Protein unc-79 homolog

Overview
NameProtein unc-79 homolog
Smed IDSMED30028777
Length (bp)7667
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein unc-79 homolog (SMED30028777) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein unc-79 homolog (SMED30028777) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein unc-79 homolog (SMED30028777) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein unc-79 homolog (SMED30028777) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028777

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30028777SMESG000053097.1 dd_Smed_v4_6600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028777SMESG000053097.1 dd_Smed_v4_6600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028777SMESG000053097.1 dd_Smed_v4_6600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30028777SMESG000053097.1 dd_Smed_v4_6600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30028777SMESG000053097.1 dd_Smed_v4_6600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028777SMESG000053097.1 dd_Smed_v4_6600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028777SMESG000053097.1 dd_Smed_v4_6600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028777SMESG000053097.1 dd_Smed_v4_6600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028777SMESG000053097.1 Contig40727uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028777SMESG000053097.1 Contig40727newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30028777SMESG000053097.1 dd_Smed_v4_6600_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein unc-79 homolog vs. Ensembl Human
Match: UNC79 (unc-79 homolog, NALCN channel complex subunit [Source:HGNC Symbol;Acc:HGNC:19966])

HSP 1 Score: 372.089 bits (954), Expect = 1.150e-102
Identity = 289/895 (32.29%), Postives = 444/895 (49.61%), Query Frame = 1
Query: 5083 EESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAED-KEKSEDEMDLFDDKPNYRQRKARKSGLTSVE----------IQKILDTKD-DPGRR------RPRRSEFLTT------DTTVNSTIGSSSSGTK---------------QPLYHRQV-------------------ESF-------MVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI-VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNG-------LFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            E+ G++   S   ++L+ V         E   +  +++KPD++A  D  T    E  + ED  E+SE ++ +       RQRK RK  +++++          + K+ + KD DP  +       PR S    T      +T+ +S+I       K               QPL  R                     E F       M ++C+ C AILE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   +++VP N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L S L+DF ++L+    + Q+LEGLN KK +      I  ++N+A ++EALP       ++   + W   I+ QF  F  KLP  L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  L++ ++ EL  A+K K  +PD NLLLL+QFI  DAG  +  + I         P       T A E +R ++++ + F++D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+++S               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     +AD + VIL GFP+Q K                           SV+ M SL+HAF+  QLWT+YCE +A   ++ N N +   A+ TA++FW  + P+IL L+  +   V +V  H++++ME L EC S    K+I +W P++Q   K L   LQ RLQ                +G          KWL+   F + + E Q S A   F
Sbjct: 1772 EKPGELMPSSGAKTVLLKVP--------EDAENPTESEKPDTSAESD--TEQNPERKVEEDGAEESEFKIQIVP-----RQRKQRKIAVSAIQREYLDISFNILDKLGEQKDPDPSTKGLSTLEMPRESSSAPTLDAGVPETSSHSSISKQIQPGKRQCNVPTCLNPDLEGQPLRMRGATKSSLLSAPSIVSMFVPAPEEFTDEQPTVMTDKCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGRLASSTTFS--NQAESMMVPGNAAGVAKQFLRCIFHQLAPNGIFPQLFQSTIKDGT-FLRTLASSLMDF-NELSSIAALSQLLEGLNNKKNLPAGGAMIRCLENIATFMEALP-------MDSPSSLW-TTISNQFQTFFAKLPCVLPLKCSLDSSLRIMICLLKIPSTNATRSLLEPFSKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDTNLLLLVQFICADAGTKLAESTILSKQMIASVPGC----GTAAMECVRQYINEVLDFMADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMDIS--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASS-PCLPIPLDAGSHVADHLIVILIGFPEQSKT--------------------------SVLHMCSLFHAFIFAQLWTVYCEQSAVATNLQNQNEFSFTAILTALEFWSRVTPSILQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNIKHLSAGLQLRLQAIQNHVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAASQF 2593          

HSP 2 Score: 369.777 bits (948), Expect = 5.715e-102
Identity = 233/762 (30.58%), Postives = 376/762 (49.34%), Query Frame = 1
Query:  136 TTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNE-------------------------------------------------SYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKL-NNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVY---TWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH---LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVG-SGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            +TK + F +KI+ L+++H+R++  +  +PS  D+  TLKYF  TL SIL  T    N+                                                   G + +D Q+  + +P+  Y  L+  L+ L + +  L + Q  + ++I  T   L+PFL  D L  LP  + S +  FP   H  IIE L T+ +P      +  E   ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P    S          + AW  I C+  EC N  +K  A+KM  DP  ++  G+K PPLY+C +C + ++      L DV+LP  ++   C  K C S    A +TCFS+ C   +G++P+R+C+ CH   H   +GA ++ H+YQ   P I   +C  E   C VEA++SL KE      Q+     E +    +G S +  +LD             A F + D        DD H  +++S +  + +   C P  NT  E L+R+V+ +F WF+ T + +    G                  +EK+K  ++ KW++ V +   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I    W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P +VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    2 STKAEQFASKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRTGKKENQDASNLTVPMTMCLFPVPFPLTPSLRPQVSSINPTVTRSLLYSVLRDAPSERGPQSRDAQL--SDYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLNDDILSTLPYTMISTLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHIECHNAINKP-AVKMCIDPSLSVALGDKPPPLYLCEECSERIAGDHSEWLIDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGAAAETHLYQTSPPPINTRECGAEELVCAVEAVISLLKEAEFHAEQR---EHELNRRRQLGLSSSHHSLDN------------ADFDNKD--------DDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYMMDDEVGS----------------LVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQSVWECIMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVKE 717          

HSP 3 Score: 160.614 bits (405), Expect = 2.587e-38
Identity = 89/256 (34.77%), Postives = 148/256 (57.81%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVAR 3762
            +P+I+ ++L  +  L  H E L + +    + + YI    ++MLI  LW ++ SEFS L+  +VPLL+++ ++  GAD FW I+   F + DW++RF+AVEK+ ++ R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R
Sbjct:  968 EPDILFNMLNCLKILCLHGECLYIARKDHPQFLAYIQ---DHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNR 1220          

HSP 4 Score: 132.88 bits (333), Expect = 6.662e-30
Identity = 79/209 (37.80%), Postives = 110/209 (52.63%), Query Frame = 1
Query: 4075 GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            G    T+HQ +T+L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R ST F+AF++ +A+V+D N ++G  +L   + VL++C+ PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y               I+ +LI IT+NT+    H CK               P A    L  D SN S
Sbjct: 1271 GIDHQTVHQLITVLMKFMAK-DESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQKMRLSTCFNAFIAGIAQVMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYR--------DCDISKILLHLIHITVNTLNAQYHSCK---------------PHATAGPLYSDNSNIS 1455          
BLAST of Protein unc-79 homolog vs. Ensembl Human
Match: UNC79 (unc-79 homolog, NALCN channel complex subunit [Source:HGNC Symbol;Acc:HGNC:19966])

HSP 1 Score: 372.089 bits (954), Expect = 1.150e-102
Identity = 289/895 (32.29%), Postives = 444/895 (49.61%), Query Frame = 1
Query: 5083 EESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAED-KEKSEDEMDLFDDKPNYRQRKARKSGLTSVE----------IQKILDTKD-DPGRR------RPRRSEFLTT------DTTVNSTIGSSSSGTK---------------QPLYHRQV-------------------ESF-------MVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI-VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNG-------LFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            E+ G++   S   ++L+ V         E   +  +++KPD++A  D  T    E  + ED  E+SE ++ +       RQRK RK  +++++          + K+ + KD DP  +       PR S    T      +T+ +S+I       K               QPL  R                     E F       M ++C+ C AILE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   +++VP N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L S L+DF ++L+    + Q+LEGLN KK +      I  ++N+A ++EALP       ++   + W   I+ QF  F  KLP  L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  L++ ++ EL  A+K K  +PD NLLLL+QFI  DAG  +  + I         P       T A E +R ++++ + F++D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+++S               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     +AD + VIL GFP+Q K                           SV+ M SL+HAF+  QLWT+YCE +A   ++ N N +   A+ TA++FW  + P+IL L+  +   V +V  H++++ME L EC S    K+I +W P++Q   K L   LQ RLQ                +G          KWL+   F + + E Q S A   F
Sbjct: 1772 EKPGELMPSSGAKTVLLKVP--------EDAENPTESEKPDTSAESD--TEQNPERKVEEDGAEESEFKIQIVP-----RQRKQRKIAVSAIQREYLDISFNILDKLGEQKDPDPSTKGLSTLEMPRESSSAPTLDAGVPETSSHSSISKQIQPGKRQCNVPTCLNPDLEGQPLRMRGATKSSLLSAPSIVSMFVPAPEEFTDEQPTVMTDKCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGRLASSTTFS--NQAESMMVPGNAAGVAKQFLRCIFHQLAPNGIFPQLFQSTIKDGT-FLRTLASSLMDF-NELSSIAALSQLLEGLNNKKNLPAGGAMIRCLENIATFMEALP-------MDSPSSLW-TTISNQFQTFFAKLPCVLPLKCSLDSSLRIMICLLKIPSTNATRSLLEPFSKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDTNLLLLVQFICADAGTKLAESTILSKQMIASVPGC----GTAAMECVRQYINEVLDFMADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMDIS--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASS-PCLPIPLDAGSHVADHLIVILIGFPEQSKT--------------------------SVLHMCSLFHAFIFAQLWTVYCEQSAVATNLQNQNEFSFTAILTALEFWSRVTPSILQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNIKHLSAGLQLRLQAIQNHVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAASQF 2593          

HSP 2 Score: 369.777 bits (948), Expect = 5.715e-102
Identity = 233/762 (30.58%), Postives = 376/762 (49.34%), Query Frame = 1
Query:  136 TTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNE-------------------------------------------------SYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKL-NNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVY---TWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH---LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVG-SGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            +TK + F +KI+ L+++H+R++  +  +PS  D+  TLKYF  TL SIL  T    N+                                                   G + +D Q+  + +P+  Y  L+  L+ L + +  L + Q  + ++I  T   L+PFL  D L  LP  + S +  FP   H  IIE L T+ +P      +  E   ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P    S          + AW  I C+  EC N  +K  A+KM  DP  ++  G+K PPLY+C +C + ++      L DV+LP  ++   C  K C S    A +TCFS+ C   +G++P+R+C+ CH   H   +GA ++ H+YQ   P I   +C  E   C VEA++SL KE      Q+     E +    +G S +  +LD             A F + D        DD H  +++S +  + +   C P  NT  E L+R+V+ +F WF+ T + +    G                  +EK+K  ++ KW++ V +   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I    W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P +VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    2 STKAEQFASKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRTGKKENQDASNLTVPMTMCLFPVPFPLTPSLRPQVSSINPTVTRSLLYSVLRDAPSERGPQSRDAQL--SDYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLNDDILSTLPYTMISTLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHIECHNAINKP-AVKMCIDPSLSVALGDKPPPLYLCEECSERIAGDHSEWLIDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGAAAETHLYQTSPPPINTRECGAEELVCAVEAVISLLKEAEFHAEQR---EHELNRRRQLGLSSSHHSLDN------------ADFDNKD--------DDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYMMDDEVGS----------------LVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQSVWECIMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVKE 717          

HSP 3 Score: 160.614 bits (405), Expect = 2.587e-38
Identity = 89/256 (34.77%), Postives = 148/256 (57.81%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVAR 3762
            +P+I+ ++L  +  L  H E L + +    + + YI    ++MLI  LW ++ SEFS L+  +VPLL+++ ++  GAD FW I+   F + DW++RF+AVEK+ ++ R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R
Sbjct:  968 EPDILFNMLNCLKILCLHGECLYIARKDHPQFLAYIQ---DHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNR 1220          

