COMM domain-containing protein 7-like

Overview
NameCOMM domain-containing protein 7-like
Smed IDSMED30028786
Length (bp)484
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of COMM domain-containing protein 7-like (SMED30028786) t-SNE clustered cells

Violin plots show distribution of expression levels for COMM domain-containing protein 7-like (SMED30028786) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of COMM domain-containing protein 7-like (SMED30028786) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for COMM domain-containing protein 7-like (SMED30028786) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028786

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30028786SMESG000037684.1 dd_Smed_v4_3552_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of COMM domain-containing protein 7-like vs. Ensembl Human
Match: COMMD7 (COMM domain containing 7 [Source:HGNC Symbol;Acc:HGNC:16223])

HSP 1 Score: 63.5438 bits (153), Expect = 1.737e-12
Identity = 31/65 (47.69%), Postives = 47/65 (72.31%), Query Frame = 3
Query:  186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380
            L+ ++WK  VT+ SSE +K G+ F+QL L VK   N+  + ++ELTLPQFY+FL+EME+ +  M+
Sbjct:  133 LIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKG-NQTENVYIELTLPQFYSFLHEMERVRTSME 196          
BLAST of COMM domain-containing protein 7-like vs. Ensembl Human
Match: COMMD7 (COMM domain containing 7 [Source:HGNC Symbol;Acc:HGNC:16223])

HSP 1 Score: 63.5438 bits (153), Expect = 1.876e-12
Identity = 31/65 (47.69%), Postives = 47/65 (72.31%), Query Frame = 3
Query:  186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380
            L+ ++WK  VT+ SSE +K G+ F+QL L VK   N+  + ++ELTLPQFY+FL+EME+ +  M+
Sbjct:  134 LIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKG-NQTENVYIELTLPQFYSFLHEMERVRTSME 197          
BLAST of COMM domain-containing protein 7-like vs. Ensembl Zebrafish
Match: commd7 (COMM domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-040801-96])

HSP 1 Score: 71.633 bits (174), Expect = 1.214e-15
Identity = 38/81 (46.91%), Postives = 55/81 (67.90%), Query Frame = 3
Query:  144 YPCIS-LLLNFNIMV--LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEM 377
            YP ++ L +   +MV  L+ ++WK  VT  +SE+ K+GN F+QL L ++   N   + +MELTLPQFYNFL+EME+AK  M
Sbjct:  117 YPVLARLAVGQTLMVNQLVDMEWKFGVTVGTSEQQKTGNIFLQLKLVIRKG-NTTENVYMELTLPQFYNFLHEMERAKASM 196          
BLAST of COMM domain-containing protein 7-like vs. Ensembl Zebrafish
Match: commd7 (COMM domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-040801-96])

HSP 1 Score: 71.633 bits (174), Expect = 1.214e-15
Identity = 38/81 (46.91%), Postives = 55/81 (67.90%), Query Frame = 3
Query:  144 YPCIS-LLLNFNIMV--LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEM 377
            YP ++ L +   +MV  L+ ++WK  VT  +SE+ K+GN F+QL L ++   N   + +MELTLPQFYNFL+EME+AK  M
Sbjct:  117 YPVLARLAVGQTLMVNQLVDMEWKFGVTVGTSEQQKTGNIFLQLKLVIRKG-NTTENVYMELTLPQFYNFLHEMERAKASM 196          
BLAST of COMM domain-containing protein 7-like vs. Ensembl Mouse
Match: Commd7 (COMM domain containing 7 [Source:MGI Symbol;Acc:MGI:1914197])

