TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30028787
Length (bp)1216
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30028787) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30028787) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30028787) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30028787) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028787

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30028787SMESG000015087.1 dd_Smed_v4_2354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028787SMESG000015087.1 dd_Smed_v4_2354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30028787SMESG000015087.1 dd_Smed_v4_2354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028787SMESG000015087.1 dd_Smed_v4_2354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30028787SMESG000015087.1 dd_Smed_v4_2354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028787SMESG000015087.1 dd_Smed_v4_2354_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.1586 bits (152), Expect = 3.685e-10
Identity = 39/142 (27.46%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  504 IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  369 VHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 504          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.1586 bits (152), Expect = 3.685e-10
Identity = 39/142 (27.46%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  504 IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  369 VHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 504          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.1586 bits (152), Expect = 4.534e-10
Identity = 39/142 (27.46%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  504 IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  394 VHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.1586 bits (152), Expect = 4.534e-10
Identity = 39/142 (27.46%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  504 IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  394 VHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 62.7734 bits (151), Expect = 5.359e-10
Identity = 39/142 (27.46%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  504 IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  311 VHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 446          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 65.855 bits (159), Expect = 3.428e-11
Identity = 60/256 (23.44%), Postives = 108/256 (42.19%), Query Frame = 3
Query:  162 FQQKICEMETNEMENLEKIEQLNEEMVALKDDNRRLRSEMETNVQSINSMRQQIEMTETKCQQQIGELKXXXXXXXXXXXXEMEMLCRKIDKMSEQKADGASRVDNNDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFI------YSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
             +QK+  M+     + EK+ ++  E+  L+   R +R E+ET   S+ SMR  +   ++ C             +        + L R  D MS                    + D ++ ++ +K+  +ET   N    G   WKI +  +++++  +      YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G   +     +   PS + + +P  + N
Sbjct:  314 LEQKLVSMQMLMSSHSEKLLEVEMELRELRP-LRAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLE--------QQLTRHDDLMS--------------------VHDVRLAEMDLKLQVLETASFN----GTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTL--MLMDQGPARKHLGDAFKPDPSSSSFRRPTGEMN 534          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.770e-7
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 3
Query:  519 MNDLKIKMMEMETKLINAEIC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN 896
            + DL I  ME + + ++A    G F WKI +  K+ +D        ++S  F++   GYKMCL +  +  G      + + F ++RG  +  L WPF   VT+  +   N    R   I  + RP  S + + +PV D N
Sbjct:  104 LRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN----REHIID-AFRPDISSSSFQRPVSDMN 238          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.770e-7
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 3
Query:  519 MNDLKIKMMEMETKLINAEIC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN 896
            + DL I  ME + + ++A    G F WKI +  K+ +D        ++S  F++   GYKMCL +  +  G      + + F ++RG  +  L WPF   VT+  +   N    R   I  + RP  S + + +PV D N
Sbjct:  104 LRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN----REHIID-AFRPDISSSSFQRPVSDMN 238          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 51.6026 bits (122), Expect = 1.110e-6
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 3
Query:  519 MNDLKIKMMEMETKLINAEIC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN 896
            + DL I  ME + + ++A    G F WKI +  K+ +D        ++S  F++   GYKMCL +  +  G      + + F ++RG  +  L WPF   VT+  +   N    R   I  + RP  S + + +PV D N
