Farnesoic acid O-methyltransferase

Overview
NameFarnesoic acid O-methyltransferase
Smed IDSMED30028798
Length (bp)1041
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Farnesoic acid O-methyltransferase (SMED30028798) t-SNE clustered cells

Violin plots show distribution of expression levels for Farnesoic acid O-methyltransferase (SMED30028798) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Farnesoic acid O-methyltransferase (SMED30028798) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Farnesoic acid O-methyltransferase (SMED30028798) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028798

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30028798SMESG000029910.1 SmedASXL_006864SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30028798SMESG000029910.1 SMED30028798smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028798SMESG000029910.1 SMED30028798smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30028798SMESG000029910.1 SMED30028798smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nu neoblastSMED30028798SMESG000029910.1 SMED30028798smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028798SMESG000029910.1 dd_Smed_v4_883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028798SMESG000029910.1 dd_Smed_v4_883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30028798SMESG000029910.1 dd_Smed_v4_883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028798SMESG000029910.1 dd_Smed_v4_883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028798SMESG000029910.1 dd_Smed_v4_883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028798SMESG000029910.1 Contig50082newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028798SMESG000029910.1 Contig50082uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
secretory systemSMED30028798SMESG000029910.1 dd_Smed_v6_883_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339104)

HSP 1 Score: 90.1225 bits (222), Expect = 2.348e-20
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 3
Query:  609 FVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDN-GQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEIL 956
            +V R+ H GE +P K+V      +V Y G E TK+HY+VLV        G+ W  S    +PPNA+  GT   G+PL++ +    G   VGK HP HGC ++P+ G E   N +E+L
Sbjct:   31 YVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVGQ------GFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVL 141          

HSP 2 Score: 73.559 bits (179), Expect = 1.333e-14
Identity = 41/119 (34.45%), Postives = 56/119 (47.06%), Query Frame = 3
Query:  609 FVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSE-DLEIPPNAIIGG-TDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILC 959
            +  RA H GE +P K+V      +VC+ G E  K  Y+VL        TGY + W      IPPNA+  G   NG+ L+  +   +G    G       C ++PY G E   N +EILC
Sbjct:  174 YAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL--------TGYGYVWMNCGHSIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 284          

HSP 3 Score: 66.2402 bits (160), Expect = 5.563e-12
Identity = 44/167 (26.35%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  474 CFFI**GEMSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGS-----CFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDNGQ-PLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEIL 956
            C ++  G      T Y   V    +W  +  G +P +AV++  +      +V R  H G    GK+   H  +++ + G+E+  + Y+VL+           W  +     PP A+I G D+ + P++  ++  EGE +  K  P  G A+V + G EF+K  +E+L
Sbjct:   52 CAYVAYGGAEHTKTHYEVLVGQGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIKQQHD-----VWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL 213          

HSP 4 Score: 48.521 bits (114), Expect = 3.313e-6
Identity = 24/57 (42.11%), Postives = 36/57 (63.16%), Query Frame = 3
Query:  789 IPPNAIIGGTDNGQ-PLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEIL 956
            +PP A+IGG D+ + P+++ +S  EGE +  K  P  GCA+V Y G E  K  +E+L
Sbjct:   14 LPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVL 70          
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339105)

HSP 1 Score: 90.1225 bits (222), Expect = 2.438e-20
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 3
Query:  609 FVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDN-GQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEIL 956
            +V R+ H GE +P K+V      +V Y G E TK+HY+VLV        G+ W  S    +PPNA+  GT   G+PL++ +    G   VGK HP HGC ++P+ G E   N +E+L
Sbjct:   42 YVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVGQ------GFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVL 152          