HSP 4 Score: 132.88 bits (333), Expect = 6.662e-30
Identity = 79/209 (37.80%), Postives = 110/209 (52.63%), Query Frame = 1
Query: 4075 GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            G    T+HQ +T+L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R ST F+AF++ +A+V+D N ++G  +L   + VL++C+ PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y               I+ +LI IT+NT+    H CK               P A    L  D SN S
Sbjct: 1271 GIDHQTVHQLITVLMKFMAK-DESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQKMRLSTCFNAFIAGIAQVMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYR--------DCDISKILLHLIHITVNTLNAQYHSCK---------------PHATAGPLYSDNSNIS 1455          
BLAST of Protein unc-79 homolog vs. Ensembl Human
Match: UNC79 (unc-79 homolog, NALCN channel complex subunit [Source:HGNC Symbol;Acc:HGNC:19966])

HSP 1 Score: 371.703 bits (953), Expect = 1.409e-102
Identity = 256/735 (34.83%), Postives = 390/735 (53.06%), Query Frame = 1
Query: 5374 DTKDDPGRRR-PRRSEFLTTDTTVNSTIGSSSSGT-KQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI-VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNG-------LFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            D +  P R R   +S  L+  + V+  + +    T +QP       + M ++C+ C AILE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   +++VP N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L S L+DF ++L+    + Q+LEGLN KK +      I  ++N+A ++EALP       ++   + W   I+ QF  F  KLP  L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  L++ ++ EL  A+K K  +PD NLLLL+QFI  DAG  +  + I         P       T A E +R ++++ + F++D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+++S               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     +AD + VIL GFP+Q K                           SV+ M SL+HAF+  QLWT+YCE +A   ++ N N +   A+ TA++FW  + P+IL L+  +   V +V  H++++ME L EC S    K+I +W P++Q   K L   LQ RLQ                +G          KWL+   F + + E Q S A   F
Sbjct: 1786 DLEGQPLRMRGATKSSLLSAPSIVSMFVPAPEEFTDEQP-------TVMTDKCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGRLASSTTFS--NQAESMMVPGNAAGVAKQFLRCIFHQLAPNGIFPQLFQSTIKDGT-FLRTLASSLMDF-NELSSIAALSQLLEGLNNKKNLPAGGAMIRCLENIATFMEALP-------MDSPSSLW-TTISNQFQTFFAKLPCVLPLKCSLDSSLRIMICLLKIPSTNATRSLLEPFSKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDTNLLLLVQFICADAGTKLAESTILSKQMIASVPGC----GTAAMECVRQYINEVLDFMADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMDIS--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASS-PCLPIPLDAGSHVADHLIVILIGFPEQSKT--------------------------SVLHMCSLFHAFIFAQLWTVYCEQSAVATNLQNQNEFSFTAILTALEFWSRVTPSILQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNIKHLSAGLQLRLQAIQNHVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAASQF 2455          

HSP 2 Score: 320.857 bits (821), Expect = 5.475e-87
Identity = 190/584 (32.53%), Postives = 304/584 (52.05%), Query Frame = 1
Query:  520 VTSCINFFPSSQHAAIIELLCTAVIPFVY---TWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH---LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVG-SGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            + S +  FP   H  IIE L T+ +P      +  E   ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P    S          + AW  I C+  EC N  +K  A+KM  DP  ++  G+K PPLY+C +C + ++      L DV+LP  ++   C  K C S    A +TCFS+ C   +G++P+R+C+ CH   H   +GA ++ H+YQ   P I   +C  E   C VEA++SL KE      Q+     E +    +G S +  +LD             A F + D        DD H  +++S +  + +   C P  NT  E L+R+V+ +F WF+ T + +    G                  +EK+K  ++ KW++ V +   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I    W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P +VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    1 MISTLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHIECHNAINKP-AVKMCIDPSLSVALGDKPPPLYLCEECSERIAGDHSEWLIDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGAAAETHLYQTSPPPINTRECGAEELVCAVEAVISLLKEAEFHAEQR---EHELNRRRQLGLSSSHHSLDN------------ADFDNKD--------DDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYMMDDEVGS----------------LVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQSVWECIMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVKE 540          

HSP 3 Score: 160.614 bits (405), Expect = 2.467e-38
Identity = 89/256 (34.77%), Postives = 148/256 (57.81%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVAR 3762
            +P+I+ ++L  +  L  H E L + +    + + YI    ++MLI  LW ++ SEFS L+  +VPLL+++ ++  GAD FW I+   F + DW++RF+AVEK+ ++ R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R
Sbjct:  791 EPDILFNMLNCLKILCLHGECLYIARKDHPQFLAYIQ---DHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNR 1043          

HSP 4 Score: 133.265 bits (334), Expect = 5.398e-30
Identity = 79/209 (37.80%), Postives = 110/209 (52.63%), Query Frame = 1
Query: 4075 GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            G    T+HQ +T+L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R ST F+AF++ +A+V+D N ++G  +L   + VL++C+ PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y               I+ +LI IT+NT+    H CK               P A    L  D SN S
Sbjct: 1094 GIDHQTVHQLITVLMKFMAK-DESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQKMRLSTCFNAFIAGIAQVMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYR--------DCDISKILLHLIHITVNTLNAQYHSCK---------------PHATAGPLYSDNSNIS 1278          
BLAST of Protein unc-79 homolog vs. Ensembl Human
Match: UNC79 (unc-79 homolog, NALCN channel complex subunit [Source:HGNC Symbol;Acc:HGNC:19966])

HSP 1 Score: 371.703 bits (953), Expect = 1.409e-102
Identity = 256/735 (34.83%), Postives = 390/735 (53.06%), Query Frame = 1
Query: 5374 DTKDDPGRRR-PRRSEFLTTDTTVNSTIGSSSSGT-KQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI-VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNG-------LFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            D +  P R R   +S  L+  + V+  + +    T +QP       + M ++C+ C AILE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   +++VP N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L S L+DF ++L+    + Q+LEGLN KK +      I  ++N+A ++EALP       ++   + W   I+ QF  F  KLP  L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  L++ ++ EL  A+K K  +PD NLLLL+QFI  DAG  +  + I         P       T A E +R ++++ + F++D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+++S               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     +AD + VIL GFP+Q K                           SV+ M SL+HAF+  QLWT+YCE +A   ++ N N +   A+ TA++FW  + P+IL L+  +   V +V  H++++ME L EC S    K+I +W P++Q   K L   LQ RLQ                +G          KWL+   F + + E Q S A   F
Sbjct: 1786 DLEGQPLRMRGATKSSLLSAPSIVSMFVPAPEEFTDEQP-------TVMTDKCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGRLASSTTFS--NQAESMMVPGNAAGVAKQFLRCIFHQLAPNGIFPQLFQSTIKDGT-FLRTLASSLMDF-NELSSIAALSQLLEGLNNKKNLPAGGAMIRCLENIATFMEALP-------MDSPSSLW-TTISNQFQTFFAKLPCVLPLKCSLDSSLRIMICLLKIPSTNATRSLLEPFSKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDTNLLLLVQFICADAGTKLAESTILSKQMIASVPGC----GTAAMECVRQYINEVLDFMADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMDIS--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASS-PCLPIPLDAGSHVADHLIVILIGFPEQSKT--------------------------SVLHMCSLFHAFIFAQLWTVYCEQSAVATNLQNQNEFSFTAILTALEFWSRVTPSILQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNIKHLSAGLQLRLQAIQNHVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAASQF 2455          

HSP 2 Score: 320.857 bits (821), Expect = 5.475e-87
Identity = 190/584 (32.53%), Postives = 304/584 (52.05%), Query Frame = 1
Query:  520 VTSCINFFPSSQHAAIIELLCTAVIPFVY---TWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH---LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVG-SGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            + S +  FP   H  IIE L T+ +P      +  E   ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P    S          + AW  I C+  EC N  +K  A+KM  DP  ++  G+K PPLY+C +C + ++      L DV+LP  ++   C  K C S    A +TCFS+ C   +G++P+R+C+ CH   H   +GA ++ H+YQ   P I   +C  E   C VEA++SL KE      Q+     E +    +G S +  +LD             A F + D        DD H  +++S +  + +   C P  NT  E L+R+V+ +F WF+ T + +    G                  +EK+K  ++ KW++ V +   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I    W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P +VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    1 MISTLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHIECHNAINKP-AVKMCIDPSLSVALGDKPPPLYLCEECSERIAGDHSEWLIDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGAAAETHLYQTSPPPINTRECGAEELVCAVEAVISLLKEAEFHAEQR---EHELNRRRQLGLSSSHHSLDN------------ADFDNKD--------DDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYMMDDEVGS----------------LVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQSVWECIMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVKE 540          

HSP 3 Score: 160.614 bits (405), Expect = 2.467e-38
Identity = 89/256 (34.77%), Postives = 148/256 (57.81%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVAR 3762
            +P+I+ ++L  +  L  H E L + +    + + YI    ++MLI  LW ++ SEFS L+  +VPLL+++ ++  GAD FW I+   F + DW++RF+AVEK+ ++ R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R
Sbjct:  791 EPDILFNMLNCLKILCLHGECLYIARKDHPQFLAYIQ---DHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNR 1043          

HSP 4 Score: 133.265 bits (334), Expect = 5.398e-30
Identity = 79/209 (37.80%), Postives = 110/209 (52.63%), Query Frame = 1
Query: 4075 GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            G    T+HQ +T+L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R ST F+AF++ +A+V+D N ++G  +L   + VL++C+ PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y               I+ +LI IT+NT+    H CK               P A    L  D SN S
Sbjct: 1094 GIDHQTVHQLITVLMKFMAK-DESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQKMRLSTCFNAFIAGIAQVMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYR--------DCDISKILLHLIHITVNTLNAQYHSCK---------------PHATAGPLYSDNSNIS 1278          
BLAST of Protein unc-79 homolog vs. Ensembl Human
Match: UNC79 (unc-79 homolog, NALCN channel complex subunit [Source:HGNC Symbol;Acc:HGNC:19966])

HSP 1 Score: 371.703 bits (953), Expect = 1.409e-102
Identity = 256/735 (34.83%), Postives = 390/735 (53.06%), Query Frame = 1
Query: 5374 DTKDDPGRRR-PRRSEFLTTDTTVNSTIGSSSSGT-KQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI-VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNG-------LFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            D +  P R R   +S  L+  + V+  + +    T +QP       + M ++C+ C AILE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   +++VP N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L S L+DF ++L+    + Q+LEGLN KK +      I  ++N+A ++EALP       ++   + W   I+ QF  F  KLP  L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  L++ ++ EL  A+K K  +PD NLLLL+QFI  DAG  +  + I         P       T A E +R ++++ + F++D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+++S               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     +AD + VIL GFP+Q K                           SV+ M SL+HAF+  QLWT+YCE +A   ++ N N +   A+ TA++FW  + P+IL L+  +   V +V  H++++ME L EC S    K+I +W P++Q   K L   LQ RLQ                +G          KWL+   F + + E Q S A   F
Sbjct: 1786 DLEGQPLRMRGATKSSLLSAPSIVSMFVPAPEEFTDEQP-------TVMTDKCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGRLASSTTFS--NQAESMMVPGNAAGVAKQFLRCIFHQLAPNGIFPQLFQSTIKDGT-FLRTLASSLMDF-NELSSIAALSQLLEGLNNKKNLPAGGAMIRCLENIATFMEALP-------MDSPSSLW-TTISNQFQTFFAKLPCVLPLKCSLDSSLRIMICLLKIPSTNATRSLLEPFSKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDTNLLLLVQFICADAGTKLAESTILSKQMIASVPGC----GTAAMECVRQYINEVLDFMADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMDIS--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASS-PCLPIPLDAGSHVADHLIVILIGFPEQSKT--------------------------SVLHMCSLFHAFIFAQLWTVYCEQSAVATNLQNQNEFSFTAILTALEFWSRVTPSILQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNIKHLSAGLQLRLQAIQNHVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAASQF 2455          