Sbjct:  404 LRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN----REHIID-AFRPDISSSSFQRPVSDMN 538          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 49.2914 bits (116), Expect = 5.455e-6
Identity = 29/100 (29.00%), Postives = 49/100 (49.00%), Query Frame = 3
Query:  534 IKMMEMETKLINAEIC---GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTI 791
            +++ E E  L   + C   G F WKI    ++ +D        ++S  F+S   GYKMCL +  +  G      + + F +++G+Y+  L WPF   VT+
Sbjct:  364 LQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTL 463          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 60.4622 bits (145), Expect = 1.736e-9
Identity = 48/175 (27.43%), Postives = 82/175 (46.86%), Query Frame = 3
Query:  519 MNDLKIKMMEMETKLI-NAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN--EGIQIY------NIPCDAFVNGNDQLLIKCRVE 977
            M D+ +  +EM +  +      G F WKI +L  +  D        +YS  F++   GYK+CL +  +  G      + + F +++GEY+  L WPFK+ VT   +   N    R S    + RP  + A + +P++D N   G  ++      N P  A++  N  L I+C ++
Sbjct:  208 MKDIVLNELEMRSACLEQTSYDGVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNN----RDSVFD-AFRPDVTSASFQRPINDMNVASGCPLFCPIAKLNSPKHAYIREN-TLYIRCIID 376          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 60.4622 bits (145), Expect = 2.844e-9
Identity = 38/142 (26.76%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  504 IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  V++  +    G   R     +   P+ + + KP  + N
Sbjct:  362 VHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSL--MLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMN 497          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 60.077 bits (144), Expect = 3.402e-9
Identity = 38/142 (26.76%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  504 IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  V++  +    G   R     +   P+ + + KP  + N
Sbjct:  387 VHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSL--MLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMN 522          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 54.299 bits (129), Expect = 2.604e-7
Identity = 45/180 (25.00%), Postives = 81/180 (45.00%), Query Frame = 3
Query:  519 MNDLKIKMMEMETKL--INAEIC-GKFEWKIEN---LLK---QEKDKFIYSNPFFSGPSGYKMCLSV------IQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEG-------IQIYNIPCDAFVNGNDQLLIKCRVEEEHNL 992
            +N+LK  +  ++ +L  + ++ C G F W+I N   LLK   +E+   I+S  F++G  GYK+CL +       Q     I +  H ++GEY+  L WP +  + +  +    G   +        +P    + +P   RN         + +  +    +V  ND LL++C V    +L
Sbjct:  363 VNELKHTIRSLDNRLGEMESQQCSGIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARNPKGFGYVTFMHLQALKQRQYVK-NDTLLVRCSVTTHLDL 541          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 63.5438 bits (153), Expect = 1.853e-10
Identity = 43/169 (25.44%), Postives = 80/169 (47.34%), Query Frame = 3
Query:  429 IDKMSEQKADGASRVDN--NDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            +DK + Q A     +++  +  +    + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  341 VDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 503          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 63.5438 bits (153), Expect = 1.853e-10
Identity = 43/169 (25.44%), Postives = 80/169 (47.34%), Query Frame = 3
Query:  429 IDKMSEQKADGASRVDN--NDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            +DK + Q A     +++  +  +    + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  341 VDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 503          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 63.5438 bits (153), Expect = 2.033e-10
Identity = 43/169 (25.44%), Postives = 80/169 (47.34%), Query Frame = 3
Query:  429 IDKMSEQKADGASRVDN--NDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            +DK + Q A     +++  +  +    + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  366 VDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 528          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 55.4546 bits (132), Expect = 7.220e-8
Identity = 46/167 (27.54%), Postives = 76/167 (45.51%), Query Frame = 3
Query:  528 LKIKMMEMETKLINAEICGKFEWKIENL---LK---QEKDKFIYSNPFFSGPSGYKMC------LSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN-EGI-QIYNIPCDAFVNG----NDQLLIKCRV 974
            L+ K+ EME +  N    G + WKI N    LK   +E+   I+S  F++G  GYK+C      L   Q     I +  H ++GEY+  L WPF+  + +  +      I ++       +P    + +P   RN +G   +  +  +A   G    +D LL++C V
Sbjct:  345 LEDKVAEMEAQQCN----GIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEV 507          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 50.447 bits (119), Expect = 2.589e-6
