor potential cation channel, subfa... [more]
Trpm45.497e-6424.69transient receptor potential cation channel, subfa... [more]
Trpm55.012e-6224.20transient receptor potential cation channel, subfa... [more]
Trpm51.673e-5423.26transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7T1N0|TMP2L_NEMVE1.261e-8726.48Transient receptor potential cation channel subfam... [more]
sp|A0A0R4IMY7|TRPM2_DANRE1.452e-7226.73Transient receptor potential cation channel subfam... [more]
sp|Q7TN37|TRPM4_MOUSE2.566e-6825.07Transient receptor potential cation channel subfam... [more]
sp|O94759|TRPM2_HUMAN6.602e-6825.73Transient receptor potential cation channel subfam... [more]
sp|E9PTA2|TRPM2_RAT3.219e-6725.03Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F5R12.681e-11427.43Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267G8482.515e-11327.25Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A210PMT13.355e-9728.09Transient receptor potential cation channel subfam... [more]
V4BKQ34.672e-9227.94Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A077LAN82.993e-9028.39Transient receptor potential ion channel M b (Frag... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm58.802e-6724.22transient receptor potential cation channel subfam... [more]
trpm36.245e-6224.89transient receptor potential cation channel, subfa... [more]
trpm4a3.307e-6124.22transient receptor potential cation channel subfam... [more]
trpm4a3.858e-6124.22transient receptor potential cation channel subfam... [more]
hrc2.283e-6023.93transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trpm29.333e-5924.41transient receptor potential cation channel, subfa... [more]
trpm74.903e-5021.67transient receptor potential cation channel, subfa... [more]
trpm73.025e-4921.65transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO301355.170e-8926.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476581.920e-3426.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm21.868e-6925.07transient receptor potential cation channel subfam... [more]
trpm24.028e-6925.07transient receptor potential cation channel subfam... [more]
trpm51.022e-5321.82transient receptor potential cation channel subfam... [more]
trpm51.589e-5323.72transient receptor potential cation channel subfam... [more]
hrc7.131e-4224.86transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member-like 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004955.10.000e+0100.00SMESG000004955.1[more]
SMESG000004955.10.000e+0100.00SMESG000004955.1[more]
SMESG000004977.10.000e+047.00SMESG000004977.1[more]
SMESG000004911.10.000e+045.59SMESG000004911.1[more]
SMESG000004911.10.000e+045.59SMESG000004911.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028809 ID=SMED30028809|Name=Transient receptor potential cation channel subfamily M member-like 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3462bp
ACTTTGAAAATCCAAATAACGCTATTTTATTTTAATAAGGCATTAACTAA
TACATTTATTTTATTTATTTAATGACATTTTGTTTTTTCATCGGTTTATT
TTTATAAAGTAACTATTTTGATTTATTATAATGGACAGTGAATATATTGG
ACAACATTTTAAAAGTTTTAATCAAATGCTAATTGATAATAATTCTTCAG
CTCCTCAGAAAAGCAACTTATCAGCTTGTAAAACATTTGGGAAAATAAAG
TTTTTAGGGTACGAGGACATTTCTTTAAATACAAATCCTCAGTTTATTCG