HSP 1 Score: 62.3882 bits (150), Expect = 1.121e-12
Identity = 32/70 (45.71%), Postives = 48/70 (68.57%), Query Frame = 3
Query:  186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK*YKCL 395
            L+ ++W+  VT+ SSE +K G+ F+QL L VK    +  + +MELTLPQFY+FL+EME+ +  M   +CL
Sbjct:   63 LIDMEWRFGVTSGSSELEKVGSIFLQLKLVVKKG-KQTENLYMELTLPQFYSFLHEMERVRASM---ECL 128          
BLAST of COMM domain-containing protein 7-like vs. Ensembl Mouse
Match: Commd7 (COMM domain containing 7 [Source:MGI Symbol;Acc:MGI:1914197])

HSP 1 Score: 62.003 bits (149), Expect = 4.492e-12
Identity = 32/70 (45.71%), Postives = 48/70 (68.57%), Query Frame = 3
Query:  186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK*YKCL 395
            L+ ++W+  VT+ SSE +K G+ F+QL L VK    +  + +MELTLPQFY+FL+EME+ +  M   +CL
Sbjct:  134 LIDMEWRFGVTSGSSELEKVGSIFLQLKLVVKKG-KQTENLYMELTLPQFYSFLHEMERVRASM---ECL 199          
BLAST of COMM domain-containing protein 7-like vs. UniProt/SwissProt
Match: sp|Q86VX2|COMD7_HUMAN (COMM domain-containing protein 7 OS=Homo sapiens OX=9606 GN=COMMD7 PE=1 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 9.010e-12
Identity = 31/65 (47.69%), Postives = 47/65 (72.31%), Query Frame = 3
Query:  186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380
            L+ ++WK  VT+ SSE +K G+ F+QL L VK   N+  + ++ELTLPQFY+FL+EME+ +  M+
Sbjct:  134 LIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKG-NQTENVYIELTLPQFYSFLHEMERVRTSME 197          
BLAST of COMM domain-containing protein 7-like vs. UniProt/SwissProt
Match: sp|Q3MHX1|COMD7_BOVIN (COMM domain-containing protein 7 OS=Bos taurus OX=9913 GN=COMMD7 PE=2 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.179e-11
Identity = 31/65 (47.69%), Postives = 47/65 (72.31%), Query Frame = 3
Query:  186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380
            L+ ++WK  VT+ SSE +K G+ F+QL L VK   N+  + ++ELTLPQFY+FL+EME+ +  M+
Sbjct:  134 LVDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKG-NQTENVYIELTLPQFYSFLHEMERVRTSME 197          
BLAST of COMM domain-containing protein 7-like vs. UniProt/SwissProt
Match: sp|Q8BG94|COMD7_MOUSE (COMM domain-containing protein 7 OS=Mus musculus OX=10090 GN=Commd7 PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 3.142e-11
Identity = 32/70 (45.71%), Postives = 48/70 (68.57%), Query Frame = 3
Query:  186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK*YKCL 395
            L+ ++W+  VT+ SSE +K G+ F+QL L VK    +  + +MELTLPQFY+FL+EME+ +  M   +CL
Sbjct:  134 LIDMEWRFGVTSGSSELEKVGSIFLQLKLVVKKG-KQTENLYMELTLPQFYSFLHEMERVRASM---ECL 199          
BLAST of COMM domain-containing protein 7-like vs. UniProt/SwissProt
Match: sp|Q86I14|COMD7_DICDI (COMM domain-containing protein 7 OS=Dictyostelium discoideum OX=44689 GN=commd7 PE=4 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 2.449e-8
Identity = 32/71 (45.07%), Postives = 43/71 (60.56%), Query Frame = 3
Query:  177 IMVLLAVDWKLMVTAASSEEDKS---GNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380
            I  +L + W+  VT +SSE  KS   G+TF+QL L +   +N      MELTLPQFY FL EM+ AK  ++
Sbjct:  136 INQVLDMQWRFGVTTSSSEFTKSNTTGSTFLQLKLVLDKGNNIKEDVHMELTLPQFYEFLKEMQSAKASLE 206          
BLAST of COMM domain-containing protein 7-like vs. UniProt/SwissProt
Match: sp|Q54MA5|COMD6_DICDI (COMM domain-containing protein 6 OS=Dictyostelium discoideum OX=44689 GN=commd6 PE=4 SV=2)