HSP 2 Score: 320.857 bits (821), Expect = 5.475e-87
Identity = 190/584 (32.53%), Postives = 304/584 (52.05%), Query Frame = 1
Query:  520 VTSCINFFPSSQHAAIIELLCTAVIPFVY---TWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH---LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVG-SGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            + S +  FP   H  IIE L T+ +P      +  E   ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P    S          + AW  I C+  EC N  +K  A+KM  DP  ++  G+K PPLY+C +C + ++      L DV+LP  ++   C  K C S    A +TCFS+ C   +G++P+R+C+ CH   H   +GA ++ H+YQ   P I   +C  E   C VEA++SL KE      Q+     E +    +G S +  +LD             A F + D        DD H  +++S +  + +   C P  NT  E L+R+V+ +F WF+ T + +    G                  +EK+K  ++ KW++ V +   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I    W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P +VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    1 MISTLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHIECHNAINKP-AVKMCIDPSLSVALGDKPPPLYLCEECSERIAGDHSEWLIDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGAAAETHLYQTSPPPINTRECGAEELVCAVEAVISLLKEAEFHAEQR---EHELNRRRQLGLSSSHHSLDN------------ADFDNKD--------DDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYMMDDEVGS----------------LVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQSVWECIMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVKE 540          

HSP 3 Score: 160.614 bits (405), Expect = 2.467e-38
Identity = 89/256 (34.77%), Postives = 148/256 (57.81%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVAR 3762
            +P+I+ ++L  +  L  H E L + +    + + YI    ++MLI  LW ++ SEFS L+  +VPLL+++ ++  GAD FW I+   F + DW++RF+AVEK+ ++ R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R
Sbjct:  791 EPDILFNMLNCLKILCLHGECLYIARKDHPQFLAYIQ---DHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNR 1043          

HSP 4 Score: 133.265 bits (334), Expect = 5.398e-30
Identity = 79/209 (37.80%), Postives = 110/209 (52.63%), Query Frame = 1
Query: 4075 GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            G    T+HQ +T+L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R ST F+AF++ +A+V+D N ++G  +L   + VL++C+ PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y               I+ +LI IT+NT+    H CK               P A    L  D SN S
Sbjct: 1094 GIDHQTVHQLITVLMKFMAK-DESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQKMRLSTCFNAFIAGIAQVMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYR--------DCDISKILLHLIHITVNTLNAQYHSCK---------------PHATAGPLYSDNSNIS 1278          
BLAST of Protein unc-79 homolog vs. Ensembl Celegans
Match: unc-79 (Uncoordinated protein 79 [Source:UniProtKB/Swiss-Prot;Acc:P42173])

HSP 1 Score: 279.256 bits (713), Expect = 5.632e-78
Identity = 198/681 (29.07%), Postives = 330/681 (48.46%), Query Frame = 1
Query: 5521 RCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGP-------ILRXXXXXXKSNMISSCKS---LMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAAT 7527
            RC  C+  +E +DEET+ L ++    ++HREP++AAP L+ +L    ++    MY W ++   + VP N  S A+Q LR + ++L  + + +QLF T+I   D F   +   L DF +   ++  IQ ++E L +     P ++ +++ NLA Y+  +P+         M N    ++    + F ++  + +  D  + P       ++ ++  + K    SS KS   L++ FA  L   +     SL  +L +C+   R + +E+ K  +T+ L+ EL  AIKFK+ + + N + +   IL DAG  +E       L   FN        T A+E +R  L + + FI+D+  + K+K+          + D LG  LK  +A+ +A+E+S  S++R           D +   +++F+PW+ S P  TQ  P  F   V  VR L+WLLLG++            SC P+P+   + +AD +  +L+GF DQ K                          QSV+ MS+L+HAF LCQLWT+YCE AA++ S        A    +DFW  + P IL LL+ S     +VN H L  ++ L +  S  + ++ ++W PIL   + Q+P  L+ +L  C           +    L  +WLKK  + + + E Q SAA+
Sbjct:  280 RCGHCNEAIEMFDEETISLCLIALETFLHREPSMAAPILFKILYTVTRLIDTPMYPWHST--EMFVPANSRSVAKQMLRVSLHHLSTSAICLQLFDTKIPRPDAFWSVVALSLADFPELSPVYF-IQILMEDLEESW---PGSVKLIMKNLAFYIVEIPT--------DMYNNPWKDLVGHLETFFKRYHSAISADNGITPTRAEIENVIIVMTHVFKVQTFSSSKSPVTLVEAFARWLSESLHSADVSLESLLGVCTACNRALIRERDKQCITRALVTELMQAIKFKVKLHESNYVTIANMILQDAGEDIE----VPLLDDQFN--------TAASEAIRPFLFEVLDFIADLHVIAKLKKES--------NSDALGGDLKVKLAEAIAVEMS-RSNAR-----------DCRT--VIRFIPWLMSPPSVTQAAPSAFADSVTNVRVLSWLLLGAL--------HANHSCLPVPIECSQHMADYIHFVLAGFADQSK--------------------------QSVVHMSALFHAFHLCQLWTVYCERAATYSSTT------AFAHLVDFWARVTPAILQLLSHSKVLADMVNLHFLNTIQALQQVNSALLCQLYSMWAPILTAYHSQIPNQLRMKLDSC-------QNQPSLEAPLVTEWLKKVRYKISQVELQTSAAS 865          

HSP 2 Score: 103.219 bits (256), Expect = 1.686e-21
Identity = 62/184 (33.70%), Postives = 99/184 (53.80%), Query Frame = 1
Query: 4063 LDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGY--TDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIR---ITINTVENHLHVC 4599
            +D++   R T++  V+L + F++N +     DE  + K  S V RH   LLGY  T++ F IPP +LR + V +AF+S + ++LD N   GN +L     +L    SPQ+ ASD     +SL LL   TR  WL  L+++LYKY ++              + +Y++R   I + T++N +H C
Sbjct:    9 VDMENPERHTVYLVVSLFVTFLSNKN-STPTDEKANAKKQSLVFRHFNTLLGYSSTEKCFTIPPARLRKAAVCNAFISGLPEILDMNLHTGNQLLPTVAQLLIHLPSPQKLASDQNVTNYSLALLTQHTRHLWLQSLILILYKYRFDQL-----------PVSEYIVRLIGIVVKTLQNQVHEC 180          
BLAST of Protein unc-79 homolog vs. Ensembl Celegans
Match: unc-79 (Uncoordinated protein 79 [Source:UniProtKB/Swiss-Prot;Acc:P42173])

HSP 1 Score: 279.256 bits (713), Expect = 5.632e-78
Identity = 198/681 (29.07%), Postives = 330/681 (48.46%), Query Frame = 1
Query: 5521 RCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGP-------ILRXXXXXXKSNMISSCKS---LMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAAT 7527
            RC  C+  +E +DEET+ L ++    ++HREP++AAP L+ +L    ++    MY W ++   + VP N  S A+Q LR + ++L  + + +QLF T+I   D F   +   L DF +   ++  IQ ++E L +     P ++ +++ NLA Y+  +P+         M N    ++    + F ++  + +  D  + P       ++ ++  + K    SS KS   L++ FA  L   +     SL  +L +C+   R + +E+ K  +T+ L+ EL  AIKFK+ + + N + +   IL DAG  +E       L   FN        T A+E +R  L + + FI+D+  + K+K+          + D LG  LK  +A+ +A+E+S  S++R           D +   +++F+PW+ S P  TQ  P  F   V  VR L+WLLLG++            SC P+P+   + +AD +  +L+GF DQ K                          QSV+ MS+L+HAF LCQLWT+YCE AA++ S        A    +DFW  + P IL LL+ S     +VN H L  ++ L +  S  + ++ ++W PIL   + Q+P  L+ +L  C           +    L  +WLKK  + + + E Q SAA+
Sbjct:  280 RCGHCNEAIEMFDEETISLCLIALETFLHREPSMAAPILFKILYTVTRLIDTPMYPWHST--EMFVPANSRSVAKQMLRVSLHHLSTSAICLQLFDTKIPRPDAFWSVVALSLADFPELSPVYF-IQILMEDLEESW---PGSVKLIMKNLAFYIVEIPT--------DMYNNPWKDLVGHLETFFKRYHSAISADNGITPTRAEIENVIIVMTHVFKVQTFSSSKSPVTLVEAFARWLSESLHSADVSLESLLGVCTACNRALIRERDKQCITRALVTELMQAIKFKVKLHESNYVTIANMILQDAGEDIE----VPLLDDQFN--------TAASEAIRPFLFEVLDFIADLHVIAKLKKES--------NSDALGGDLKVKLAEAIAVEMS-RSNAR-----------DCRT--VIRFIPWLMSPPSVTQAAPSAFADSVTNVRVLSWLLLGAL--------HANHSCLPVPIECSQHMADYIHFVLAGFADQSK--------------------------QSVVHMSALFHAFHLCQLWTVYCERAATYSSTT------AFAHLVDFWARVTPAILQLLSHSKVLADMVNLHFLNTIQALQQVNSALLCQLYSMWAPILTAYHSQIPNQLRMKLDSC-------QNQPSLEAPLVTEWLKKVRYKISQVELQTSAAS 865          

HSP 2 Score: 103.219 bits (256), Expect = 1.686e-21
Identity = 62/184 (33.70%), Postives = 99/184 (53.80%), Query Frame = 1
Query: 4063 LDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGY--TDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIR---ITINTVENHLHVC 4599
            +D++   R T++  V+L + F++N +     DE  + K  S V RH   LLGY  T++ F IPP +LR + V +AF+S + ++LD N   GN +L     +L    SPQ+ ASD     +SL LL   TR  WL  L+++LYKY ++              + +Y++R   I + T++N +H C
Sbjct:    9 VDMENPERHTVYLVVSLFVTFLSNKN-STPTDEKANAKKQSLVFRHFNTLLGYSSTEKCFTIPPARLRKAAVCNAFISGLPEILDMNLHTGNQLLPTVAQLLIHLPSPQKLASDQNVTNYSLALLTQHTRHLWLQSLILILYKYRFDQL-----------PVSEYIVRLIGIVVKTLQNQVHEC 180          
BLAST of Protein unc-79 homolog vs. Ensembl Celegans
Match: unc-79 (Uncoordinated protein 79 [Source:UniProtKB/Swiss-Prot;Acc:P42173])

