COMM domain-containing protein 7-like
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30028786 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 1
Homology
BLAST of COMM domain-containing protein 7-like vs. Ensembl Human
Match: COMMD7 (COMM domain containing 7 [Source:HGNC Symbol;Acc:HGNC:16223]) HSP 1 Score: 63.5438 bits (153), Expect = 1.737e-12 Identity = 31/65 (47.69%), Postives = 47/65 (72.31%), Query Frame = 3 Query: 186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380 L+ ++WK VT+ SSE +K G+ F+QL L VK N+ + ++ELTLPQFY+FL+EME+ + M+ Sbjct: 133 LIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKG-NQTENVYIELTLPQFYSFLHEMERVRTSME 196
BLAST of COMM domain-containing protein 7-like vs. Ensembl Human
Match: COMMD7 (COMM domain containing 7 [Source:HGNC Symbol;Acc:HGNC:16223]) HSP 1 Score: 63.5438 bits (153), Expect = 1.876e-12 Identity = 31/65 (47.69%), Postives = 47/65 (72.31%), Query Frame = 3 Query: 186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380 L+ ++WK VT+ SSE +K G+ F+QL L VK N+ + ++ELTLPQFY+FL+EME+ + M+ Sbjct: 134 LIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKG-NQTENVYIELTLPQFYSFLHEMERVRTSME 197
BLAST of COMM domain-containing protein 7-like vs. Ensembl Zebrafish
Match: commd7 (COMM domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-040801-96]) HSP 1 Score: 71.633 bits (174), Expect = 1.214e-15 Identity = 38/81 (46.91%), Postives = 55/81 (67.90%), Query Frame = 3 Query: 144 YPCIS-LLLNFNIMV--LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEM 377 YP ++ L + +MV L+ ++WK VT +SE+ K+GN F+QL L ++ N + +MELTLPQFYNFL+EME+AK M Sbjct: 117 YPVLARLAVGQTLMVNQLVDMEWKFGVTVGTSEQQKTGNIFLQLKLVIRKG-NTTENVYMELTLPQFYNFLHEMERAKASM 196
BLAST of COMM domain-containing protein 7-like vs. Ensembl Zebrafish
Match: commd7 (COMM domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-040801-96]) HSP 1 Score: 71.633 bits (174), Expect = 1.214e-15 Identity = 38/81 (46.91%), Postives = 55/81 (67.90%), Query Frame = 3 Query: 144 YPCIS-LLLNFNIMV--LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEM 377 YP ++ L + +MV L+ ++WK VT +SE+ K+GN F+QL L ++ N + +MELTLPQFYNFL+EME+AK M Sbjct: 117 YPVLARLAVGQTLMVNQLVDMEWKFGVTVGTSEQQKTGNIFLQLKLVIRKG-NTTENVYMELTLPQFYNFLHEMERAKASM 196
BLAST of COMM domain-containing protein 7-like vs. Ensembl Mouse
Match: Commd7 (COMM domain containing 7 [Source:MGI Symbol;Acc:MGI:1914197]) HSP 1 Score: 62.3882 bits (150), Expect = 1.121e-12 Identity = 32/70 (45.71%), Postives = 48/70 (68.57%), Query Frame = 3 Query: 186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK*YKCL 395 L+ ++W+ VT+ SSE +K G+ F+QL L VK + + +MELTLPQFY+FL+EME+ + M +CL Sbjct: 63 LIDMEWRFGVTSGSSELEKVGSIFLQLKLVVKKG-KQTENLYMELTLPQFYSFLHEMERVRASM---ECL 128
BLAST of COMM domain-containing protein 7-like vs. Ensembl Mouse
Match: Commd7 (COMM domain containing 7 [Source:MGI Symbol;Acc:MGI:1914197]) HSP 1 Score: 62.003 bits (149), Expect = 4.492e-12 Identity = 32/70 (45.71%), Postives = 48/70 (68.57%), Query Frame = 3 Query: 186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK*YKCL 395 L+ ++W+ VT+ SSE +K G+ F+QL L VK + + +MELTLPQFY+FL+EME+ + M +CL Sbjct: 134 LIDMEWRFGVTSGSSELEKVGSIFLQLKLVVKKG-KQTENLYMELTLPQFYSFLHEMERVRASM---ECL 199
BLAST of COMM domain-containing protein 7-like vs. UniProt/SwissProt
Match: sp|Q86VX2|COMD7_HUMAN (COMM domain-containing protein 7 OS=Homo sapiens OX=9606 GN=COMMD7 PE=1 SV=2) HSP 1 Score: 63.5438 bits (153), Expect = 9.010e-12 Identity = 31/65 (47.69%), Postives = 47/65 (72.31%), Query Frame = 3 Query: 186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380 L+ ++WK VT+ SSE +K G+ F+QL L VK N+ + ++ELTLPQFY+FL+EME+ + M+ Sbjct: 134 LIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKG-NQTENVYIELTLPQFYSFLHEMERVRTSME 197
BLAST of COMM domain-containing protein 7-like vs. UniProt/SwissProt
Match: sp|Q3MHX1|COMD7_BOVIN (COMM domain-containing protein 7 OS=Bos taurus OX=9913 GN=COMMD7 PE=2 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 1.179e-11 Identity = 31/65 (47.69%), Postives = 47/65 (72.31%), Query Frame = 3 Query: 186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380 L+ ++WK VT+ SSE +K G+ F+QL L VK N+ + ++ELTLPQFY+FL+EME+ + M+ Sbjct: 134 LVDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKG-NQTENVYIELTLPQFYSFLHEMERVRTSME 197