HSP 1 Score: 46.9802 bits (110), Expect = 1.723e-6
Identity = 22/61 (36.07%), Postives = 39/61 (63.93%), Query Frame = 3
Query:  171 FNIMVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYE 353
            FN+  L+   WKL V+ AS+   +    F+ + +KV ++++++TSH  ELT+P+F NF  +
Sbjct:    5 FNVGKLVDFQWKLGVSIASNHSSQLNTPFITVFVKVLDSNSEVTSHSFELTIPEFKNFAQQ 65          
BLAST of COMM domain-containing protein 7-like vs. TrEMBL
Match: A0A210QSC4 (COMM domain-containing protein 7 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11720 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 4.508e-14
Identity = 39/65 (60.00%), Postives = 48/65 (73.85%), Query Frame = 3
Query:  186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380
            LL ++WK  VTA SSE DK GNTF+QL L V N  N   + +MELTLPQFY+FL+EMEKAK  ++
Sbjct:  135 LLDMEWKFGVTAGSSEADKVGNTFLQLKL-VINTGNGTKNTYMELTLPQFYSFLHEMEKAKASLE 198          
BLAST of COMM domain-containing protein 7-like vs. TrEMBL
Match: A0A1S3JFR7 (COMM domain-containing protein 7-like OS=Lingula unguis OX=7574 GN=LOC106172876 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.212e-13
Identity = 39/65 (60.00%), Postives = 50/65 (76.92%), Query Frame = 3
Query:  186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380
            LL ++WK  VTAASSE ++ GNTF+QL L V N  NK  + +MELTLPQFY+FL+EMEKAK  ++
Sbjct:  139 LLDMEWKFGVTAASSELNQVGNTFIQLKLVV-NKGNKTENVYMELTLPQFYSFLHEMEKAKASLE 202          
BLAST of COMM domain-containing protein 7-like vs. TrEMBL
Match: A0A2C9LZ17 (COMM domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106054134 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.401e-13
Identity = 38/65 (58.46%), Postives = 48/65 (73.85%), Query Frame = 3
Query:  186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380
            L+ ++WK  VTA+SSE DK GNTF+QL L V N  N     F+ELTLPQFY+FL+EMEKAK  ++
Sbjct:  135 LVDIEWKFGVTASSSELDKVGNTFLQLKL-VINTGNGTKDVFLELTLPQFYSFLHEMEKAKASLE 198          
BLAST of COMM domain-containing protein 7-like vs. TrEMBL
Match: A0A2T7NUD4 (COMM domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15251 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 4.189e-13
Identity = 39/74 (52.70%), Postives = 55/74 (74.32%), Query Frame = 3
Query:  165 LNFNIMV--LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380
            L+  +MV  L+ ++WK  VTA+SSE D+ GNTF+QL L V N  N + + +MEL+LPQFY+FL+EMEKAK  ++
Sbjct:  126 LDLTLMVNQLVDMEWKFGVTASSSELDRVGNTFLQLKL-VINTGNGMKNVYMELSLPQFYSFLHEMEKAKASLE 198          
BLAST of COMM domain-containing protein 7-like vs. TrEMBL
Match: A0A0B6ZP10 (COMM domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF72921 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 4.977e-13
Identity = 37/65 (56.92%), Postives = 49/65 (75.38%), Query Frame = 3
Query:  186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380
            L+ ++WK  VTA+SSE DK GNTF+QL L V N  N   + F+ELTLPQFY+FL+EMEKA+  ++
Sbjct:  137 LVDIEWKFGVTASSSELDKVGNTFLQLKL-VINTGNGTKNVFLELTLPQFYSFLHEMEKARASLE 200          
BLAST of COMM domain-containing protein 7-like vs. Ensembl Cavefish
Match: commd7 (COMM domain containing 7 [Source:NCBI gene;Acc:103033306])