HSP 1 Score: 288.886 bits (738), Expect = 7.341e-78
Identity = 203/719 (28.23%), Postives = 336/719 (46.73%), Query Frame = 1
Query:  130 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQ-SSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQA--RFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETL-----------PRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDS----LCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSM 2232
            MATT+  +F+ KI+ L +F  RL S     PS+ ++  TL+YF  TL   LK+  +    +Y  R      R NL+PN +Y  L+Y ++ L +    + +Q  ++ EAIL T   L+ FLE ++L+ LPL++ S +  FP      I+ LL   V PF    N+E  +Y   S+P +L ++ Q       H W+VES M+  + +++DLL +IA G+ ESRV A  LLF+YWP      F + Q   R   +Y   AW+ + C+ T C   + KT ++K  +DP       +  PP+++C  C + ++ +R V    +  P+     TC  + C+S++  A   C S ECT  + H P+R C  C    H    + KH+       +W  + + Q   VE+IV L +ET            P+W +Q++                     G  SM   I   A               D+ +++S +  +++   C P  + +   +  I+  +F WF  T        G                  +E++K D++  WI   +  +  V ++ L          G C +     + DR   +K+GL ++ +L+PYD+I+ ETW  ++P WLE +  +  E + PEL+IL+ KIF+P   P PF   ++Y F T R            L W+  L+R+ + IP+  +L  F+  ++ +
Sbjct:    1 MATTRAATFSAKIRTLSEFQIRL-STNQQPPSNAEIITTLRYFQQTLIGFLKDFPST-QTNYCERFSSDAARWNLYPNLNYSALYYAIVNLLDVFPLITSQPQAIGEAILDTIKALMIFLERESLEQLPLLLASQLGIFPRELDKQIVHLLADCVFPFAI--NDE--TYVKYSVPGVLMLVLQQTHDPSLHTWIVESAMNCSQGVYQDLLQVIAKGTCESRVAAANLLFHYWP------FPNPQILHRKTIQYRVHAWRTVQCQSTGC---SDKTASVKRCYDPVICADVADTSPPIFLCRKCAEQVTGERKVITQHIAQPMPASNATCQRQECQSQSRLAVTICCSHECTRGHNHVPMRLCMDCSTLVHEEG-TIKHLQHQGSGVVW--STDDQWPTVESIVKLLRETTMFEGNEGEGKKPKWLRQLD---------------------GGTSMGKEIDKMA---------------DERRMLSRFGVWLMAGLCPPNESADPRAIGYIMQNVFEWFSTTALLPNDSMGAS----------------LEQLKTDFVSDWINIGMRVHNAVFISSL---------CGECEEQDGRPVIDR---IKEGLGRLLALMPYDVISLETWSRVMPRWLEAIVNDCTEDNQPELKILLCKIFEPDLCPLPFETKEVYGFMTGRIGGDDYDEMFNALQWIHQLSRLDITIPLNMILEHFNRCLQKL 637          

HSP 2 Score: 278.485 bits (711), Expect = 1.264e-74
Identity = 198/681 (29.07%), Postives = 330/681 (48.46%), Query Frame = 1
Query: 5521 RCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGP-------ILRXXXXXXKSNMISSCKS---LMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAAT 7527
            RC  C+  +E +DEET+ L ++    ++HREP++AAP L+ +L    ++    MY W ++   + VP N  S A+Q LR + ++L  + + +QLF T+I   D F   +   L DF +   ++  IQ ++E L +     P ++ +++ NLA Y+  +P+         M N    ++    + F ++  + +  D  + P       ++ ++  + K    SS KS   L++ FA  L   +     SL  +L +C+   R + +E+ K  +T+ L+ EL  AIKFK+ + + N + +   IL DAG  +E       L   FN        T A+E +R  L + + FI+D+  + K+K+          + D LG  LK  +A+ +A+E+S  S++R           D +   +++F+PW+ S P  TQ  P  F   V  VR L+WLLLG++            SC P+P+   + +AD +  +L+GF DQ K                          QSV+ MS+L+HAF LCQLWT+YCE AA++ S        A    +DFW  + P IL LL+ S     +VN H L  ++ L +  S  + ++ ++W PIL   + Q+P  L+ +L  C           +    L  +WLKK  + + + E Q SAA+
Sbjct: 1502 RCGHCNEAIEMFDEETISLCLIALETFLHREPSMAAPILFKILYTVTRLIDTPMYPWHST--EMFVPANSRSVAKQMLRVSLHHLSTSAICLQLFDTKIPRPDAFWSVVALSLADFPELSPVYF-IQILMEDLEESW---PGSVKLIMKNLAFYIVEIPT--------DMYNNPWKDLVGHLETFFKRYHSAISADNGITPTRAEIENVIIVMTHVFKVQTFSSSKSPVTLVEAFARWLSESLHSADVSLESLLGVCTACNRALIRERDKQCITRALVTELMQAIKFKVKLHESNYVTIANMILQDAGEDIE----VPLLDDQFN--------TAASEAIRPFLFEVLDFIADLHVIAKLKKES--------NSDALGGDLKVKLAEAIAVEMS-RSNAR-----------DCRT--VIRFIPWLMSPPSVTQAAPSAFADSVTNVRVLSWLLLGAL--------HANHSCLPVPIECSQHMADYIHFVLAGFADQSK--------------------------QSVVHMSALFHAFHLCQLWTVYCERAATYSSTT------AFAHLVDFWARVTPAILQLLSHSKVLADMVNLHFLNTIQALQQVNSALLCQLYSMWAPILTAYHSQIPNQLRMKLDSC-------QNQPSLEAPLVTEWLKKVRYKISQVELQTSAAS 2087          

HSP 3 Score: 238.039 bits (606), Expect = 2.878e-62
Identity = 157/537 (29.24%), Postives = 264/537 (49.16%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNL-INKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGY--TDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIR---ITINTVENHLHVC 4599
            +P++   V+ S+ YL  H E L    N   +   ++    EN ++P LW+ + S++  + E +  LL+++ T+  G + FW ++  +FT+  W VRFDAV K  ++A+ +  +    N+ V T LA  F + I +L D N +VA R +  L ++   +L  +  C E QFD  I DR LI+  I  +S  LP +T  ++DFFI RF    +E+Q+ +  + +I  V DL +   +++ ++ +  +AR A+    + RSI                 L Q  G+     H    P N+ +N D S  + +  ++      GR +              E+TD  +         +D++   R T++  V+L + F++N +     DE  + K  S V RH   LLGY  T++ F IPP +LR + V +AF+S + ++LD N   GN +L     +L    SPQ+ ASD     +SL LL   TR  WL  L+++LYKY ++              + +Y++R   I + T++N +H C
Sbjct:  910 EPDVEFFVMSSMKYLCLHCEALS---NARREHRGFLIWTQENQMVPKLWERLRSDYIQVGELATHLLLHAMTLPCGEEMFWKMVHRDFTSPQWNVRFDAVGKAYVMAQMIKTAPVKANKVVQTCLAAVFYHFIASLHDPNPSVAQRAIIALRAMPRHTLKLMCMCFESQFDHCIVDRPLIIHAITMMSILLPDQTTLTFDFFIQRFETLVLESQLSSQTEENI-FVQDLMHTDPMSELYQRKVSKARSAIENASTARSIVRH--------------LKQYDGMKHQLAHLPSDPANVAVNDDVSSPNSSVTANYGHGGYGRLR--------------EFTDEESNMCLLFNRVVDMENPERHTVYLVVSLFVTFLSNKN-STPTDEKANAKKQSLVFRHFNTLLGYSSTEKCFTIPPARLRKAAVCNAFISGLPEILDMNLHTGNQLLPTVAQLLIHLPSPQKLASDQNVTNYSLALLTQHTRHLWLQSLILILYKYRFDQL-----------PVSEYIVRLIGIVVKTLQNQVHEC 1402          
BLAST of Protein unc-79 homolog vs. Ensembl Fly
Match: unc79 (gene:FBgn0038693 transcript:FBtr0301694)

HSP 1 Score: 401.749 bits (1031), Expect = 1.731e-118
Identity = 264/934 (28.27%), Postives = 468/934 (50.11%), Query Frame = 1
Query:  139 TKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLN-NQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTW--NEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPP-LYVCLDCYDALSRQR-IVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVN--QTSTQLDDIDPEAGLTGAX------XXXXXXXXXXXXXXXXCLCMMVKTIDVQLKMNDPHGHGNMSQQXXXXXXXXXXXXXXXCWSSENCKCKHLXXXXXXXXXXXRPLSVGDAS-----QQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKIS 2886
            T+  +F  K++AL ++H RL+  V   PS  D+   +KYF  TL ++LK+    P+E     ++D   R++ +PN  Y  L+  L  L +    +   Q    +A+L+  + ++PFL+ D +D LP +V+S I+  P + H  II  LC  ++PF  T   ++E E  A +S+ S++ ++ Q+ +   +H  ++E  M+ K ++ KD+L ++AYG+  SR  A  LLFYYWP      F   +    SK  ++      C+R  CPN  +   A K+ +D   +I +    PP LY+C++C + + R+   +   D++ P+++V   C++K CRS   +A   CFS+EC S NG+ PIR+C  CH  +H   +   H+    L   W  + E+Q  MVE++VSL +E  P     +NF E    +    S   G+         G+              A   S ++ + +  Y  +++  +C P  +T +E+L RI+S LF+WF+ T ++        Y   G ++        IEK+K D++  W++ +   +  V ++ LLP+P EYA+VG  W++L  RT+ +K+GL ++  L+PY++IT E WDY++P W+E +  ++ E +  EL+I++ KI DP   P  F    +Y F   RF  T   VQ Q L WL ILT++++ IP+ +L  MF  G++ M   I    +   +A   SL    ++      +T A   N  + S+    ++ ++G T AI      +   +  ++D+   L+C  +M+  +  Q+++ D   H  +                          C++++       ++ R   VG +S     +   C  C+  + WHQ+ +K++Q + P++P+  PD  + +E I +  K+  K+  +   E   +++  +S
Sbjct:   14 TRAAAFQAKLRALHEYHVRLLHNVLPAPSGVDIANNIKYFSQTLLTVLKDVRTSPHELIRDPLED-PTRMSAYPNLEYGNLYNALTMLIDVAPCIQYGQIVFGKALLQCLSCILPFLDKDLIDNLPYLVSSTISVLPPALHQCIINALCYYILPFTITRRSSDEQECQACQSVSSVIMMVLQYSNNPAHHCQLLECLMTLKHNVVKDILCVVAYGTAVSRTSAAKLLFYYWPAFNANLF--DRKVLLSKLTND-LVPFTCQREHCPNSGNAEAA-KVCYDHSISIAYAPDCPPPLYLCIECANEIHREHGSLEFGDILHPMQQVSMVCENKNCRSNEKSAFSICFSTECASFNGNHPIRYCSQCHSNRHNSRRGGDHVVHRSLQPAWQMDPEMQMHMVESVVSLLREAKP-----LNF-EPGKESSSSESKKNGS---------GIT-------------ADNISLEERQRLGRYGIWLLVGRCTPTADTPVEVLGRILSMLFHWFHVTAYS--------YDAAGQVEST------IEKLKVDHVCNWLKDICRIHYNVFISCLLPHPPEYARVGGHWETLASRTSHLKEGLQRLICLVPYEVITSEIWDYVMPHWMEAITNDVAEKELNELKIVLSKILDPEMSPLGFDAKTMYNFVAIRFEKTTAKVQQQALHWLQILTKLEILIPLVQLFAMFGDGVRIMKYGIQHELMREKDAQSQSLAKAPKTPCKESKETKADMANPPRRSSISPVVEDDSGNTSAISDDEAPTNRHTEFSTDAEHNLTCCILMLDILLKQMELQDVEQHMGIHTSV----------------------CENVSRLIKCMVTAAR---VGLSSHVCALKVAECAYCEASIMWHQLATKLVQFMAPLNPVRPPD--VPIEDIIEEEKSSRKSPPESDKEKTRDRDVSLS 873          
BLAST of Protein unc-79 homolog vs. Ensembl Fly
Match: unc79 (gene:FBgn0038693 transcript:FBtr0301692)