Identity = 42/153 (27.45%), Postives = 70/153 (45.75%), Query Frame = 3
Query:  582 GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN--EGIQIY------NIPCDAFVNGNDQLLIKCRVE 977
            G F WKI N+ K+  +        ++S  F++   GYK+CL +  +  G      + +   ++RGEY+  L WPF+  VT   +   N    R   I  + RP  S A + +P  + N   G  ++        P  A+V  +D + +KC V+
Sbjct:  260 GTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNN----REHAID-AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVK-DDTMFLKCIVD 406          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 1.422e-9
Identity = 43/169 (25.44%), Postives = 80/169 (47.34%), Query Frame = 3
Query:  429 IDKMSEQKADGASRVDN--NDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            +DK + Q A     +++  +  +    + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  366 VDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 528          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 63.1586 bits (152), Expect = 2.178e-9
Identity = 39/142 (27.46%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  504 IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  394 VHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.501e-7
Identity = 44/174 (25.29%), Postives = 75/174 (43.10%), Query Frame = 3
Query:  519 MNDLKIKMMEMETKL--INAEIC-GKFEWKIENLL------KQEKDKFIYSNPFFSGPSGYKMCLSV------IQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEG-------IQIYNIPCDAFVNGNDQLLIKCRV 974
            +N+LK  +  +E KL  ++   C G F WKI+         ++EK   I+S  F++G  GYK+CL +       Q     I +  H ++GEY+  L WP    + +  +    G I +        +P    + +P   RN         + +  +    +V  ND L ++C V
Sbjct:  361 VNELKHTIRSLEDKLLDVDGHHCNGVFIWKIKGFSGLQKTQEEEKPVVIHSPGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLHGTIRLSILDQSEGAIIQDQEEVMDTKPDLLAFQRPTTQRNPKGFGYVTFMHLNTLKQRQYVK-NDTLFVRCAV 533          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.843e-7
Identity = 46/174 (26.44%), Postives = 82/174 (47.13%), Query Frame = 3
Query:  519 MNDLK--IKMMEMETKLINAEIC-GKFEWKIENL---LK---QEKDKFIYSNPFFSGPSGYKMC----LSVIQSSRGQIFVSF--HLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEG-------IQIYNIPCDAFVNGNDQLLIKCRV 974
            +N+LK  I+ +E +   I A+ C G + WKI N    LK   +EK   I+S  F++G  GYK+C    L +  + R   ++S   H ++GEY+  L WPF+  + +  +      + ++       +P    + +P   RN         + +  +    F+  +D LL++C V
Sbjct:  347 VNELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPSAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAAVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIK-DDTLLVRCEV 519          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B5DF45|TRAF6_RAT (TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.844e-7
Identity = 46/170 (27.06%), Postives = 77/170 (45.29%), Query Frame = 3
Query:  519 MNDLKIKMMEMETKLINAEICGKFEWKIENL---LK---QEKDKFIYSNPFFSGPSGYKMC------LSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN-EGI-QIYNIPCDAFVNG----NDQLLIKCRV 974
            +  L+ K+ EME +  N    G + WKI N    LK   +E+   I+S  F++G  GYK+C      L   Q     I +  H ++GEY+  L WPF+  + +  +      I ++       +P    + +P   RN +G   +  +  +A   G    +D LL++C V
Sbjct:  342 IRSLEDKVAEMEAQQCN----GIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAVIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEV 507          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0L8HQP6 (MATH domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22008610mg PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.944e-11
Identity = 66/246 (26.83%), Postives = 104/246 (42.28%), Query Frame = 3
Query:  198 MENLEKIEQLNEEMVALKDDNRRLRSEMETNVQSINSMRQQIEMTETKCQQQIGELKXXXXXXXXXXXXEMEMLCRKIDKMSEQKADGASRVDNNDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFE----WKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDR----PSDARWGKPVDDRN 896
             EN +K   L E+++ L  D +RL+   +  VQ + S     +MT                         ++ L   ID++  Q     + +D   G     + D ++ ++  K+  +     +AE+  K      WK  + LK  K  FIYS PF+S   GYKMC  V  +  G      +   F +++GEY++ LTWPFK+ VT+  +    G         YSDR    P+   + KP  D N
Sbjct:  169 FENKKKFVNLTEKLIVLDQDLQRLKEGTDKQVQILKSKESITDMTT------------------------IQNLSTLIDQLLTQ----VTSIDRQIG-----LHDMRIEEMNSKLTSVTHPNYDAEVLMKISNYSRWK--SALKTSKTSFIYSEPFYSSKYGYKMCAKVYLNGDGIGKGTHLSFYFTIMKGEYDNILTWPFKHKVTLTVLDQFGGE------KNYSDRFLPDPNSKSFHKPSSDYN 373          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A4C1WCS8 (TNF receptor-associated factor 6 OS=Eumeta variegata OX=151549 GN=TRAF6 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 6.644e-10
Identity = 41/143 (28.67%), Postives = 72/143 (50.35%), Query Frame = 3
Query:  537 KMMEMETKLINAEIC-GKFEWKIENL------LKQEKDKFIYSNPFFSGPSGYKMC--LSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYR---SSTIKYSDRPSDARWGKPVDDRNE---GIQIYNI 920