HSP 1 Score: 69.707 bits (169), Expect = 5.261e-15
Identity = 39/80 (48.75%), Postives = 53/80 (66.25%), Query Frame = 3
Query:  147 PCIS-LLLNFNIMV--LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEM 377
            P +S L +   +MV  L+ ++WK  VT  +SE  K+GN F+QL L V+   N   + FMELTLPQFYNFL+EME+A+  M
Sbjct:  118 PLLSRLAVGQTLMVNQLVDMEWKFGVTVGTSELQKAGNIFLQLKLVVRKG-NSTQNVFMELTLPQFYNFLHEMERARASM 196          
BLAST of COMM domain-containing protein 7-like vs. Ensembl Cavefish
Match: commd7 (COMM domain containing 7 [Source:NCBI gene;Acc:103033306])

HSP 1 Score: 52.373 bits (124), Expect = 1.077e-8
Identity = 33/70 (47.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  177 IMVLLAVDWKLMVTAASSEEDKSGNTF---VQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEM 377
            ++  LAV   LMV      E K G  F   +QL L V+   N   + FMELTLPQFYNFL+EME+A+  M
Sbjct:  117 LLSRLAVGQTLMVNQLVDMEWKFGGKFCSSLQLKLVVRKG-NSTQNVFMELTLPQFYNFLHEMERARASM 185          
BLAST of COMM domain-containing protein 7-like vs. Ensembl Nematostella
Match: EDO37428 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFX4])

HSP 1 Score: 62.7734 bits (151), Expect = 4.616e-13
Identity = 34/66 (51.52%), Postives = 46/66 (69.70%), Query Frame = 3
Query:  171 FNIMVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAK 368
            F +  LL ++WK  VTA+S++    G TF+QL L V +   K  + FME+TLPQFY+FL+EMEKAK
Sbjct:  100 FTVNQLLDMEWKFGVTASSNDMKVVGQTFLQLKLVV-DKGGKHENVFMEMTLPQFYSFLHEMEKAK 164          
BLAST of COMM domain-containing protein 7-like vs. Ensembl Medaka
Match: commd7 (COMM domain containing 7 [Source:NCBI gene;Acc:101158586])

HSP 1 Score: 60.077 bits (144), Expect = 2.407e-11
Identity = 31/65 (47.69%), Postives = 43/65 (66.15%), Query Frame = 3
Query:  186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380
            L+ ++WK  VT  +SE  K G+ F+QL L V    N   + ++ELTLPQFY FL+EME+AK  M+
Sbjct:  132 LVDMEWKFGVTVGTSEIQKVGSIFLQLKL-VTRKGNSTENIYVELTLPQFYKFLHEMERAKASME 195          
BLAST of COMM domain-containing protein 7-like vs. Planmine SMEST
Match: SMESG000037684.1 (SMESG000037684.1)