HSP 1 Score: 404.445 bits (1038), Expect = 7.706e-113
Identity = 265/934 (28.37%), Postives = 469/934 (50.21%), Query Frame = 1
Query:  139 TKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLN-NQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTW--NEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPP-LYVCLDCYDALSRQR-IVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVN--QTSTQLDDIDPEAGLTGAXXXXXXXX------XXXXXXXXXCLCMMVKTIDVQLKMNDPHGHGNMSQQXXXXXXXXXXXXXXXCWSSENCKCKHLXXXXXXXXXXXRPLSVGDAS-----QQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKIS 2886
            T+  +F  K++AL ++H RL+  V   PS  D+   +KYF  TL ++LK+    P+E     ++D   R++ +PN  Y  L+  L  L +    +   Q    +A+L+  + ++PFL+ D +D LP +V+S I+  P + H  II  LC  ++PF  T   ++E E  A +S+ S++ ++ Q+ +   +H  ++E  M+ K ++ KD+L ++AYG+  SR  A  LLFYYWP      F   +    SK  ++      C+R  CPN  +   A K+ +D   +I +    PP LY+C++C + + R+   +   D++ P+++V   C++K CRS   +A   CFS+EC S NG+ PIR+C  CH  +H   +   H+    L   W  + E+Q  MVE++VSL +E  P     +NF E    +    S   G+         G+              A   S ++ + +  Y  +++  +C P  +T +E+L RI+S LF+WF+ T ++        Y   G ++        IEK+K D++  W++ +   +  V ++ LLP+P EYA+VG  W++L  RT+ +K+GL ++  L+PY++IT E WDY++P W+E +  ++ E +  EL+I++ KI DP   P  F    +Y F   RF  T   VQ Q L WL ILT++++ IP+ +L  MF  G++ M   I    +   +A   SL    ++      +T A   N  + S+    ++ ++G T AIS   + +      ++D+   L+C  +M+  +  Q+++ D   H  +                          C++++       ++ R   VG +S     +   C  C+  + WHQ+ +K++Q + P++P+  PD  + +E I +  K+  K+  +   E   +++  +S
Sbjct:   14 TRAAAFQAKLRALHEYHVRLLHNVLPAPSGVDIANNIKYFSQTLLTVLKDVRTSPHELIRDPLED-PTRMSAYPNLEYGNLYNALTMLIDVAPCIQYGQIVFGKALLQCLSCILPFLDKDLIDNLPYLVSSTISVLPPALHQCIINALCYYILPFTITRRSSDEQECQACQSVSSVIMMVLQYSNNPAHHCQLLECLMTLKHNVVKDILCVVAYGTAVSRTSAAKLLFYYWPAFNANLF--DRKVLLSKLTND-LVPFTCQREHCPNSGNAEAA-KVCYDHSISIAYAPDCPPPLYLCIECANEIHREHGSLEFGDILHPMQQVSMVCENKNCRSNEKSAFSICFSTECASFNGNHPIRYCSQCHSNRHNSRRGGDHVVHRSLQPAWQMDPEMQMHMVESVVSLLREAKP-----LNF-EPGKESSSSESKKNGS---------GIT-------------ADNISLEERQRLGRYGIWLLVGRCTPTADTPVEVLGRILSMLFHWFHVTAYS--------YDAAGQVEST------IEKLKVDHVCNWLKDICRIHYNVFISCLLPHPPEYARVGGHWETLASRTSHLKEGLQRLICLVPYEVITSEIWDYVMPHWMEAITNDVAEKELNELKIVLSKILDPEMSPLGFDAKTMYNFVAIRFEKTTAKVQQQALHWLQILTKLEILIPLVQLFAMFGDGVRIMKYGIQHELMREKDAQSQSLAKAPKTPCKESKETKADMANPPRRSSISPVVEDDSGNTSAISDDEAPTNRHTEFSTDAEHNLTCCILMLDILLKQMELQDVEQHMGI----------------------HTSVCENVSRLIKCMVTAAR---VGLSSHVCALKVAECAYCEASIMWHQLATKLVQFMAPLNPVRPPD--VPIEDIIEEEKSSRKSPPESDKEKTRDRDVSLS 873          

HSP 2 Score: 328.946 bits (842), Expect = 1.068e-89
Identity = 229/737 (31.07%), Postives = 373/737 (50.61%), Query Frame = 1
Query: 5494 RQVESF-MVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIEN--NDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQ-FDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCV-----------------TSNGTGISC------------QPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFV----------------------VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            R+V  + +VERC+ C A +E Y +E +G+ IV  G ++HREPA+AAP+L ++L ++++I   + ++W+   +   + ++  + A QF RC  + L PNG+F+Q+FQT+++        + +   L DF+D LN   PI  V E L  KK++  E LP++  N+A YL      ++ V     +   +++ A Q  +  LR++   +   T+   +L I+   ++ N +   K+L+D ++ ++ + V+        + ELC++  R   K++ KNLL + +I E   A+KFK  +PD NLL +I F+L+DAGGT+ P     GL     P    ++ T +A+ +R +++D I F++D  T+ K+K  +    S  L EDTLG  LK A+AQY+ALE+S               G    +  + ++LPW+ + P + QQGP+EF  CV  +R L+WLLLGS+ H  +                  S GTG +             QP+P      IAD ++VI +GF +Q K                           SV+ MSSL+HAF LCQLWT+Y E  A  H+ NSN     +    +FW  + P IL L++ +   V                      +VN H L+++E L +  S  + K++ +W+P+L  +  QL   L  RLQ   ++ P   E     +   +KWL++  F +G+ E Q S AT  +
Sbjct: 2096 RRVGDYTIVERCSDCGAHIEEYTDEEIGIFIVILGTFIHREPAMAAPFLPEILTMTSRICLSSTHAWQGE-NGPPLASSAQAVACQFFRCVLHQLAPNGIFLQVFQTQMKMKIRHHHFRSIAKALQDFQD-LNSTSPIYMVCESLTSKKSLPIEQLPVIFRNMAEYLN-----LQCVPTEAGVGLAVWSQAMQAMESLLRQVIVIMPSLTNAEYMLDIMAATLRLNCVP--KTLLDPYSKIMAYCVQHTNLEYQTLYELCTLNIRSFSKDRDKNLLCRQMIFEFVQALKFKSNIPDHNLLTIIGFVLLDAGGTLPPGA-APGL-----PDAAPMMTTNSADCLRQYINDVIDFLADFHTLSKIKNFKNGQTSSGLGEDTLGGVLKGAVAQYLALEMS--------------RGNSRDNKAVSRYLPWLNNAPSSLQQGPKEFTECVGHMRLLSWLLLGSLTHMALMQRRQETHSIPTPLPQQNSQGTGPAASVHYQHQGVTYSQPVPQEASCHIADHIQVIFAGFAEQSKT--------------------------SVLHMSSLFHAFTLCQLWTVYLEQMA--HNTNSNAEGSTLGVLFEFWAKVTPCILQLVSHAKPTVNKDQPQTPLDFQTQSANSKLSEMVNLHFLSLLEALKDTNSTVLGKLLPMWSPVLSSQT-QLSDTLHVRLQNVRDYAPDYEEQQTYKSEALLKWLQRLQFKMGQIELQASTATQFY 2774          

HSP 3 Score: 276.174 bits (705), Expect = 1.166e-73
Identity = 170/544 (31.25%), Postives = 281/544 (51.65%), Query Frame = 1
Query: 3010 PEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSS------DKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYT--DQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPP---TFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRM 4608
            PEI++ VL  +  +  H + L        ++  +     EN+LI +LW+L  +E S++ +  VPLL++  T+  G+D FW +++  F + DWRVRF AVE++T++ R +D +       + T+LA AFC+LI ++DD+N  VA R   Y+ +I D ++  ++ CLE QFD  I DR ++L  +YQL  +L  R +  W+FF+NRF    +EAQI      DI+ + DL N    ++    + ++AR A++++D+   ++ +              L  S G       +   P ++  +  S      +K Y+RQ SAP   + +RK+          ++    D N   +  +    +L+ S R+T+H  V +L++FM+  D     +E    K  + V +HL LLLG+   D+ F+  P  LR S VF+AFL+N+ +VLD N  +G  IL   + ++ +  +P   + +S       +SLW LE   R +WL  LLVVLYKY Y                V   IR+ +N++  H H C+R+
Sbjct: 1071 PEILYYVLQCLNTMALHGDALA---KAAREQRGFFIWCQENLLIKNLWELCNAEHSHICQVGVPLLLHCITLPLGSDVFWRVVQEAFHDTDWRVRFTAVERVTVITRFMDSTPLRSEVGLQTALATAFCHLIASMDDINVYVAQRATLYIGTIHDTAIRSLLFCLESQFDLFIVDRPVVLQSVYQLHNSLSDRKMLGWEFFLNRFDTLFVEAQINLEKCGDISYLRDLRNSDNGSEALSAKIQKAREALSQSDTSGGMAKT--------------LSASFGTKWPYKRTMSAPASMAPRQDSKFVPEKEKIYSRQVSAP---ILKRKTSRFGLDGHIHSLGGLNDDN--LIGLLSRITELEESDRETIHLLVFMLMQFMSRTDQAYPSEEKPMTKTQNIVLKHLFLLLGHNQIDKTFHTTPESLRVSAVFNAFLANLPQVLDQNHLIGGLILPSVMQIILYAPNPTSTSGESYQNIVFNYSLWHLEQYPRRNWLFTLLVVLYKYSYT--------QPPLSGYVIAGIRLIMNSLRGHFHQCRRI 1584          
BLAST of Protein unc-79 homolog vs. Ensembl Fly
Match: unc79 (gene:FBgn0038693 transcript:FBtr0344553)

HSP 1 Score: 403.675 bits (1036), Expect = 1.203e-112
Identity = 265/934 (28.37%), Postives = 469/934 (50.21%), Query Frame = 1
Query:  139 TKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLN-NQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTW--NEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPP-LYVCLDCYDALSRQR-IVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVN--QTSTQLDDIDPEAGLTGAXXXXXXXX------XXXXXXXXXCLCMMVKTIDVQLKMNDPHGHGNMSQQXXXXXXXXXXXXXXXCWSSENCKCKHLXXXXXXXXXXXRPLSVGDAS-----QQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKIS 2886
            T+  +F  K++AL ++H RL+  V   PS  D+   +KYF  TL ++LK+    P+E     ++D   R++ +PN  Y  L+  L  L +    +   Q    +A+L+  + ++PFL+ D +D LP +V+S I+  P + H  II  LC  ++PF  T   ++E E  A +S+ S++ ++ Q+ +   +H  ++E  M+ K ++ KD+L ++AYG+  SR  A  LLFYYWP      F   +    SK  ++      C+R  CPN  +   A K+ +D   +I +    PP LY+C++C + + R+   +   D++ P+++V   C++K CRS   +A   CFS+EC S NG+ PIR+C  CH  +H   +   H+    L   W  + E+Q  MVE++VSL +E  P     +NF E    +    S   G+         G+              A   S ++ + +  Y  +++  +C P  +T +E+L RI+S LF+WF+ T ++        Y   G ++        IEK+K D++  W++ +   +  V ++ LLP+P EYA+VG  W++L  RT+ +K+GL ++  L+PY++IT E WDY++P W+E +  ++ E +  EL+I++ KI DP   P  F    +Y F   RF  T   VQ Q L WL ILT++++ IP+ +L  MF  G++ M   I    +   +A   SL    ++      +T A   N  + S+    ++ ++G T AIS   + +      ++D+   L+C  +M+  +  Q+++ D   H  +                          C++++       ++ R   VG +S     +   C  C+  + WHQ+ +K++Q + P++P+  PD  + +E I +  K+  K+  +   E   +++  +S
Sbjct:   14 TRAAAFQAKLRALHEYHVRLLHNVLPAPSGVDIANNIKYFSQTLLTVLKDVRTSPHELIRDPLED-PTRMSAYPNLEYGNLYNALTMLIDVAPCIQYGQIVFGKALLQCLSCILPFLDKDLIDNLPYLVSSTISVLPPALHQCIINALCYYILPFTITRRSSDEQECQACQSVSSVIMMVLQYSNNPAHHCQLLECLMTLKHNVVKDILCVVAYGTAVSRTSAAKLLFYYWPAFNANLF--DRKVLLSKLTND-LVPFTCQREHCPNSGNAEAA-KVCYDHSISIAYAPDCPPPLYLCIECANEIHREHGSLEFGDILHPMQQVSMVCENKNCRSNEKSAFSICFSTECASFNGNHPIRYCSQCHSNRHNSRRGGDHVVHRSLQPAWQMDPEMQMHMVESVVSLLREAKP-----LNF-EPGKESSSSESKKNGS---------GIT-------------ADNISLEERQRLGRYGIWLLVGRCTPTADTPVEVLGRILSMLFHWFHVTAYS--------YDAAGQVEST------IEKLKVDHVCNWLKDICRIHYNVFISCLLPHPPEYARVGGHWETLASRTSHLKEGLQRLICLVPYEVITSEIWDYVMPHWMEAITNDVAEKELNELKIVLSKILDPEMSPLGFDAKTMYNFVAIRFEKTTAKVQQQALHWLQILTKLEILIPLVQLFAMFGDGVRIMKYGIQHELMREKDAQSQSLAKAPKTPCKESKETKADMANPPRRSSISPVVEDDSGNTSAISDDEAPTNRHTEFSTDAEHNLTCCILMLDILLKQMELQDVEQHMGI----------------------HTSVCENVSRLIKCMVTAAR---VGLSSHVCALKVAECAYCEASIMWHQLATKLVQFMAPLNPVRPPD--VPIEDIIEEEKSSRKSPPESDKEKTRDRDVSLS 873          