            K ++M T       C G+F W+++ +      +K + ++ IYS PF++ P GYK C  L++ Q +   + ++ HL++  ++D LTWPF    TI  +     N YR   S  +  +  P+   + +P  DR+    G Q Y +
Sbjct:  178 KQLDMLTHTAARRTCFGEFLWRVDGISGHIATMKADHNRIIYSEPFYTSPYGYKFCLRLNISQHNSNYLALNLHLMKSPHDDCLTWPFSGSFTITMV-----NRYRPDLSEVVSMASNPAVLAFTRPTLDRHPRGFGYQEYGL 315          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3M6V1C0 (Uncharacterized protein (Fragment) OS=Pocillopora damicornis OX=46731 GN=pdam_00012082 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.265e-9
Identity = 44/171 (25.73%), Postives = 85/171 (49.71%), Query Frame = 3
Query:  420 CRKIDKMSEQKADGASRVDNNDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSV----IQSSRG-QIFVSFHLIRGEYNDKLTWPFKYGVTIDAI-TTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            C++ID ++ Q+ +   RVD  + E              +K++  E +L N    G++ WKIEN+ +  +D        +YS  F++ P GYK+CL +    ++S  G  + +  H++RG+Y++ L WPF  G ++  +  + + ++    T     +P  + + +PV   N
Sbjct:   64 CKEIDCLTLQQKETVDRVDELEVE--------------VKLLRQEQQLCN----GRYVWKIENIDRCCEDAISGVSPVMYSPGFYASPHGYKLCLRINLNGVKSGVGTHVALYVHMMRGDYDNHLEWPFSKGFSLSIVDQSDDESLQYHITETVITKPELSAFQRPVPPHN 216          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2B4SA99 (TNF receptor-associated factor 6-B OS=Stylophora pistillata OX=50429 GN=traf6-b PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.022e-9
Identity = 37/132 (28.03%), Postives = 71/132 (53.79%), Query Frame = 3
Query:  531 KIKMMEMETKLI--NAEIC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSV----IQSSRG-QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPV 884
            ++  +++E KL+    ++C G++ WKIEN+ +  +D        +YS  F++ P GYKMCL +    ++S  G  + +  H++RG+++  L WPF  G T+  +    G++    T     +P  + + +PV
Sbjct:  318 RVHKLKVEVKLLQQGQQLCNGQYIWKIENMDRCCQDAVSGVSPVMYSPGFYTSPCGYKMCLRINLNGVKSGVGTHVALHVHMMRGDHDKHLEWPFSKGFTLSIVDQSEGSLQYHITKTVVTKPEPSVFQRPV 449          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: S4R4E5 (TNF receptor-associated factor OS=Petromyzon marinus OX=7757 PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 3.934e-9
Identity = 40/155 (25.81%), Postives = 74/155 (47.74%), Query Frame = 3
Query:  465 SRVDNNDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            S +  +D + F    D ++ ++ ++   +ET   N    GK  WKI +  ++++D        +YS PF++ P GY+MC     +  G      + + F ++RGEY+  L WPF+  VT+  +    G   R  +  +   P+ + + +P  D N
Sbjct:  292 SALSRHDTQLFAH--DTRLAEMDLRFQVLETASYN----GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLD--QGAARRQLSDTFKPDPASSSFRRPTSDMN 438          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 1.691e-7
Identity = 28/81 (34.57%), Postives = 43/81 (53.09%), Query Frame = 3
Query:  582 GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTI 791
            G   WKI +  +++ +        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+
Sbjct:    4 GTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTL 84          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 53.1434 bits (126), Expect = 3.353e-7
Identity = 33/105 (31.43%), Postives = 52/105 (49.52%), Query Frame = 3
Query:  519 MNDLKIKMMEMETKLINAEIC---GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTI 791
            M DL+  + E E  L   + C   G F WKI +  ++ +D        ++S  F+S   GYKMCL +  +  G      + + F ++RG+Y+  L WPF   VT+
Sbjct:  360 MRDLQ--LAESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTL 462          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 51.2174 bits (121), Expect = 1.319e-6
Identity = 37/146 (25.34%), Postives = 67/146 (45.89%), Query Frame = 3
Query:  582 GKFEWKIENLL-KQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQI--------YNIPCDAFVNGNDQLLIKCRVE 977
            GK  WK+ +   K+E    + S PF++  SGYK+   V     G      + +   L+RG+++  L WPF+  VT+ A+  ++GN    S + ++   +   + +P  + N  +             P +A    +D L IK +V+
Sbjct:  400 GKLIWKVHDYHRKKEAGTALNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTL-AVLDQSGNRNHVS-LSFTPDLASNNFRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVD 543          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 50.8322 bits (120), Expect = 1.858e-6
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 3
Query:  519 MNDLKIKMMEMETKLINAEIC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN 896
            + DL I  ME + + ++A    G F WKI +  K+ +D        ++S  F++   GYKMCL +  +  G      + + F ++RG  +  L WPF   VT+  +   N    R   I  + RP  S + + +PV D N
Sbjct:  401 LRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN----REHIID-AFRPDISSSSFQRPVSDMN 535          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 50.447 bits (119), Expect = 2.147e-6