HSP 2 Score: 73.9442 bits (180), Expect = 1.312e-14
Identity = 41/119 (34.45%), Postives = 56/119 (47.06%), Query Frame = 3
Query:  609 FVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSE-DLEIPPNAIIGG-TDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILC 959
            +  RA H GE +P K+V      +VC+ G E  K  Y+VL        TGY + W      IPPNA+  G   NG+ L+  +   +G    G       C ++PY G E   N +EILC
Sbjct:  185 YAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL--------TGYGYVWMNCGHSIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 295          

HSP 3 Score: 66.2402 bits (160), Expect = 6.166e-12
Identity = 44/167 (26.35%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  474 CFFI**GEMSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGS-----CFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDNGQ-PLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEIL 956
            C ++  G      T Y   V    +W  +  G +P +AV++  +      +V R  H G    GK+   H  +++ + G+E+  + Y+VL+           W  +     PP A+I G D+ + P++  ++  EGE +  K  P  G A+V + G EF+K  +E+L
Sbjct:   63 CAYVAYGGAEHTKTHYEVLVGQGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIKQQHD-----VWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL 224          

HSP 4 Score: 48.521 bits (114), Expect = 3.772e-6
Identity = 24/57 (42.11%), Postives = 36/57 (63.16%), Query Frame = 3
Query:  789 IPPNAIIGGTDNGQ-PLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEIL 956
            +PP A+IGG D+ + P+++ +S  EGE +  K  P  GCA+V Y G E  K  +E+L
Sbjct:   25 LPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVL 81          
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Fly
Match: CG10527 (gene:FBgn0034583 transcript:FBtr0071541)

HSP 1 Score: 90.1225 bits (222), Expect = 2.574e-20
Identity = 54/143 (37.76%), Postives = 77/143 (53.85%), Query Frame = 3
Query:  549 WQEAHDGSIPLHAVKA--DGS--CFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGG-TDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCS 962
            W  A +G +P +A++   D S   ++ARA+H G+ IPGKL   H   +V + G E   + Y+VL         G +W   +   IPPNA+  G T  G+PLFI ++  +G   VGK  P HGC ++PY G E    EFEI  +
Sbjct:  159 WVPAANGEVPPNALEGGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLC------AGGGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEIYVT 295          
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0345371)

HSP 1 Score: 86.2705 bits (212), Expect = 6.286e-19
Identity = 49/138 (35.51%), Postives = 72/138 (52.17%), Query Frame = 3
Query:  567 GSIPLHAVKA-----DGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAI-IGGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCS 962
            GS+P  A+ A         FV RA HNGE +P K+V G    +V + G+EI+K  ++VLV         + W  S    +PP+AI +G T  G+PL++ +   +G    GK HP H C ++PY G E     +E+L  
Sbjct:   13 GSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLVGDH------FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQ 144          

HSP 2 Score: 74.3294 bits (181), Expect = 7.588e-15
Identity = 49/167 (29.34%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  471 KCFFI**GEMSKVITQYGRAVEISVSWQEAHDGSIPLHAV---KADG-SCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAII-GGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEIL 956
            +C +I  G     +  Y   V+       +  G +P   V    ADG   +V RA H G+ +P K++      +V Y G E+ K  Y++L         GY W       +P NA++ G T +G+PLFI ++   G    GK H  H C ++P++G E   + +E+L
Sbjct:  123 QCLYIPYGGQEHRLEAYEVLVQPETWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAGY------GYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVL 283          

HSP 3 Score: 72.4034 bits (176), Expect = 4.265e-14
Identity = 46/145 (31.72%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  546 SWQEAHDGSIPLHAVKADGS-----CFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTD-NGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCS 962
            SW  +  GS+P HA++   +      +V R    G   PGK+   H  +++ Y G+E     Y+VLV     P T   W  S    I P  ++GG D +G  +++ ++  EG+ +  K  P+ GCA+VPY G E  K+++E+L  
Sbjct:   77 SWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQ----PET---WIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAG 214          
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0087792)