HSP 2 Score: 328.561 bits (841), Expect = 1.311e-89
Identity = 229/737 (31.07%), Postives = 373/737 (50.61%), Query Frame = 1
Query: 5494 RQVESF-MVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIEN--NDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQ-FDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCV-----------------TSNGTGISC------------QPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFV----------------------VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            R+V  + +VERC+ C A +E Y +E +G+ IV  G ++HREPA+AAP+L ++L ++++I   + ++W+   +   + ++  + A QF RC  + L PNG+F+Q+FQT+++        + +   L DF+D LN   PI  V E L  KK++  E LP++  N+A YL      ++ V     +   +++ A Q  +  LR++   +   T+   +L I+   ++ N +   K+L+D ++ ++ + V+        + ELC++  R   K++ KNLL + +I E   A+KFK  +PD NLL +I F+L+DAGGT+ P     GL     P    ++ T +A+ +R +++D I F++D  T+ K+K  +    S  L EDTLG  LK A+AQY+ALE+S               G    +  + ++LPW+ + P + QQGP+EF  CV  +R L+WLLLGS+ H  +                  S GTG +             QP+P      IAD ++VI +GF +Q K                           SV+ MSSL+HAF LCQLWT+Y E  A  H+ NSN     +    +FW  + P IL L++ +   V                      +VN H L+++E L +  S  + K++ +W+P+L  +  QL   L  RLQ   ++ P   E     +   +KWL++  F +G+ E Q S AT  +
Sbjct: 2101 RRVGDYTIVERCSDCGAHIEEYTDEEIGIFIVILGTFIHREPAMAAPFLPEILTMTSRICLSSTHAWQGE-NGPPLASSAQAVACQFFRCVLHQLAPNGIFLQVFQTQMKMKIRHHHFRSIAKALQDFQD-LNSTSPIYMVCESLTSKKSLPIEQLPVIFRNMAEYLN-----LQCVPTEAGVGLAVWSQAMQAMESLLRQVIVIMPSLTNAEYMLDIMAATLRLNCVP--KTLLDPYSKIMAYCVQHTNLEYQTLYELCTLNIRSFSKDRDKNLLCRQMIFEFVQALKFKSNIPDHNLLTIIGFVLLDAGGTLPPGA-APGL-----PDAAPMMTTNSADCLRQYINDVIDFLADFHTLSKIKNFKNGQTSSGLGEDTLGGVLKGAVAQYLALEMS--------------RGNSRDNKAVSRYLPWLNNAPSSLQQGPKEFTECVGHMRLLSWLLLGSLTHMALMQRRQETHSIPTPLPQQNSQGTGPAASVHYQHQGVTYSQPVPQEASCHIADHIQVIFAGFAEQSKT--------------------------SVLHMSSLFHAFTLCQLWTVYLEQMA--HNTNSNAEGSTLGVLFEFWAKVTPCILQLVSHAKPTVNKDQPQTPLDFQTQSANSKLSEMVNLHFLSLLEALKDTNSTVLGKLLPMWSPVLSSQT-QLSDTLHVRLQNVRDYAPDYEEQQTYKSEALLKWLQRLQFKMGQIELQASTATQFY 2779          

HSP 3 Score: 276.174 bits (705), Expect = 1.197e-73
Identity = 170/544 (31.25%), Postives = 281/544 (51.65%), Query Frame = 1
Query: 3010 PEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSS------DKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYT--DQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPP---TFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRM 4608
            PEI++ VL  +  +  H + L        ++  +     EN+LI +LW+L  +E S++ +  VPLL++  T+  G+D FW +++  F + DWRVRF AVE++T++ R +D +       + T+LA AFC+LI ++DD+N  VA R   Y+ +I D ++  ++ CLE QFD  I DR ++L  +YQL  +L  R +  W+FF+NRF    +EAQI      DI+ + DL N    ++    + ++AR A++++D+   ++ +              L  S G       +   P ++  +  S      +K Y+RQ SAP   + +RK+          ++    D N   +  +    +L+ S R+T+H  V +L++FM+  D     +E    K  + V +HL LLLG+   D+ F+  P  LR S VF+AFL+N+ +VLD N  +G  IL   + ++ +  +P   + +S       +SLW LE   R +WL  LLVVLYKY Y                V   IR+ +N++  H H C+R+
Sbjct: 1050 PEILYYVLQCLNTMALHGDALA---KAAREQRGFFIWCQENLLIKNLWELCNAEHSHICQVGVPLLLHCITLPLGSDVFWRVVQEAFHDTDWRVRFTAVERVTVITRFMDSTPLRSEVGLQTALATAFCHLIASMDDINVYVAQRATLYIGTIHDTAIRSLLFCLESQFDLFIVDRPVVLQSVYQLHNSLSDRKMLGWEFFLNRFDTLFVEAQINLEKCGDISYLRDLRNSDNGSEALSAKIQKAREALSQSDTSGGMAKT--------------LSASFGTKWPYKRTMSAPASMAPRQDSKFVPEKEKIYSRQVSAP---ILKRKTSRFGLDGHIHSLGGLNDDN--LIGLLSRITELEESDRETIHLLVFMLMQFMSRTDQAYPSEEKPMTKTQNIVLKHLFLLLGHNQIDKTFHTTPESLRVSAVFNAFLANLPQVLDQNHLIGGLILPSVMQIILYAPNPTSTSGESYQNIVFNYSLWHLEQYPRRNWLFTLLVVLYKYSYT--------QPPLSGYVIAGIRLIMNSLRGHFHQCRRI 1563          
BLAST of Protein unc-79 homolog vs. Ensembl Fly
Match: unc79 (gene:FBgn0038693 transcript:FBtr0344552)

HSP 1 Score: 403.675 bits (1036), Expect = 1.516e-112
Identity = 264/934 (28.27%), Postives = 466/934 (49.89%), Query Frame = 1
Query:  139 TKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLN-NQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTW--NEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPP-LYVCLDCYDALSRQR-IVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVN--QTSTQLDDIDPEAGLTGAXXXXXXXXXXXXXXXX------XCLCMMVKTIDVQLKMNDPHGHGNMSQQXXXXXXXXXXXXXXXCWSSENCKCKHLXXXXXXXXXXXRPLSVGDAS-----QQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKIS 2886
            T+  +F  K++AL ++H RL+  V   PS  D+   +KYF  TL ++LK+    P+E     ++D   R++ +PN  Y  L+  L  L +    +   Q    +A+L+  + ++PFL+ D +D LP +V+S I+  P + H  II  LC  ++PF  T   ++E E  A +S+ S++ ++ Q+ +   +H  ++E  M+ K ++ KD+L ++AYG+  SR  A  LLFYYWP      F   +    SK  ++      C+R  CPN  +   A K+ +D   +I +    PP LY+C++C + + R+   +   D++ P+++V   C++K CRS   +A   CFS+EC S NG+ PIR+C  CH  +H   +   H+    L   W  + E+Q  MVE++VSL +E  P     +NF E    +    S   G+         G+              A   S ++ + +  Y  +++  +C P  +T +E+L RI+S LF+WF+ T ++        Y   G ++        IEK+K D++  W++ +   +  V ++ LLP+P EYA+VG  W++L  RT+ +K+GL ++  L+PY++IT E WDY++P W+E +  ++ E +  EL+I++ KI DP   P  F    +Y F   RF  T   VQ Q L WL ILT++++ IP+ +L  MF  G++ M   I    +   +A   SL    ++      +T A   N  + S+    ++ ++G T AIS   + +N  +          +C  +M+  +  Q+++ D   H  +                          C++++       ++ R   VG +S     +   C  C+  + WHQ+ +K++Q + P++P+  PD  + +E I +  K+  K+  +   E   +++  +S
Sbjct:   14 TRAAAFQAKLRALHEYHVRLLHNVLPAPSGVDIANNIKYFSQTLLTVLKDVRTSPHELIRDPLED-PTRMSAYPNLEYGNLYNALTMLIDVAPCIQYGQIVFGKALLQCLSCILPFLDKDLIDNLPYLVSSTISVLPPALHQCIINALCYYILPFTITRRSSDEQECQACQSVSSVIMMVLQYSNNPAHHCQLLECLMTLKHNVVKDILCVVAYGTAVSRTSAAKLLFYYWPAFNANLF--DRKVLLSKLTND-LVPFTCQREHCPNSGNAEAA-KVCYDHSISIAYAPDCPPPLYLCIECANEIHREHGSLEFGDILHPMQQVSMVCENKNCRSNEKSAFSICFSTECASFNGNHPIRYCSQCHSNRHNSRRGGDHVVHRSLQPAWQMDPEMQMHMVESVVSLLREAKP-----LNF-EPGKESSSSESKKNGS---------GIT-------------ADNISLEERQRLGRYGIWLLVGRCTPTADTPVEVLGRILSMLFHWFHVTAYS--------YDAAGQVEST------IEKLKVDHVCNWLKDICRIHYNVFISCLLPHPPEYARVGGHWETLASRTSHLKEGLQRLICLVPYEVITSEIWDYVMPHWMEAITNDVAEKELNELKIVLSKILDPEMSPLGFDAKTMYNFVAIRFEKTTAKVQQQALHWLQILTKLEILIPLVQLFAMFGDGVRIMKYGIQHELMREKDAQSQSLAKAPKTPCKESKETKADMANPPRRSSISPVVEDDSGNTSAISDDEAPTNRHTEFSTDAEHNLTCCILMLDILLKQMELQDVEQHMGI----------------------HTSVCENVSRLIKCMVTAAR---VGLSSHVCALKVAECAYCEASIMWHQLATKLVQFMAPLNPVRPPD--VPIEDIIEEEKSSRKSPPESDKEKTRDRDVSLS 873          