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 3
Query:  519 MNDLKIKMMEMETKLINAEIC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN 896
            + DL I  ME + + ++A    G F WKI +  K+ +D        ++S  F++   GYKMCL +  +  G      + + F ++RG  +  L WPF   VT+  +   N    R   I  + RP  S + + +PV D N
Sbjct:  288 LRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN----REHIID-AFRPDISSSSFQRPVSDMN 422          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 3.023e-13
Identity = 40/155 (25.81%), Postives = 74/155 (47.74%), Query Frame = 3
Query:  465 SRVDNNDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            S +  +D + F    D ++ ++ ++   +ET   N    GK  WKI +  ++++D        +YS PF++ P GY+MC     +  G      + + F ++RGEY+  L WPF+  VT+  +    G   R  +  +   P+ + + +P  D N
Sbjct:  292 SALSRHDTQLFAH--DTRLAEMDLRFQVLETASYN----GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLD--QGAARRQLSDTFKPDPASSSFRRPTSDMN 438          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.940e-11
Identity = 38/140 (27.14%), Postives = 68/140 (48.57%), Query Frame = 3
Query:  510 DGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            DG ++  + ++  +ET    A   GK  WKI +  +++++        +YS PF++ P GYKMC     +  G      + + F ++RGEY+  L WPF+  VT+  +    G   R  +  ++  P+   + +P  D N
Sbjct:  248 DGLLDTAERRLQVLET----AGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLD--QGAARRHLSDTFTPDPASGSFRRPDGDMN 381          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 60.077 bits (144), Expect = 6.358e-10
Identity = 75/288 (26.04%), Postives = 129/288 (44.79%), Query Frame = 3
Query:  195 EMENLEKIEQLNEEMVALKDDNRRLRS-EMETNVQSINSMRQQIEMTETKCQQQIGELKXXXXXXXXXXXXEMEMLCRKIDKMSEQKADGAS-----RVDNNDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLK--QE----KDKFIYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRN----GNIYRSSTIKYSDRPSDARWGKPVDDRN--EGIQIY----NIPCDAFVNGNDQLLIKCRVE 977
            E E  ++ EQ+ E+  AL   N+ LR+ + + NV   +   Q+ E+ E K + Q+ E++   ++Q ++L        R     S   + G +     R D N+ +     I    +DLK++M+E  +        G + WKI+   +  QE    K   IYS PF+ G  GYK C  V  +  G      + + F L+RGE++  L WPF+  VT   +        G+ +R         P+ + + +P  + N   G  ++    N+   A+V  +D + IK  V+
Sbjct:  249 EKERAKQQEQMYEQREALAVANQNLRTYQGKLNVIERSVAEQRRELAELKERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYD------GTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHDIGDTFRPD-------PTSSSFKRPTSNMNIASGCPLFISHTNLQTRAYVR-DDTMFIKIAVD 522          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 55.8398 bits (133), Expect = 1.537e-8
Identity = 31/91 (34.07%), Postives = 47/91 (51.65%), Query Frame = 3
Query:  582 GKFEWKIENLLKQEKDK------FIYSNPFFSGPSGYKMCLSVIQSSRGQ-------IFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNG 815
            G F WKI+   ++  +        IYS+PF++   GYK+C  +  +  G        IF++  L+RGEY+  L WPF+  +TI  I   NG
Sbjct:  380 GTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIA--LMRGEYDSILPWPFQETITITLIDQDNG 468          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 54.6842 bits (130), Expect = 3.611e-8
Identity = 46/167 (27.54%), Postives = 76/167 (45.51%), Query Frame = 3
Query:  510 DGKMNDLKIKMMEMETKLINAE--IC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSV----IQSSRGQIFVSF-HLIRGEYNDKLTWPFKYGVTI------DAITTRNG---NIYRSSTIKYSDRPSDARWGK--------PVDDRNEGIQIYN 917
            D ++ +L  K+M +ET+ I  E  +C G F WK++N  +  +         I+S PF++   GYKMCL +    +    G+    F H+++G+++  L WPF   +T+      D I +R      +     +    RP+  R  K        P+D   EG  I N
Sbjct:  305 DRRIAELTHKLMRLETREIELEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDSRRPISETLVAKPNLLAFQRPTSPRNHKGYGYVEFCPIDQLTEGQYIKN 471          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 53.1434 bits (126), Expect = 1.240e-7
Identity = 26/77 (33.77%), Postives = 40/77 (51.95%), Query Frame = 3
Query:  594 WKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTI 791
            WKI N+  +  +         YS  FF+GP GYKMC  +  +  G      + + F ++RGE++  L WPF+  VT+
Sbjct:  337 WKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTL 413          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO40665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6K0])

HSP 1 Score: 50.0618 bits (118), Expect = 7.667e-7
Identity = 42/136 (30.88%), Postives = 68/136 (50.00%), Query Frame = 3
Query:  534 IKMMEMETKLINAEIC--GKFEWKIENLL--------KQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQ---IFVSFHLI--RGEYNDKLTWPFKYGVTI------DAITTRNGNIYRSSTIKYSD---RPSDAR 869
            I++ E+E +    +IC  GKF WKI N          K+EK+K + S PF++G  GYK+      +  GQ     +S +++  +G+Y+  L WPF+  V        D  T+R    +R +  + SD   RP+ A+