BLAST of COMM domain-containing protein 7-like vs. UniProt/SwissProt
Match: sp|Q8BG94|COMD7_MOUSE (COMM domain-containing protein 7 OS=Mus musculus OX=10090 GN=Commd7 PE=1 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 3.142e-11 Identity = 32/70 (45.71%), Postives = 48/70 (68.57%), Query Frame = 3 Query: 186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK*YKCL 395 L+ ++W+ VT+ SSE +K G+ F+QL L VK + + +MELTLPQFY+FL+EME+ + M +CL Sbjct: 134 LIDMEWRFGVTSGSSELEKVGSIFLQLKLVVKKG-KQTENLYMELTLPQFYSFLHEMERVRASM---ECL 199
BLAST of COMM domain-containing protein 7-like vs. UniProt/SwissProt
Match: sp|Q86I14|COMD7_DICDI (COMM domain-containing protein 7 OS=Dictyostelium discoideum OX=44689 GN=commd7 PE=4 SV=1) HSP 1 Score: 54.299 bits (129), Expect = 2.449e-8 Identity = 32/71 (45.07%), Postives = 43/71 (60.56%), Query Frame = 3 Query: 177 IMVLLAVDWKLMVTAASSEEDKS---GNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380 I +L + W+ VT +SSE KS G+TF+QL L + +N MELTLPQFY FL EM+ AK ++ Sbjct: 136 INQVLDMQWRFGVTTSSSEFTKSNTTGSTFLQLKLVLDKGNNIKEDVHMELTLPQFYEFLKEMQSAKASLE 206
BLAST of COMM domain-containing protein 7-like vs. UniProt/SwissProt
Match: sp|Q54MA5|COMD6_DICDI (COMM domain-containing protein 6 OS=Dictyostelium discoideum OX=44689 GN=commd6 PE=4 SV=2) HSP 1 Score: 46.9802 bits (110), Expect = 1.723e-6 Identity = 22/61 (36.07%), Postives = 39/61 (63.93%), Query Frame = 3 Query: 171 FNIMVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYE 353 FN+ L+ WKL V+ AS+ + F+ + +KV ++++++TSH ELT+P+F NF + Sbjct: 5 FNVGKLVDFQWKLGVSIASNHSSQLNTPFITVFVKVLDSNSEVTSHSFELTIPEFKNFAQQ 65
BLAST of COMM domain-containing protein 7-like vs. TrEMBL
Match: A0A210QSC4 (COMM domain-containing protein 7 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11720 PE=4 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 4.508e-14 Identity = 39/65 (60.00%), Postives = 48/65 (73.85%), Query Frame = 3 Query: 186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380 LL ++WK VTA SSE DK GNTF+QL L V N N + +MELTLPQFY+FL+EMEKAK ++ Sbjct: 135 LLDMEWKFGVTAGSSEADKVGNTFLQLKL-VINTGNGTKNTYMELTLPQFYSFLHEMEKAKASLE 198
BLAST of COMM domain-containing protein 7-like vs. TrEMBL
Match: A0A1S3JFR7 (COMM domain-containing protein 7-like OS=Lingula unguis OX=7574 GN=LOC106172876 PE=4 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 1.212e-13 Identity = 39/65 (60.00%), Postives = 50/65 (76.92%), Query Frame = 3 Query: 186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380 LL ++WK VTAASSE ++ GNTF+QL L V N NK + +MELTLPQFY+FL+EMEKAK ++ Sbjct: 139 LLDMEWKFGVTAASSELNQVGNTFIQLKLVV-NKGNKTENVYMELTLPQFYSFLHEMEKAKASLE 202
BLAST of COMM domain-containing protein 7-like vs. TrEMBL
Match: A0A2C9LZ17 (COMM domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106054134 PE=4 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.401e-13 Identity = 38/65 (58.46%), Postives = 48/65 (73.85%), Query Frame = 3 Query: 186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380 L+ ++WK VTA+SSE DK GNTF+QL L V N N F+ELTLPQFY+FL+EMEKAK ++ Sbjct: 135 LVDIEWKFGVTASSSELDKVGNTFLQLKL-VINTGNGTKDVFLELTLPQFYSFLHEMEKAKASLE 198
BLAST of COMM domain-containing protein 7-like vs. TrEMBL
Match: A0A2T7NUD4 (COMM domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15251 PE=4 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 4.189e-13 Identity = 39/74 (52.70%), Postives = 55/74 (74.32%), Query Frame = 3 Query: 165 LNFNIMV--LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380 L+ +MV L+ ++WK VTA+SSE D+ GNTF+QL L V N N + + +MEL+LPQFY+FL+EMEKAK ++ Sbjct: 126 LDLTLMVNQLVDMEWKFGVTASSSELDRVGNTFLQLKL-VINTGNGMKNVYMELSLPQFYSFLHEMEKAKASLE 198
BLAST of COMM domain-containing protein 7-like vs. TrEMBL
Match: A0A0B6ZP10 (COMM domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF72921 PE=4 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 4.977e-13 Identity = 37/65 (56.92%), Postives = 49/65 (75.38%), Query Frame = 3 Query: 186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380 L+ ++WK VTA+SSE DK GNTF+QL L V N N + F+ELTLPQFY+FL+EMEKA+ ++ Sbjct: 137 LVDIEWKFGVTASSSELDKVGNTFLQLKL-VINTGNGTKNVFLELTLPQFYSFLHEMEKARASLE 200