HSP 2 Score: 328.176 bits (840), Expect = 1.416e-89
Identity = 229/737 (31.07%), Postives = 373/737 (50.61%), Query Frame = 1
Query: 5494 RQVESF-MVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIEN--NDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQ-FDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCV-----------------TSNGTGISC------------QPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFV----------------------VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            R+V  + +VERC+ C A +E Y +E +G+ IV  G ++HREPA+AAP+L ++L ++++I   + ++W+   +   + ++  + A QF RC  + L PNG+F+Q+FQT+++        + +   L DF+D LN   PI  V E L  KK++  E LP++  N+A YL      ++ V     +   +++ A Q  +  LR++   +   T+   +L I+   ++ N +   K+L+D ++ ++ + V+        + ELC++  R   K++ KNLL + +I E   A+KFK  +PD NLL +I F+L+DAGGT+ P     GL     P    ++ T +A+ +R +++D I F++D  T+ K+K  +    S  L EDTLG  LK A+AQY+ALE+S               G    +  + ++LPW+ + P + QQGP+EF  CV  +R L+WLLLGS+ H  +                  S GTG +             QP+P      IAD ++VI +GF +Q K                           SV+ MSSL+HAF LCQLWT+Y E  A  H+ NSN     +    +FW  + P IL L++ +   V                      +VN H L+++E L +  S  + K++ +W+P+L  +  QL   L  RLQ   ++ P   E     +   +KWL++  F +G+ E Q S AT  +
Sbjct: 2103 RRVGDYTIVERCSDCGAHIEEYTDEEIGIFIVILGTFIHREPAMAAPFLPEILTMTSRICLSSTHAWQGE-NGPPLASSAQAVACQFFRCVLHQLAPNGIFLQVFQTQMKMKIRHHHFRSIAKALQDFQD-LNSTSPIYMVCESLTSKKSLPIEQLPVIFRNMAEYLN-----LQCVPTEAGVGLAVWSQAMQAMESLLRQVIVIMPSLTNAEYMLDIMAATLRLNCVP--KTLLDPYSKIMAYCVQHTNLEYQTLYELCTLNIRSFSKDRDKNLLCRQMIFEFVQALKFKSNIPDHNLLTIIGFVLLDAGGTLPPGA-APGL-----PDAAPMMTTNSADCLRQYINDVIDFLADFHTLSKIKNFKNGQTSSGLGEDTLGGVLKGAVAQYLALEMS--------------RGNSRDNKAVSRYLPWLNNAPSSLQQGPKEFTECVGHMRLLSWLLLGSLTHMALMQRRQETHSIPTPLPQQNSQGTGPAASVHYQHQGVTYSQPVPQEASCHIADHIQVIFAGFAEQSKT--------------------------SVLHMSSLFHAFTLCQLWTVYLEQMA--HNTNSNAEGSTLGVLFEFWAKVTPCILQLVSHAKPTVNKDQPQTPLDFQTQSANSKLSEMVNLHFLSLLEALKDTNSTVLGKLLPMWSPVLSSQT-QLSDTLHVRLQNVRDYAPDYEEQQTYKSEALLKWLQRLQFKMGQIELQASTATQFY 2781          

HSP 3 Score: 275.789 bits (704), Expect = 1.504e-73
Identity = 170/544 (31.25%), Postives = 281/544 (51.65%), Query Frame = 1
Query: 3010 PEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSS------DKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYT--DQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPP---TFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRM 4608
            PEI++ VL  +  +  H + L        ++  +     EN+LI +LW+L  +E S++ +  VPLL++  T+  G+D FW +++  F + DWRVRF AVE++T++ R +D +       + T+LA AFC+LI ++DD+N  VA R   Y+ +I D ++  ++ CLE QFD  I DR ++L  +YQL  +L  R +  W+FF+NRF    +EAQI      DI+ + DL N    ++    + ++AR A++++D+   ++ +              L  S G       +   P ++  +  S      +K Y+RQ SAP   + +RK+          ++    D N   +  +    +L+ S R+T+H  V +L++FM+  D     +E    K  + V +HL LLLG+   D+ F+  P  LR S VF+AFL+N+ +VLD N  +G  IL   + ++ +  +P   + +S       +SLW LE   R +WL  LLVVLYKY Y                V   IR+ +N++  H H C+R+
Sbjct: 1052 PEILYYVLQCLNTMALHGDALA---KAAREQRGFFIWCQENLLIKNLWELCNAEHSHICQVGVPLLLHCITLPLGSDVFWRVVQEAFHDTDWRVRFTAVERVTVITRFMDSTPLRSEVGLQTALATAFCHLIASMDDINVYVAQRATLYIGTIHDTAIRSLLFCLESQFDLFIVDRPVVLQSVYQLHNSLSDRKMLGWEFFLNRFDTLFVEAQINLEKCGDISYLRDLRNSDNGSEALSAKIQKAREALSQSDTSGGMAKT--------------LSASFGTKWPYKRTMSAPASMAPRQDSKFVPEKEKIYSRQVSAP---ILKRKTSRFGLDGHIHSLGGLNDDN--LIGLLSRITELEESDRETIHLLVFMLMQFMSRTDQAYPSEEKPMTKTQNIVLKHLFLLLGHNQIDKTFHTTPESLRVSAVFNAFLANLPQVLDQNHLIGGLILPSVMQIILYAPNPTSTSGESYQNIVFNYSLWHLEQYPRRNWLFTLLVVLYKYSYT--------QPPLSGYVIAGIRLIMNSLRGHFHQCRRI 1565          
BLAST of Protein unc-79 homolog vs. Ensembl Fly
Match: unc79 (gene:FBgn0038693 transcript:FBtr0301693)

HSP 1 Score: 403.29 bits (1035), Expect = 2.093e-112
Identity = 264/934 (28.27%), Postives = 466/934 (49.89%), Query Frame = 1
Query:  139 TKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLN-NQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTW--NEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPP-LYVCLDCYDALSRQR-IVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVN--QTSTQLDDIDPEAGLTGAXXXXXXXXXXXXXXXX------XCLCMMVKTIDVQLKMNDPHGHGNMSQQXXXXXXXXXXXXXXXCWSSENCKCKHLXXXXXXXXXXXRPLSVGDAS-----QQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKIS 2886
            T+  +F  K++AL ++H RL+  V   PS  D+   +KYF  TL ++LK+    P+E     ++D   R++ +PN  Y  L+  L  L +    +   Q    +A+L+  + ++PFL+ D +D LP +V+S I+  P + H  II  LC  ++PF  T   ++E E  A +S+ S++ ++ Q+ +   +H  ++E  M+ K ++ KD+L ++AYG+  SR  A  LLFYYWP      F   +    SK  ++      C+R  CPN  +   A K+ +D   +I +    PP LY+C++C + + R+   +   D++ P+++V   C++K CRS   +A   CFS+EC S NG+ PIR+C  CH  +H   +   H+    L   W  + E+Q  MVE++VSL +E  P     +NF E    +    S   G+         G+              A   S ++ + +  Y  +++  +C P  +T +E+L RI+S LF+WF+ T ++        Y   G ++        IEK+K D++  W++ +   +  V ++ LLP+P EYA+VG  W++L  RT+ +K+GL ++  L+PY++IT E WDY++P W+E +  ++ E +  EL+I++ KI DP   P  F    +Y F   RF  T   VQ Q L WL ILT++++ IP+ +L  MF  G++ M   I    +   +A   SL    ++      +T A   N  + S+    ++ ++G T AIS   + +N  +          +C  +M+  +  Q+++ D   H  +                          C++++       ++ R   VG +S     +   C  C+  + WHQ+ +K++Q + P++P+  PD  + +E I +  K+  K+  +   E   +++  +S
Sbjct:   14 TRAAAFQAKLRALHEYHVRLLHNVLPAPSGVDIANNIKYFSQTLLTVLKDVRTSPHELIRDPLED-PTRMSAYPNLEYGNLYNALTMLIDVAPCIQYGQIVFGKALLQCLSCILPFLDKDLIDNLPYLVSSTISVLPPALHQCIINALCYYILPFTITRRSSDEQECQACQSVSSVIMMVLQYSNNPAHHCQLLECLMTLKHNVVKDILCVVAYGTAVSRTSAAKLLFYYWPAFNANLFD--RKVLLSKLTND-LVPFTCQREHCPNSGNAEAA-KVCYDHSISIAYAPDCPPPLYLCIECANEIHREHGSLEFGDILHPMQQVSMVCENKNCRSNEKSAFSICFSTECASFNGNHPIRYCSQCHSNRHNSRRGGDHVVHRSLQPAWQMDPEMQMHMVESVVSLLREAKP-----LNF-EPGKESSSSESKKNGS---------GIT-------------ADNISLEERQRLGRYGIWLLVGRCTPTADTPVEVLGRILSMLFHWFHVTAYS--------YDAAGQVEST------IEKLKVDHVCNWLKDICRIHYNVFISCLLPHPPEYARVGGHWETLASRTSHLKEGLQRLICLVPYEVITSEIWDYVMPHWMEAITNDVAEKELNELKIVLSKILDPEMSPLGFDAKTMYNFVAIRFEKTTAKVQQQALHWLQILTKLEILIPLVQLFAMFGDGVRIMKYGIQHELMREKDAQSQSLAKAPKTPCKESKETKADMANPPRRSSISPVVEDDSGNTSAISDDEAPTNRHTEFSTDAEHNLTCCILMLDILLKQMELQDVEQHMGI----------------------HTSVCENVSRLIKCMVTAAR---VGLSSHVCALKVAECAYCEASIMWHQLATKLVQFMAPLNPVRPPD--VPIEDIIEEEKSSRKSPPESDKEKTRDRDVSLS 873          

HSP 2 Score: 328.561 bits (841), Expect = 1.360e-89
Identity = 229/737 (31.07%), Postives = 373/737 (50.61%), Query Frame = 1
Query: 5494 RQVESF-MVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIEN--NDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQ-FDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCV-----------------TSNGTGISC------------QPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFV----------------------VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            R+V  + +VERC+ C A +E Y +E +G+ IV  G ++HREPA+AAP+L ++L ++++I   + ++W+   +   + ++  + A QF RC  + L PNG+F+Q+FQT+++        + +   L DF+D LN   PI  V E L  KK++  E LP++  N+A YL      ++ V     +   +++ A Q  +  LR++   +   T+   +L I+   ++ N +   K+L+D ++ ++ + V+        + ELC++  R   K++ KNLL + +I E   A+KFK  +PD NLL +I F+L+DAGGT+ P     GL     P    ++ T +A+ +R +++D I F++D  T+ K+K  +    S  L EDTLG  LK A+AQY+ALE+S               G    +  + ++LPW+ + P + QQGP+EF  CV  +R L+WLLLGS+ H  +                  S GTG +             QP+P      IAD ++VI +GF +Q K                           SV+ MSSL+HAF LCQLWT+Y E  A  H+ NSN     +    +FW  + P IL L++ +   V                      +VN H L+++E L +  S  + K++ +W+P+L  +  QL   L  RLQ   ++ P   E     +   +KWL++  F +G+ E Q S AT  +
Sbjct: 2348 RRVGDYTIVERCSDCGAHIEEYTDEEIGIFIVILGTFIHREPAMAAPFLPEILTMTSRICLSSTHAWQGE-NGPPLASSAQAVACQFFRCVLHQLAPNGIFLQVFQTQMKMKIRHHHFRSIAKALQDFQD-LNSTSPIYMVCESLTSKKSLPIEQLPVIFRNMAEYLN-----LQCVPTEAGVGLAVWSQAMQAMESLLRQVIVIMPSLTNAEYMLDIMAATLRLNCVP--KTLLDPYSKIMAYCVQHTNLEYQTLYELCTLNIRSFSKDRDKNLLCRQMIFEFVQALKFKSNIPDHNLLTIIGFVLLDAGGTLPPGA-APGL-----PDAAPMMTTNSADCLRQYINDVIDFLADFHTLSKIKNFKNGQTSSGLGEDTLGGVLKGAVAQYLALEMS--------------RGNSRDNKAVSRYLPWLNNAPSSLQQGPKEFTECVGHMRLLSWLLLGSLTHMALMQRRQETHSIPTPLPQQNSQGTGPAASVHYQHQGVTYSQPVPQEASCHIADHIQVIFAGFAEQSKT--------------------------SVLHMSSLFHAFTLCQLWTVYLEQMA--HNTNSNAEGSTLGVLFEFWAKVTPCILQLVSHAKPTVNKDQPQTPLDFQTQSANSKLSEMVNLHFLSLLEALKDTNSTVLGKLLPMWSPVLSSQT-QLSDTLHVRLQNVRDYAPDYEEQQTYKSEALLKWLQRLQFKMGQIELQASTATQFY 3026          