Sbjct:  213 IRIRELEQR--QEKICTNGKFLWKISNYTQLFQQSATKKEKEK-LCSPPFYTGQYGYKLRAEAFLNGLGQGKGTHLSLYVVIMKGDYDSVLPWPFQQRVDFILIDQDDDFTSRQNKTWRLTCDRNSDYFGRPNKAK 345          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 61.6178 bits (148), Expect = 4.828e-10
Identity = 39/138 (28.26%), Postives = 67/138 (48.55%), Query Frame = 3
Query:  516 KMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 896
            ++ D+ ++   +ET   N    G   WKI +  ++++D        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G   +     +   PS + + +PV + N
Sbjct:  280 RLADMDLRFQVLETASYN----GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTL--MLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMN 411          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 51.6026 bits (122), Expect = 1.089e-6
Identity = 42/140 (30.00%), Postives = 66/140 (47.14%), Query Frame = 3
Query:  519 MNDLKIKMMEMETKLINAEIC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN 896
            + DL I  ME + K ++A    G F WKI +  K+ +D        ++S  F++   GYKMCL +  +  G      + + F ++RG  +  L WPF   VT+  +   N    R   I  + RP  S + + +PV D N
Sbjct:  398 LRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN----REHIID-AFRPDISSSSFQRPVSDMN 532          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000015087.1 (SMESG000015087.1)

HSP 1 Score: 359.762 bits (922), Expect = 1.640e-121
Identity = 194/276 (70.29%), Postives = 218/276 (78.99%), Query Frame = 3
Query:  165 QQKICEMETNEMENLEKIEQLNEEMVALKDDNRRLRSEMETNVQSINSMRQQIEMTETKCQQQIGELKXXXXXXXXXXXXEMEMLCRKIDKMSEQKADGASRVDNNDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL 992
            Q+KI EME   M ++ + ++LN          R LR E E  +  I    +QIE+           LKQ+++Q QQ+ N+E+++L   ID++ ++  + A        E F+ IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITT+NGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL
Sbjct:  190 QEKILEMERKTMNSMRETDELN----------RLLRRETEK-INQIWPRNEQIEL-----------LKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMA-----NENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTKNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL 438          

HSP 2 Score: 50.0618 bits (118), Expect = 1.930e-6
Identity = 26/38 (68.42%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 IDLINNLLSEMESMKNEIIEVKRENSQFKQKIDNIELQ 115
            ID INN   E+ES+KNE IE+K EN+QFKQK  NIELQ
Sbjct:  148 IDQINNFFGEVESLKNENIELKMENNQFKQKFANIELQ 185          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000015087.1 (SMESG000015087.1)

HSP 1 Score: 359.377 bits (921), Expect = 3.566e-121
Identity = 194/276 (70.29%), Postives = 218/276 (78.99%), Query Frame = 3
Query:  165 QQKICEMETNEMENLEKIEQLNEEMVALKDDNRRLRSEMETNVQSINSMRQQIEMTETKCQQQIGELKXXXXXXXXXXXXEMEMLCRKIDKMSEQKADGASRVDNNDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL 992
            Q+KI EME   M ++ + ++LN          R LR E E  +  I    +QIE+           LKQ+++Q QQ+ N+E+++L   ID++ ++  + A        E F+ IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITT+NGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL
Sbjct:  198 QEKILEMERKTMNSMRETDELN----------RLLRRETEK-INQIWPRNEQIEL-----------LKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMA-----NENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTKNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL 446          

HSP 2 Score: 50.0618 bits (118), Expect = 2.078e-6
Identity = 26/38 (68.42%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 IDLINNLLSEMESMKNEIIEVKRENSQFKQKIDNIELQ 115
            ID INN   E+ES+KNE IE+K EN+QFKQK  NIELQ
Sbjct:  156 IDQINNFFGEVESLKNENIELKMENNQFKQKFANIELQ 193          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014712.1 (SMESG000014712.1)

HSP 1 Score: 347.436 bits (890), Expect = 2.490e-116
Identity = 193/276 (69.93%), Postives = 226/276 (81.88%), Query Frame = 3
Query:  165 QQKICEMETNEMENLEKIEQLNEEMVALKDDNRRLRSEMETNVQSINSMRQQIEMTETKCQQQIGELKXXXXXXXXXXXXEMEMLCRKIDKMSEQKADGASRVDNNDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIY---NIPCDAFVNGNDQLLIKCRVEEE 983
            QQKIC+ME+NE+EN  +IE+LNEEMVALKDDNRRLRSEMETNVQSINSMRQQIEMTETKCQQQIGELKQNYQQQQQQLNNEMEMLCRKIDKMSEQKADGASRVDNNDGETFTWIIDGKMNDL++  ++ ET+LIN  IC KFEWKIENL +QE+ K I+S PF++GP+GYKMCLSV   +  +IFV FHL++G+ +D+L WPF+Y VTID I   NG+I+ S  IKYSD P  A   KP + RNE I +Y   NI  ++    N+QL++ C VE E
Sbjct:  191 QQKICDMESNEIENRGEIERLNEEMVALKDDNRRLRSEMETNVQSINSMRQQIEMTETKCQQQIGELKQNYQQQQQQLNNEMEMLCRKIDKMSEQKADGASRVDNNDGETFTWIIDGKMNDLELGKIKKETRLINTGICWKFEWKIENLSQQERRKRIHSKPFYTGPNGYKMCLSV-NITDCRIFVGFHLMQGDSDDRLEWPFRYAVTIDLIDIENGDIWCSRKIKYSDAPDAAGRRKPGNGRNERILVYDLLNIQWNSPPIRNNQLVMNCLVEHE 465          