HSP 1 Score: 135.961 bits (341), Expect = 2.241e-42
Identity = 66/67 (98.51%), Postives = 67/67 (100.00%), Query Frame = 3
Query:  180 MVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380
            MVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITS+FMELTLPQFYNFLYEMEKAKIEMK
Sbjct:    1 MVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSNFMELTLPQFYNFLYEMEKAKIEMK 67          
The following BLAST results are available for this feature:
BLAST of COMM domain-containing protein 7-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
COMMD71.737e-1247.69COMM domain containing 7 [Source:HGNC Symbol;Acc:H... [more]
COMMD71.876e-1247.69COMM domain containing 7 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of COMM domain-containing protein 7-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of COMM domain-containing protein 7-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of COMM domain-containing protein 7-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
commd71.214e-1546.91COMM domain containing 7 [Source:ZFIN;Acc:ZDB-GENE... [more]
commd71.214e-1546.91COMM domain containing 7 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of COMM domain-containing protein 7-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of COMM domain-containing protein 7-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Commd71.121e-1245.71COMM domain containing 7 [Source:MGI Symbol;Acc:MG... [more]
Commd74.492e-1245.71COMM domain containing 7 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of COMM domain-containing protein 7-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86VX2|COMD7_HUMAN9.010e-1247.69COMM domain-containing protein 7 OS=Homo sapiens O... [more]
sp|Q3MHX1|COMD7_BOVIN1.179e-1147.69COMM domain-containing protein 7 OS=Bos taurus OX=... [more]
sp|Q8BG94|COMD7_MOUSE3.142e-1145.71COMM domain-containing protein 7 OS=Mus musculus O... [more]
sp|Q86I14|COMD7_DICDI2.449e-845.07COMM domain-containing protein 7 OS=Dictyostelium ... [more]
sp|Q54MA5|COMD6_DICDI1.723e-636.07COMM domain-containing protein 6 OS=Dictyostelium ... [more]
back to top
BLAST of COMM domain-containing protein 7-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QSC44.508e-1460.00COMM domain-containing protein 7 OS=Mizuhopecten y... [more]
A0A1S3JFR71.212e-1360.00COMM domain-containing protein 7-like OS=Lingula u... [more]
A0A2C9LZ172.401e-1358.46COMM domain-containing protein OS=Biomphalaria gla... [more]
A0A2T7NUD44.189e-1352.70COMM domain-containing protein OS=Pomacea canalicu... [more]
A0A0B6ZP104.977e-1356.92COMM domain-containing protein (Fragment) OS=Arion... [more]
back to top
BLAST of COMM domain-containing protein 7-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
commd75.261e-1548.75COMM domain containing 7 [Source:NCBI gene;Acc:103... [more]
commd71.077e-847.14COMM domain containing 7 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of COMM domain-containing protein 7-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of COMM domain-containing protein 7-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of COMM domain-containing protein 7-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO374284.616e-1351.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of COMM domain-containing protein 7-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
commd72.407e-1147.69COMM domain containing 7 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of COMM domain-containing protein 7-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000037684.12.241e-4298.51SMESG000037684.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028786 ID=SMED30028786|Name=COMM domain-containing protein 7-like|organism=Schmidtea mediterranea sexual|type=transcript|length=484bp
AAACATATATTTTTGGAAAATACTTTGAATTTTAAATTATTCCATTAAAT
ATTGTTATTTTGATACTTGAAATTTTATTTTATTCATATACCTTTTTTTA
ATTTTTGAAATTATTTTTAAAACCTTTATTTGAATAGTAATTATACCCTT
GTATTTCACTTTTACTTAATTTTAATATCATGGTTCTATTAGCAGTTGAT
TGGAAATTAATGGTAACAGCCGCAAGCAGTGAAGAAGATAAATCTGGAAA
TACATTTGTCCAGCTTCATTTAAAAGTAAAAAACAATGATAACAAAATTA
CCAGCCATTTTATGGAATTAACATTGCCTCAATTTTATAATTTCTTATAT
GAAATGGAAAAAGCAAAGATTGAAATGAAATAATATAAATGTTTGATTAA
ATAAAATCTTGATTAGCTTTACAAAAAAAAAAAAAAAAAAAAANAAAAAA
AAAGTACTACTAGTACGTTAGTAACTAACCAACT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017920COMM
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0051059NF-kappaB binding
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0045892negative regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0031410cytoplasmic vesicle
GO:0043231intracellular membrane-bounded organelle
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017920COMM domainPFAMPF07258COMM_domaincoord: 3..66
e-value: 9.5E-14
score: 51.3
IPR017920COMM domainPROSITEPS51269COMMcoord: 2..67
score: 14.147
NoneNo IPR availablePANTHERPTHR16231:SF2COMM DOMAIN-CONTAINING PROTEIN 7coord: 3..67
NoneNo IPR availablePANTHERPTHR16231FAMILY NOT NAMEDcoord: 3..67