HSP 1 Score: 86.2705 bits (212), Expect = 6.286e-19
Identity = 49/138 (35.51%), Postives = 72/138 (52.17%), Query Frame = 3
Query:  567 GSIPLHAVKA-----DGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAI-IGGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCS 962
            GS+P  A+ A         FV RA HNGE +P K+V G    +V + G+EI+K  ++VLV         + W  S    +PP+AI +G T  G+PL++ +   +G    GK HP H C ++PY G E     +E+L  
Sbjct:   13 GSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLVGDH------FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQ 144          

HSP 2 Score: 74.3294 bits (181), Expect = 7.588e-15
Identity = 49/167 (29.34%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  471 KCFFI**GEMSKVITQYGRAVEISVSWQEAHDGSIPLHAV---KADG-SCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAII-GGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEIL 956
            +C +I  G     +  Y   V+       +  G +P   V    ADG   +V RA H G+ +P K++      +V Y G E+ K  Y++L         GY W       +P NA++ G T +G+PLFI ++   G    GK H  H C ++P++G E   + +E+L
Sbjct:  123 QCLYIPYGGQEHRLEAYEVLVQPETWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAGY------GYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVL 283          

HSP 3 Score: 72.4034 bits (176), Expect = 4.265e-14
Identity = 46/145 (31.72%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  546 SWQEAHDGSIPLHAVKADGS-----CFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTD-NGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCS 962
            SW  +  GS+P HA++   +      +V R    G   PGK+   H  +++ Y G+E     Y+VLV     P T   W  S    I P  ++GG D +G  +++ ++  EG+ +  K  P+ GCA+VPY G E  K+++E+L  
Sbjct:   77 SWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQ----PET---WIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAG 214          
BLAST of Farnesoic acid O-methyltransferase vs. TrEMBL
Match: Q5DHE4 (SJCHGC04453 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.603e-32
Identity = 62/155 (40.00%), Postives = 91/155 (58.71%), Query Frame = 3
Query:  510 ITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILP-TTGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCSLKK 971
            + + G+ ++I +SW  A DG++P +A+   G  +V R+KH+G +IPGK V GH+  +   +G+EI    Y+VL DTS+     GYEW+      +P NAII G     PL+I +  V GE  VGK H  H CA+ P+ G E   N++E+L   KK
Sbjct:    1 MAKIGKGIQIPLSWVPATDGNVPHNAINVSGDIYVIRSKHDGHWIPGKAVIGHNTAYYPMNGQEIKTREYEVLCDTSLSGHNKGYEWESESGGNVPKNAIIAGMSGNDPLYIARGSVNGEVCVGKVHYGHNCAYFPWGGNEHSVNDYEVLVWKKK 155          
BLAST of Farnesoic acid O-methyltransferase vs. TrEMBL
Match: A0A1I8J9Y8 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.865e-32
Identity = 66/155 (42.58%), Postives = 96/155 (61.94%), Query Frame = 3
Query:  498 MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSI-LPTTGYEWKWSEDLEIPPNAIIGGTD-NGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEIL 956
            MSKV     + +EI VSWQ A DG IP +A++A   CFV RAKH   +IP K+  GH++ +V YDGKE +   Y+VLV + I     GY+W   +  ++P  A++ G + N +PL++ + +V+GE  VGK H +H CA+ PY G E    E+E+L