HSP 2 Score: 53.5286 bits (127), Expect = 1.605e-7
Identity = 28/34 (82.35%), Postives = 31/34 (91.18%), Query Frame = 2
Query:   26 SEMESMKNEIIEVKRENSQFKQKIDNIELQSTSK 127
            SEMESMKNEIIEVKREN Q KQKIDNI+LQS ++
Sbjct:  157 SEMESMKNEIIEVKRENLQSKQKIDNIDLQSVNQ 190          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070162.1 (SMESG000070162.1)

HSP 1 Score: 322.013 bits (824), Expect = 5.034e-106
Identity = 180/298 (60.40%), Postives = 228/298 (76.51%), Query Frame = 3
Query:  165 QQKICEMETNEMENLEKIEQLNEEMVALKDDNRRLRSEMETNVQSINSMRQQIEMTETKCQQQIGELKXXXXXXXXXXXXEMEMLCRKIDKMSEQKADGASRVDNNDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSV----------IQSSRG-----------QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIY----NIPCDAFVNGNDQLLIKCRVEEE 983
            QQKICEME+NEMEN  +IEQLNEEMV LK++NRRLRSE+ETN QSIN++RQQI + ETK Q QI ELKQN+QQQQQ+LN+E EM  R+I+K++EQ A+GASRVDNN+GETF  +IDG++N+L+++M+EMET+ INA+I G+FEWKIENL +Q KDK+I+S PF+SGP+GYKMCLSV           Q  RG           +I V F+++RG+ +DKL WPFKY VTID I T NG+I+RS TIKYSDRP  A W KPV DRNE I +Y    +IP ++    N++LLIKCR+E E
Sbjct:  199 QQKICEMESNEMENRGEIEQLNEEMVVLKNENRRLRSEIETNAQSINAIRQQIGIIETKSQLQIDELKQNHQQQQQELNDEAEMPRREINKLNEQNANGASRVDNNNGETFKQVIDGEINNLELRMIEMETRFINAQIRGEFEWKIENLSQQVKDKWIHSKPFYSGPNGYKMCLSVNINHLEIENLSQRVRGRRMCLNVIIDWRICVGFYMMRGDSDDKLAWPFKYAVTIDVIDTANGDIWRSETIKYSDRPDAAGWMKPVTDRNERIPVYKWPDHIPLNSPPIRNNRLLIKCRLERE 496          

HSP 2 Score: 68.5514 bits (166), Expect = 2.367e-12
Identity = 35/41 (85.37%), Postives = 38/41 (92.68%), Query Frame = 2
Query:    5 DLINNLLSEMESMKNEIIEVKRENSQFKQKIDNIELQSTSK 127
            DLINNLL EMESMKNE IE+KRENSQFKQKIDNIELQS ++
Sbjct:  158 DLINNLLGEMESMKNENIELKRENSQFKQKIDNIELQSANQ 198          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070162.1 (SMESG000070162.1)

HSP 1 Score: 322.013 bits (824), Expect = 8.184e-106
Identity = 180/298 (60.40%), Postives = 228/298 (76.51%), Query Frame = 3
Query:  165 QQKICEMETNEMENLEKIEQLNEEMVALKDDNRRLRSEMETNVQSINSMRQQIEMTETKCQQQIGELKXXXXXXXXXXXXEMEMLCRKIDKMSEQKADGASRVDNNDGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSV----------IQSSRG-----------QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIY----NIPCDAFVNGNDQLLIKCRVEEE 983
            QQKICEME+NEMEN  +IEQLNEEMV LK++NRRLRSE+ETN QSIN++RQQI + ETK Q QI ELKQN+QQQQQ+LN+E EM  R+I+K++EQ A+GASRVDNN+GETF  +IDG++N+L+++M+EMET+ INA+I G+FEWKIENL +Q KDK+I+S PF+SGP+GYKMCLSV           Q  RG           +I V F+++RG+ +DKL WPFKY VTID I T NG+I+RS TIKYSDRP  A W KPV DRNE I +Y    +IP ++    N++LLIKCR+E E
Sbjct:  206 QQKICEMESNEMENRGEIEQLNEEMVVLKNENRRLRSEIETNAQSINAIRQQIGIIETKSQLQIDELKQNHQQQQQELNDEAEMPRREINKLNEQNANGASRVDNNNGETFKQVIDGEINNLELRMIEMETRFINAQIRGEFEWKIENLSQQVKDKWIHSKPFYSGPNGYKMCLSVNINHLEIENLSQRVRGRRMCLNVIIDWRICVGFYMMRGDSDDKLAWPFKYAVTIDVIDTANGDIWRSETIKYSDRPDAAGWMKPVTDRNERIPVYKWPDHIPLNSPPIRNNRLLIKCRLERE 503          

HSP 2 Score: 68.5514 bits (166), Expect = 2.507e-12
Identity = 35/41 (85.37%), Postives = 38/41 (92.68%), Query Frame = 2
Query:    5 DLINNLLSEMESMKNEIIEVKRENSQFKQKIDNIELQSTSK 127
            DLINNLL EMESMKNE IE+KRENSQFKQKIDNIELQS ++
Sbjct:  165 DLINNLLGEMESMKNENIELKRENSQFKQKIDNIELQSANQ 205          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF33.685e-1027.46TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.685e-1027.46TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.534e-1027.46TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.534e-1027.46TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF35.359e-1027.46TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf33.428e-1123.44TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
BX901915.11.770e-729.29pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.11.770e-729.29pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
traf2a1.110e-629.29Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
traf2b5.455e-629.00Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hspb61.736e-927.43heat shock protein family B (small) member 6 [Sour... [more]
ssh22.844e-926.76slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh23.402e-926.76slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
egf2.604e-725.00epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf31.853e-1025.44TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.853e-1025.44TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf32.033e-1025.44TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf67.220e-827.54TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf12.589e-627.45TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60803|TRAF3_MOUSE1.422e-925.44TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN2.178e-927.46TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q6DJN2|TRF6B_XENLA1.501e-725.29TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|Q3ZCC3|TRAF6_BOVIN1.843e-726.44TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