GTTTTTTCCTACTGATGGCAACAATTTTCAAGAATTGACTTATAATGCAT
ATGAATTGATAACAAAATATTGGAATTTTCCTAAACCGCAATTACTTATT
TCTATTAATGGTGGATTTAAAAGAATGAATTTTAAAAATAATCAACAGAA
AAAAAATTTCAAACAAGGACTAATGGAAGTAATGCGAAAAGATACAACGT
GGATAATTGGTGGTGGATTTCATGTCGGTATTCATAAATTGGTTAGTGAG
GCTGTTAATGACTTTCGGATACTTTCCGATGAGAATGAAAATCAAGTGAA
ATTAATCAGTATCAGCACTTGGGGAGTTGTTAAAAATAATCGAAGTTTAA
CAGTTGGAACTTGTGCTTACGATAATAGTAATACAATTGAAAAAGGAAAA
GTTACATTGGATCCAAATTATGACTGTTACTTGTTTTGTGACGATGGCAC
TGAAAAGGAATACGATAAAGAAATTGATTTTCGATTGGATTTTGAAAGGA
ATGTGCGGGATATCGGCGCTTTTGCTGTTCAAATTTTATATGAAGGAGGA
AAGCGTGCTATCGAAAGTATTTATAGATCATTGCAAAAATCCATCCCCCT
TGTCGTCATTAAGGAGTCAGGTCGAGCAGCAGATTTGATATGTGAAATTC
TCGAAACAGATAAAATGAATGTTGAAATCGTTGACAAATATGAGGAACAG
CTCAGATTGACCGATGACGATAAAATCCGCATTATAGAAATTCTTTCTGA
TATATACTCTAACTACAAAGAAAGAATAACTATTCATGACCTTCTAGATC
AAAATGTGCACCTGGATAAAAAAATACTTGATGCAATTATTTCTAGTCGT
GAAGACAGAAACTTAGAAAAGACTCTAAACTTAGCAGTTAGATTTAATTG
CGTTGATATTGCTGATTTCAAAGTATTCCAATCGTCTAGAGCTTCCACTC
TATCTCAAAAAACTTTGGGAATTTATTTTAAAGAAATGCTAAGCAAGAAT
CAGCATGAGATGTTACAGTTGTTTTTAGTAAATAATTTCAGCATTGATGA
ATTTGTTCAAGAAAACCTCCAAGATTTATATATGACATCTCTACGATCAA
TCAAATGCCGTTGCACAGAAATGATATCTGATTTGATTTTAAGAGAGGAT
AAATCATTCAAAATTGACAATATAAATAATCCGGGTAAAAACCTCCTGAA
AGTTATTTACAAAATCATCTGTAATCTAAGTGACAACATTTTAAAATTCG
AATCTTTTAATTTACGTTCATCTAATTCTCATAATGCCAATCAAAATTCT
TACCGAGAACTTTTTCTCTGGTCGCTGATTTCTGGATACACTGAAATGGC
GTTAATATTTTGGGAAAACGGCAAAGAGAATGTGGGTTCAGCATTAATAG
GATCTATAATTTTGAGTAAAATGAAAAGCTACATTAAAAGTAAAGGCTTC
AACGATATGTCTGATACTTTATTGAAGACGTCCATCAAATTTCAAGAACT
GGCTTGTGATATTATAACAAAAGCCTATAAAATAAATCAAGAAAAAACTC
ACATTGTTTTGACTCGCCCTCTAAACTTATGGAATAATTTGACTTGTTTG
CAAATTGCAATAGGTGGTAATCTGTTAGACTTCTTAAATCTTAATGCCTG
TCGTTCTTATACAAGAGAAGCCTGGATGGGTGATTTATCACCTTTTCTTC
CTACTTGGAAAATTTTAGTCACTATTCCGTTCAGTCCTCTATTGATCAAA
CCTTTTATTATTCCGTATGTGTCAAATAAAAAAAGTTGTTCAAATTTGTC
TCATGAAAAGGTCAAGGATAAATTTTTATTTGAGAAGGAAAAAATTGAAT
TAAATATTCGAAAAAAATCTCCCAAATCGTGGAAAAGTTATCATTCAGAG
TCTGATCAGGTTTCTTTTTGCAGGGCTTTAATTAAATTTTATCGAGCACC
GATTGTCAAATTTGTCATATATTTACTATCTTACATCACATTTCTTGTGA
TTTTTGCCTATTTGAATTTAGTGGAATTAAAGCCAATAAAAGAAGTTAAA
GTAATTCAAAATGTTACTGCTGAATTATTGGTTTACATTTTTATTTTGGG
ATTTATCGTAGAAGAAATTAATCAAATCAACAATACGGAAAAAAATGGGC
TCATCTATAAATTGAAATCTTATGTATCTGGATCCTGGAACCTTTATGAT
ATGCTAACGATTTTTATATTTATTATCAGTATTATAATGAGATTTACCGT
CAATGGAGATTCATTTATTTTTGTTCGATGCTTTTATGCGGTGACTTTGA
GTTTGTTTTCACTGAGAACGATGCAATTTTATTTTATCAGTCGCTCGATT
GGTCCTAAAGTAATAATGATAAGAAAAATGATTGTTGATGTTTTTTTCTT
TCTGAGTATATTTTCCTTATTTATTATATCATATGGAACCCTATCTCATT
CTATACAAAATCCAAATAGCAAGTGGAATCTTTTTCTTATCAGTGAATTA
TTTTACCGACCTTATTTCCAAACCTATGGTGAACTGATGTTGGACGATTT
TAAAATCCCTTCTCCATGTAATACTACAGTTTGTATTGTTCAATCTGCAA
CTCTTATTATAGGATTTGGTATATTCTTATTAATGACCAATATTCTTCTA
CTCAATCTTTTGATAGCAATGTTTGGATATACATTCAATAAAATCCAAGG
AGAATCAGAAAAGTTCTTTTCTTTTATTCAAATACAATTAGTTGATGAGT
TCCATAACAAACCTTTAATGCCACCTCCATTAAACATAGCTTATTATATT
TTGAGAAAATTGTGGCAATCCGGAAAAATTATTTTTCATGGGGATTCTAA
ACGAAAGAATACGTTTTTGATTAAATATTTAAACGATGATCAAAATTTGA
AAATACGAGGATTTGAGCATTTATGCATGGAGTCGGCAATGTTGGAAAAT
CACCAATCTACCAATGTTGCAAATATTAATTTAAATTCTGATAATTTATT
CGATACGATTTTGAAGAATTTGGAATTGATCAACGAAAAATTAAATAATA