Sbjct:    1 MSKVKHAGHKGIEICVSWQPAKDGHIPPNAIEAAPGCFVGRAKHEDCWIPAKVAEGHTNAYVPYDGKEHSIPEYEVLVCSEIGCYGKGYKWVRKDSGDVPKKALVAGREKNDEPLYVARGEVDGEMCVGKVHKNHHCAYFPYGGTEHSSEEYEVL 155          
BLAST of Farnesoic acid O-methyltransferase vs. TrEMBL
Match: A0A1I8HE36 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001642g3 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.288e-32
Identity = 66/155 (42.58%), Postives = 96/155 (61.94%), Query Frame = 3
Query:  498 MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSI-LPTTGYEWKWSEDLEIPPNAIIGGTD-NGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEIL 956
            MSKV     + +EI VSWQ A DG IP +A++A   CFV RAKH   +IP K+  GH++ +V YDGKE +   Y+VLV + I     GY+W   +  ++P  A++ G + N +PL++ + +V+GE  VGK H +H CA+ PY G E    E+E+L
Sbjct:    1 MSKVKHAGHKGIEICVSWQPAKDGHIPPNAIEAAPGCFVGRAKHEDCWIPAKVAEGHTNAYVPYDGKEHSIPEYEVLVCSEIGCYGKGYKWVREDSGDVPKKALVAGREKNDEPLYVARGEVDGEMCVGKVHKNHHCAYFPYGGTEHSSEEYEVL 155          
BLAST of Farnesoic acid O-methyltransferase vs. TrEMBL
Match: A0A4Z2D8K2 (Natterin-4 OS=Schistosoma japonicum OX=6182 GN=EWB00_003361 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 6.268e-32
Identity = 61/150 (40.67%), Postives = 89/150 (59.33%), Query Frame = 3
Query:  510 ITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILP-TTGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEIL 956
            + + G+ ++I +SW  A DG++P +AV   G  +V R+KH+G +IPGK V GH+  +   +G+EI    Y+VL DTS+     GYEW+      +P NAII G     PL+I +  V GE  VGK H  H CA+ P+ G E   N++E+L
Sbjct:    1 MAKIGKGIQIPLSWVPATDGNVPHNAVNVSGDIYVIRSKHDGHWIPGKAVIGHNTAYYPMNGQEIKTREYEVLCDTSLSGHNKGYEWESESGGNVPKNAIIAGMSGNDPLYIARGSVNGEVCVGKVHYGHNCAYFPWGGNEHSVNDYEVL 150          
BLAST of Farnesoic acid O-methyltransferase vs. TrEMBL
Match: A0A430PYP5 (DUF3421 domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0005187 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 8.661e-32
Identity = 60/149 (40.27%), Postives = 87/149 (58.39%), Query Frame = 3
Query:  510 ITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEIL 956
            + + G+ ++I +SW  A DG++P +A+      +V R KH+G++IPGK  TGH+  +  Y G+E     Y+VL DTS     GYEW  +    +P NAII G     PL+I KS + GE  VGK H  H CA++P+ G E    E+E+L
Sbjct:    1 MAKIGKGIQIPLSWVPAKDGNVPNNALSVTRGIYVVRCKHDGQWIPGKAATGHNAAYYPYGGEEKNTREYEVLCDTSFSGHQGYEWLHASRGSVPKNAIIAGMSGSDPLYIAKSSINGEPSVGKVHSGHECAYLPWGGEEHSVKEYEVL 149          
BLAST of Farnesoic acid O-methyltransferase vs. Planmine SMEST
Match: SMESG000029910.1 (SMESG000029910.1)

HSP 1 Score: 328.176 bits (840), Expect = 4.844e-114
Identity = 159/160 (99.38%), Postives = 159/160 (99.38%), Query Frame = 3
Query:  498 MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCSLKKHL 977
            MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKS VEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCSLKKHL
Sbjct:    1 MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSIVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCSLKKHL 160          
BLAST of Farnesoic acid O-methyltransferase vs. Planmine SMEST
Match: SMESG000074377.1 (SMESG000074377.1)