sp|B5DF45|TRAF6_RAT3.844e-727.06TNF receptor-associated factor 6 OS=Rattus norvegi... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8HQP62.944e-1126.83MATH domain-containing protein OS=Octopus bimaculo... [more]
A0A4C1WCS86.644e-1028.67TNF receptor-associated factor 6 OS=Eumeta variega... [more]
A0A3M6V1C01.265e-925.73Uncharacterized protein (Fragment) OS=Pocillopora ... [more]
A0A2B4SA993.022e-928.03TNF receptor-associated factor 6-B OS=Stylophora p... [more]
S4R4E53.934e-925.81TNF receptor-associated factor OS=Petromyzon marin... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035169.11.691e-734.57pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf2b3.353e-731.43TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf51.319e-625.34TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf2a1.858e-629.29TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a2.147e-629.29TNF receptor-associated factor 2-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000074.13.023e-1325.81pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.11.940e-1127.14pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494646.358e-1026.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352371.537e-834.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487733.611e-827.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388731.240e-733.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406657.667e-730.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
traf34.828e-1028.26TNF receptor associated factor 3 [Source:NCBI gene... [more]
ENSORLT00000020861.21.089e-630.00TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015087.11.640e-12170.29SMESG000015087.1[more]
SMESG000015087.13.566e-12170.29SMESG000015087.1[more]
SMESG000014712.12.490e-11669.93SMESG000014712.1[more]
SMESG000070162.15.034e-10660.40SMESG000070162.1[more]
SMESG000070162.18.184e-10660.40SMESG000070162.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028787 ID=SMED30028787|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1216bp
GATTGATCTGATCAATAATTTACTCAGTGAGATGGAATCAATGAAGAATG
AAATAATCGAAGTGAAGAGAGAAAACAGTCAATTCAAACAAAAAATCGAT
AATATCGAGTTGCAATCAACAAGCAAATTGATTGATGAAAATATTTGATT
GATATTTGTGATTTCAGCAGAAAATATGCGAGATGGAAACCAATGAGATG
GAAAATCTGGAAAAAATTGAGCAGCTGAATGAGGAAATGGTGGCACTGAA
GGATGATAATCGGAGGTTGAGAAGCGAGATGGAGACAAATGTTCAATCAA
TCAATTCAATGAGACAGCAAATTGAAATGACTGAGACAAAATGCCAACAG
CAAATTGGTGAATTAAAACAAAATTATCAGCAACAGCAGCAGCAACTGAA
TAATGAAATGGAAATGCTGTGCAGAAAAATCGATAAAATGAGTGAGCAAA
AGGCTGATGGTGCATCGAGAGTTGATAATAATGACGGGGAGACATTCACG
TGGATTATTGATGGGAAAATGAATGATTTGAAAATTAAAATGATGGAGAT
GGAAACCAAATTAATTAATGCAGAAATTTGCGGGAAATTTGAATGGAAAA
TTGAAAATCTATTAAAACAAGAAAAAGACAAATTCATCTACAGCAATCCA
TTTTTTTCAGGGCCATCTGGCTACAAAATGTGCTTGAGTGTAATTCAGAG
TTCGCGTGGTCAGATTTTTGTTTCTTTCCATTTGATTCGTGGGGAATACA
ATGACAAATTGACATGGCCATTCAAGTATGGTGTGACAATTGATGCGATC
ACTACAAGAAATGGAAATATCTATCGCAGTAGTACTATAAAATACTCTGA
TCGTCCTAGTGATGCCAGATGGGGGAAACCAGTAGATGACAGAAATGAGG
GAATCCAGATATATAACATCCCATGCGATGCATTTGTCAACGGAAATGAC
CAATTGCTGATCAAATGCAGAGTGGAAGAAGAACATAATTTATAGCTGAA
ATTGTGATTCAAATGAATAAAATCTCAACAAATATTTGATACAATTTATG
TATAATAAGCACCCATCTCCATTTGCTCACATAAATATACAAATGCGCGC
AAATATAGGATTGCCATAAATAATAAAACGGTTTGAGCTAAATTAACAGC
AAGTGGAGGATTCCGAATCAGTGACATTGAATTAGTTCAGGATCTTTTAA
CTTTTGGTTTCTTCAC
back to top

protein sequence of SMED30028787-orf-1

>SMED30028787-orf-1 ID=SMED30028787-orf-1|Name=SMED30028787-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=271bp
METNEMENLEKIEQLNEEMVALKDDNRRLRSEMETNVQSINSMRQQIEMT
ETKCQQQIGELKQNYQQQQQQLNNEMEMLCRKIDKMSEQKADGASRVDNN
DGETFTWIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDK
FIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYG
VTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDA
FVNGNDQLLIKCRVEEEHNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001817regulation of cytokine production
GO:0006470protein dephosphorylation
GO:0007165signal transduction
GO:0008063Toll signaling pathway
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0045087innate immune response
GO:0050688regulation of defense response to virus
GO:0016567protein ubiquitination
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 1..157
e-value: 1.5E-23
score: 85.2
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 21..152
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 6..130
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 6..130
NoneNo IPR availableCOILSCoilCoilcoord: 12..32
NoneNo IPR availableCOILSCoilCoilcoord: 51..89