AATCGTCAGACAAGGCAATAACATCTCGTTTAGGTGTCATTGAAAAGCAT
TTACAAAAAATGTTATCGTAGCATCTGTTTTTATAAAATTATGAAACGAA
TTTTATACCATT
back to top

protein sequence of SMED30028809-orf-1

>SMED30028809-orf-1 ID=SMED30028809-orf-1|Name=SMED30028809-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1097bp
MDSEYIGQHFKSFNQMLIDNNSSAPQKSNLSACKTFGKIKFLGYEDISLN
TNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMN
FKNNQQKKNFKQGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSD
ENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCY
LFCDDGTEKEYDKEIDFRLDFERNVRDIGAFAVQILYEGGKRAIESIYRS
LQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIR
IIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLN
LAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLV
NNFSIDEFVQENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINN
PGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNANQNSYRELFLWSLI
SGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKT
SIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLD
FLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNK
KSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFCRAL
IKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELL
VYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTIFIFIIS
IIMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKM
IVDVFFFLSIFSLFIISYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYG
ELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFLLMTNILLLNLLIAMFGY
TFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKI
IFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCMESAMLENHQSTNVANIN
LNSDNLFDTILKNLELINEKLNNKSSDKAITSRLGVIEKHLQKMLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005262calcium channel activity
GO:0005272sodium channel activity
GO:0015280ligand-gated sodium channel activity
GO:0046872metal ion binding
GO:0099604ligand-gated calcium channel activity
GO:0005216ion channel activity
GO:0005261cation channel activity
GO:0016787hydrolase activity
GO:0047631ADP-ribose diphosphatase activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006816calcium ion transport
GO:0019722calcium-mediated signaling
GO:0035725sodium ion transmembrane transport
GO:0070588calcium ion transmembrane transport
GO:0006811ion transport
GO:0006812cation transport
GO:0006979response to oxidative stress
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
GO:0098655cation transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041491TRPM_SLOG
IPR005821Ion_trans_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041491TRPM, SLOG domainPFAMPF18139LSDAT_eukcoord: 72..292
e-value: 1.8E-40
score: 139.0
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 716..958
e-value: 2.2E-6
score: 27.1
NoneNo IPR availablePANTHERPTHR13800TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL, SUBFAMILY M, MEMBER 6coord: 22..1094
NoneNo IPR availableTMHMMTMhelixcoord: 622..644
NoneNo IPR availableTMHMMTMhelixcoord: 924..946
NoneNo IPR availableTMHMMTMhelixcoord: 709..731
NoneNo IPR availableTMHMMTMhelixcoord: 850..872
NoneNo IPR availableTMHMMTMhelixcoord: 812..829
NoneNo IPR availableTMHMMTMhelixcoord: 780..802
NoneNo IPR availableTMHMMTMhelixcoord: 741..760