HSP 1 Score: 187.193 bits (474), Expect = 1.153e-58
Identity = 86/158 (54.43%), Postives = 113/158 (71.52%), Query Frame = 3
Query:  498 MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCSLKK 971
            MSKV +QYG+ VEI VSWQ+A +G IP   VKA G CFV RA+ NG+YIPGKL  GH  V+V Y GKEI  ++Y+ LV+T++L   G++WK+ +   +P  AI+GGTDNGQPL+I +S+V GE VVGK+ P HGCA+ P+ G E  K   E+LC + K
Sbjct:    1 MSKVSSQYGKGVEICVSWQKASNGEIPHRTVKAGGKCFVGRAQQNGQYIPGKLYEGHKGVYVSYGGKEICVNNYEALVETNVLHNDGFQWKYVDGNNVPSGAIVGGTDNGQPLYIARSEVNGEPVVGKYFPPHGCAYFPFGGEEHRKTGVEVLCCVAK 158          
BLAST of Farnesoic acid O-methyltransferase vs. Planmine SMEST
Match: SMESG000029913.1 (SMESG000029913.1)

HSP 1 Score: 184.496 bits (467), Expect = 1.067e-57
Identity = 88/160 (55.00%), Postives = 111/160 (69.38%), Query Frame = 3
Query:  498 MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCSLKKHL 977
            MSK++++YGR+VEISVSW +  DG+IP  AV A  SC+VARAKH  EYIPGK V GH+  +V YDGKEI KS YQ+LVD+SIL     EW ++   +IP  +I+GGTDN +PL+I KS + GE VVGK+ P+  C   PY G E  K+  EILC   K L
Sbjct:    1 MSKIVSEYGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMVEILCCTTKQL 160          
BLAST of Farnesoic acid O-methyltransferase vs. Planmine SMEST
Match: SMESG000074396.1 (SMESG000074396.1)

HSP 1 Score: 175.252 bits (443), Expect = 5.548e-54
Identity = 80/161 (49.69%), Postives = 116/161 (72.05%), Query Frame = 3
Query:  498 MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPT-TGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCSLKKHL 977
            MSKV +QYG  VE+S+SW +A++GSIP  AV+A G  FVARAKH+G+YIPGK V G++ VFV + G E  K++Y++LV++S+L    GYEWKW+    +P  A++GG ++G PL++ +S +E + VVGK++P HGCA++PY G E      E+LC   KH+
Sbjct:    1 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 161          
BLAST of Farnesoic acid O-methyltransferase vs. Planmine SMEST
Match: SMESG000074378.1 (SMESG000074378.1)