BLAST of COMM domain-containing protein 7-like vs. Ensembl Cavefish
Match: commd7 (COMM domain containing 7 [Source:NCBI gene;Acc:103033306]) HSP 1 Score: 69.707 bits (169), Expect = 5.261e-15 Identity = 39/80 (48.75%), Postives = 53/80 (66.25%), Query Frame = 3 Query: 147 PCIS-LLLNFNIMV--LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEM 377 P +S L + +MV L+ ++WK VT +SE K+GN F+QL L V+ N + FMELTLPQFYNFL+EME+A+ M Sbjct: 118 PLLSRLAVGQTLMVNQLVDMEWKFGVTVGTSELQKAGNIFLQLKLVVRKG-NSTQNVFMELTLPQFYNFLHEMERARASM 196
BLAST of COMM domain-containing protein 7-like vs. Ensembl Cavefish
Match: commd7 (COMM domain containing 7 [Source:NCBI gene;Acc:103033306]) HSP 1 Score: 52.373 bits (124), Expect = 1.077e-8 Identity = 33/70 (47.14%), Postives = 41/70 (58.57%), Query Frame = 3 Query: 177 IMVLLAVDWKLMVTAASSEEDKSGNTF---VQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEM 377 ++ LAV LMV E K G F +QL L V+ N + FMELTLPQFYNFL+EME+A+ M Sbjct: 117 LLSRLAVGQTLMVNQLVDMEWKFGGKFCSSLQLKLVVRKG-NSTQNVFMELTLPQFYNFLHEMERARASM 185
BLAST of COMM domain-containing protein 7-like vs. Ensembl Nematostella
Match: EDO37428 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFX4]) HSP 1 Score: 62.7734 bits (151), Expect = 4.616e-13 Identity = 34/66 (51.52%), Postives = 46/66 (69.70%), Query Frame = 3 Query: 171 FNIMVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAK 368 F + LL ++WK VTA+S++ G TF+QL L V + K + FME+TLPQFY+FL+EMEKAK Sbjct: 100 FTVNQLLDMEWKFGVTASSNDMKVVGQTFLQLKLVV-DKGGKHENVFMEMTLPQFYSFLHEMEKAK 164
BLAST of COMM domain-containing protein 7-like vs. Ensembl Medaka
Match: commd7 (COMM domain containing 7 [Source:NCBI gene;Acc:101158586]) HSP 1 Score: 60.077 bits (144), Expect = 2.407e-11 Identity = 31/65 (47.69%), Postives = 43/65 (66.15%), Query Frame = 3 Query: 186 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380 L+ ++WK VT +SE K G+ F+QL L V N + ++ELTLPQFY FL+EME+AK M+ Sbjct: 132 LVDMEWKFGVTVGTSEIQKVGSIFLQLKL-VTRKGNSTENIYVELTLPQFYKFLHEMERAKASME 195
BLAST of COMM domain-containing protein 7-like vs. Planmine SMEST
Match: SMESG000037684.1 (SMESG000037684.1) HSP 1 Score: 135.961 bits (341), Expect = 2.241e-42 Identity = 66/67 (98.51%), Postives = 67/67 (100.00%), Query Frame = 3 Query: 180 MVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSHFMELTLPQFYNFLYEMEKAKIEMK 380 MVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITS+FMELTLPQFYNFLYEMEKAKIEMK Sbjct: 1 MVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSNFMELTLPQFYNFLYEMEKAKIEMK 67 The following BLAST results are available for this feature:
BLAST of COMM domain-containing protein 7-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 2
BLAST of COMM domain-containing protein 7-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of COMM domain-containing protein 7-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of COMM domain-containing protein 7-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 2
BLAST of COMM domain-containing protein 7-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of COMM domain-containing protein 7-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 2
BLAST of COMM domain-containing protein 7-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 5
BLAST of COMM domain-containing protein 7-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of COMM domain-containing protein 7-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 2
BLAST of COMM domain-containing protein 7-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of COMM domain-containing protein 7-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of COMM domain-containing protein 7-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 1
BLAST of COMM domain-containing protein 7-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 1
BLAST of COMM domain-containing protein 7-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 1
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30028786 ID=SMED30028786|Name=COMM domain-containing protein 7-like|organism=Schmidtea mediterranea sexual|type=transcript|length=484bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|