HSP 1 Score: 175.252 bits (443), Expect = 5.548e-54
Identity = 80/161 (49.69%), Postives = 116/161 (72.05%), Query Frame = 3
Query:  498 MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPT-TGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCSLKKHL 977
            MSKV +QYG  VE+S+SW +A++GSIP  AV+A G  FVARAKH+G+YIPGK V G++ VFV + G E  K++Y++LV++S+L    GYEWKW+    +P  A++GG ++G PL++ +S +E + VVGK++P HGCA++PY G E      E+LC   KH+
Sbjct:    1 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 161          
The following BLAST results are available for this feature:
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG442502.348e-2039.32gene:FBgn0265185 transcript:FBtr0339104[more]
CG442502.438e-2039.32gene:FBgn0265185 transcript:FBtr0339105[more]
CG105272.574e-2037.76gene:FBgn0034583 transcript:FBtr0071541[more]
CG133216.286e-1935.51gene:FBgn0033787 transcript:FBtr0345371[more]
CG133216.286e-1935.51gene:FBgn0033787 transcript:FBtr0087792[more]
back to top
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Farnesoic acid O-methyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Farnesoic acid O-methyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q5DHE42.603e-3240.00SJCHGC04453 protein OS=Schistosoma japonicum OX=61... [more]
A0A1I8J9Y82.865e-3242.58DUF3421 domain-containing protein OS=Macrostomum l... [more]
A0A1I8HE363.288e-3242.58DUF3421 domain-containing protein OS=Macrostomum l... [more]
A0A4Z2D8K26.268e-3240.67Natterin-4 OS=Schistosoma japonicum OX=6182 GN=EWB... [more]
A0A430PYP58.661e-3240.27DUF3421 domain-containing protein OS=Schistosoma b... [more]
back to top
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Farnesoic acid O-methyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Farnesoic acid O-methyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029910.14.844e-11499.38SMESG000029910.1[more]
SMESG000074377.11.153e-5854.43SMESG000074377.1[more]
SMESG000029913.11.067e-5755.00SMESG000029913.1[more]
SMESG000074396.15.548e-5449.69SMESG000074396.1[more]
SMESG000074378.15.548e-5449.69SMESG000074378.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028798 ID=SMED30028798|Name=Farnesoic acid O-methyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1041bp
GGGGATATATATGTTACTTAAGTTCTATTTAAATAGATGACTAGCTTTGT
ATATTTAGGCATCTATTTTAATGAAATTTAAATTACAAAAGTATGATTTT
AATAATAATTATGGCTTTTGCGAGGGAGTACTCATGGCAATGAAAAGGAT
AAATTCTCCATTGTCATGATAAAAGTAAAACACCATATTCCAGAGTAGTT
TCTCATAAAACAAATTAGATTAACCGCTTTAAATTATGCAAAAATAAAGT
CTTTTTTTCATTTGTCTACATAAGCCTTGTTTACCTCTAGGCAATATTTG
GAATTCAAAGAGTCCTTTGTGAAAAACATGAATATTGATATCTAAATTAT
GAACTTCCATAAATAGTATAATTTACTCAAACTTTCTTTGAAAGCTGTCC
TGATTTTGCAAGATATATATATATATATGTGTGTGTATATATATATATAT
AAGTGCTCTAAGTGCTCATTAAGTGTTTTTTTATTTAATAGGGAGAAATG
AGCAAAGTTATTACTCAATATGGAAGAGCAGTGGAGATTTCTGTATCATG
GCAGGAAGCCCATGATGGTTCGATTCCTTTGCATGCTGTCAAGGCAGATG
GATCCTGCTTCGTGGCAAGAGCTAAGCACAATGGAGAATACATTCCTGGG
AAATTGGTAACTGGTCACAGCCATGTTTTCGTTTGCTATGATGGTAAAGA
AATTACAAAGTCTCATTATCAAGTATTGGTTGATACAAGCATTTTGCCGA
CAACTGGATATGAATGGAAATGGTCAGAAGACTTGGAAATACCACCGAAT
GCGATTATTGGGGGAACGGATAATGGACAGCCTCTGTTCATTGTGAAAAG
TAAAGTTGAAGGAGAGACTGTTGTTGGGAAGTTTCATCCTGATCACGGAT
GCGCTCATGTACCTTATGAAGGCCTTGAATTTGAAAAGAATGAATTTGAA
ATTTTATGTTCTTTAAAAAAACACTTATAATTGTTTGCGATTAGTTATTT
AGACCGTTTATATAAAGAATAAATAAATATTATTAGAGAAA
back to top

protein sequence of SMED30028798-orf-1

>SMED30028798-orf-1 ID=SMED30028798-orf-1|Name=SMED30028798-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=161bp
MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIP
GKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPP
NAIIGGTDNGQPLFIVKSKVEGETVVGKFHPDHGCAHVPYEGLEFEKNEF
EILCSLKKHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0032259methylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000039gamma neoblast
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0000484secretory system
PLANA:0003117parapharyngeal cell
PLANA:0007552nu neoblast
Vocabulary: INTERPRO
TermDefinition
IPR006616DM9_repeat
IPR024518DUF3421
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006616DM9 repeatSMARTSM00696dm9coord: 15..80
e-value: 1.7E-6
score: 34.1
coord: 87..156
e-value: 2.2E-17
score: 73.8
IPR024518Domain of unknown function DUF3421PFAMPF11901DUF3421coord: 36..146
e-value: 1.5E-29
score: 102.3
NoneNo IPR availablePANTHERPTHR31649FAMILY NOT NAMEDcoord: 14..155