HSP 3 Score: 182.57 bits (462), Expect = 2.697e-45
Identity = 89/253 (35.18%), Postives = 149/253 (58.89%), Query Frame = 1
Query: 3010 PEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTD 3768
            PEI++ VL  +  +  H + L        ++  +     EN+LI +LW+L  +E S++ +  VPLL++  T+  G+D FW +++  F + DWRVRF AVE++T++ R +D +       + T+LA AFC+LI ++DD+N  VA R   Y+ +I D ++  ++ CLE QFD  I DR ++L  +YQL  +L  R +  W+FF+NRF    +EAQI      DI+ + DL N    ++    + ++AR A++++D
Sbjct: 1071 PEILYYVLQCLNTMALHGDALA---KAAREQRGFFIWCQENLLIKNLWELCNAEHSHICQVGVPLLLHCITLPLGSDVFWRVVQEAFHDTDWRVRFTAVERVTVITRFMDSTPLRSEVGLQTALATAFCHLIASMDDINVYVAQRATLYIGTIHDTAIRSLLFCLESQFDLFIVDRPVVLQSVYQLHNSLSDRKMLGWEFFLNRFDTLFVEAQINLEKCGDISYLRDLRNSDNGSEALSAKIQKAREALSQSD 1320          

HSP 4 Score: 107.071 bits (266), Expect = 2.210e-22
Identity = 65/186 (34.95%), Postives = 99/186 (53.23%), Query Frame = 1
Query: 4066 DLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYT--DQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPP---TFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRM 4608
            +L+ S R+T+H  V +L++FM+  D     +E    K  + V +HL LLLG+   D+ F+  P  LR S VF+AFL+N+ +VLD N  +G  IL   + ++ +  +P   + +S       +SLW LE   R +WL  LLVVLYKY Y                V   IR+ +N++  H H C+R+
Sbjct: 1633 ELEESDRETIHLLVFMLMQFMSRTDQAYPSEEKPMTKTQNIVLKHLFLLLGHNQIDKTFHTTPESLRVSAVFNAFLANLPQVLDQNHLIGGLILPSVMQIILYAPNPTSTSGESYQNIVFNYSLWHLEQYPRRNWLFTLLVVLYKYSYT--------QPPLSGYVIAGIRLIMNSLRGHFHQCRRI 1810          
BLAST of Protein unc-79 homolog vs. Ensembl Xenopus
Match: UNC79 (unc-79 homolog, NALCN channel complex subunit [Source:NCBI gene;Acc:100486994])

HSP 1 Score: 376.326 bits (965), Expect = 5.474e-104
Identity = 297/903 (32.89%), Postives = 443/903 (49.06%), Query Frame = 1
Query: 5032 SPITVSSKDKNIKTPVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVE----------IQKILDTKDDPGRRR-------PRRSEFLTT-DTTVNSTIGSSSSGTKQPLYHRQVESF---------------------------------MVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI------VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVE-------WXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            SP+T+  K   ++         + DD++ +++    EN   E+     +  D   + DS   PD    S  E   AE KE++E+    F  +   RQRK RK  +++++          + K+ + KD     +       PR S    T D  V  T   SS  +KQ     Q+  F                                 M ++C+ C A+LE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   ++++P N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L + L+DF  +L+ F  + Q+LEGLN KK     NLP        +DN+A ++EALP       ++   N W   I  QF  F  KLP+ L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  LT+ +I +L  A+K K  +PD NLLLL+QFI  D G  +  + I         P       T A E  R ++ + + FI+D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+E++               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     +AD + VIL GFP+Q K                           SV+ M SL+HAF+  QLWT+YCE AA   SV N N +   AV TA++FW  + P+IL L+  +   V +V  HL+++ME L EC S    K+I +W P++Q   K L   LQ RLQ                   +  ++ +  KWL+   F + + E Q S A   F
Sbjct: 1663 SPLTLKQKRDQLRKSCALAELSL-DDNSEDAM---EENNTGEKSEPLNVTEDTENQTDSE-KPDVGNESDTEQN-AEPKEEAEE----FKIQIVPRQRKQRKIAVSAIQREYLDITFNILDKLGEQKDTESDSKGLSILEIPRESSSAPTLDAVVPETSSRSSLTSKQSNEPSQLTLFILFSTKSSLLSAPSIVSMFVPAPEDFTDDQPTIMSDKCHDCGAVLEEYDEETLGLAIVVLLTFIHLSPDLAAPLLLDIMQSVGRLASSTNFS--NQAESMMIPGNAAGVAKQFLRCVFHQLAPNGIFTQLFQSNIKDGS-FLRTLANSLMDF-SELSSFAALSQLLEGLNNKK-----NLPAGGAMLRCLDNIATFMEALP-------MDSPSNLW-TTICNQFQTFFTKLPSVLPLKCSLDSSLRIMICLLKIPTSNATRSLLEPFSKLLSFVIQNGVFTLAYLVELCGLCYRAFTKERDKFYLTRSVILDLLQALKLKSPLPDTNLLLLVQFICTDVGTKLAESTIIHKQMIASLPGC----GTAAMECTRQYISELLDFIADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMEIT--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHGVVCVN-SPTPCMPIPLDAGSHVADHLIVILIGFPEQSKT--------------------------SVLHMCSLFHAFIFAQLWTVYCEQAAIAPSVQNQNEFSFTAVLTALEFWSRVTPSILQLMAHNTVMVEMVCLHLISLMEALQECNSTVFVKLIPMWLPMIQSNLKHLSAGLQLRLQAIQNNVNQQNLRMLQGSAQITHNSAVLRKWLQCTQFKMAQVEIQSSEAASQF 2492          

HSP 2 Score: 345.51 bits (885), Expect = 1.268e-94
Identity = 229/761 (30.09%), Postives = 371/761 (48.75%), Query Frame = 1
Query:  160 NKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNE-------------------------------------------------SYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKL-NNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECE----SYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCP----VQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH-----LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVG-SGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            +KI+ L+++H+R++  +  +PS  D+  TLKYF  TL SIL  +    N+                                                   G + +D Q+  + +P+  Y  L+  L+ L + +  L + Q  + ++I  T   L+PFL  D L  LP  + S +  FP   H  IIE L T+ +P     +   E    ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P     +++  Q        + AW  I C+  EC N  +K  A+KM  D   ++  G+K PPLY+C +C   ++      L DV+LP    + T   K C S    A +TCFS+ C   +G++P+R+C+ CH   H      GA ++ H++Q   P I   +C  E   C VEA++SL KE      Q+     E +    +G S +  +LD             A F + D        DD H  +++S +  + +   C P  NT  E L+R+VS +F WF+ T + +    G                  +EK+K  ++ KW++ V E   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I  + W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P +VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    4 SKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRSGKKENQDASNLTVPMTMCLFPVPFPLTPSLRPQVSSINPTVTRSLLYSVLRDSPSERGQQSRDAQL--SEYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLSDDILSTLPYTMISTLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGGVPAHVNLSASSMLMIAMQYTTNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAITEYRGLQ--------YTAWNPIHCQHIECHNAINKP-AVKMCIDASLSVALGDKPPPLYLCEECSQRIAGDHGEWLIDVLLP----QGTFIFKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSYHHSNEVGAGAAAETHLFQTSPPPINTRECGAEELVCAVEAVISLLKEAEFHAEQR---EYEMNRRRQMGLSSSHHSLDN------------ADFDNKD--------DDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVSMVFQWFHSTAYMMDDEVG----------------SLVEKLKPQFVTKWLKTVCEIRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQQVWECIMPEWLEAIRTEVPDTQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIVVPLQLLISMFSDGVNSVKE 710          

HSP 3 Score: 134.806 bits (338), Expect = 1.478e-30
Identity = 80/209 (38.28%), Postives = 109/209 (52.15%), Query Frame = 1
Query: 4075 GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQA--FNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            G    T+HQ + +L+KFMA  D   ++ ++   KA + V+RHL +LLG+  Q   F I P K+R ST F+AF++ VA+V+D N ++G  +L   + VL++CA PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y               IV +LI IT+NT+    H CK               P A    L  D SN S
Sbjct: 1206 GIDHQTVHQLIIVLMKFMAK-DKSSAEADISSAKAFNTVKRHLYVLLGFDQQEGYFTIAPQKMRTSTCFNAFIAGVAQVMDYNINLGKHLLPLVVQVLKYCACPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYR--------EADLSKIVLHLIHITVNTLNAQYHSCK---------------PHATAGPLYSDNSNIS 1390          

HSP 4 Score: 91.6633 bits (226), Expect = 1.815e-17
Identity = 54/156 (34.62%), Postives = 86/156 (55.13%), Query Frame = 1
Query: 3307 EKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVAR 3762
            EK+ +L R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R
Sbjct: 1000 EKVAVLCRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFDTLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAAMWKIKRARFARNR 1155          
BLAST of Protein unc-79 homolog vs. Ensembl Xenopus
Match: UNC79 (unc-79 homolog, NALCN channel complex subunit [Source:NCBI gene;Acc:100486994])

HSP 1 Score: 375.17 bits (962), Expect = 1.201e-103
Identity = 253/694 (36.46%), Postives = 372/694 (53.60%), Query Frame = 1
Query: 5506 SFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI------VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVE-------WXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            + M ++C+ C A+LE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   ++++P N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L + L+DF  +L+ F  + Q+LEGLN KK     NLP        +DN+A ++EALP       ++   N W   I  QF  F  KLP+ L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  LT+ +I +L  A+K K  +PD NLLLL+QFI  D G  +  + I         P       T A E  R ++ + + FI+D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+E++               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     +AD + VIL GFP+Q K                           SV+ M SL+HAF+  QLWT+YCE AA   SV N N +   AV TA++FW  + P+IL L+  +   V +V  HL+++ME L EC S    K+I +W P++Q   K L   LQ RLQ                   +  ++ +  KWL+   F + + E Q S A   F
Sbjct: 1924 TIMSDKCHDCGAVLEEYDEETLGLAIVVLLTFIHLSPDLAAPLLLDIMQSVGRLASSTNFS--NQAESMMIPGNAAGVAKQFLRCVFHQLAPNGIFTQLFQSNIKDGS-FLRTLANSLMDF-SELSSFAALSQLLEGLNNKK-----NLPAGGAMLRCLDNIATFMEALP-------MDSPSNLWT-TICNQFQTFFTKLPSVLPLKCSLDSSLRIMICLLKIPTSNATRSLLEPFSKLLSFVIQNGVFTLAYLVELCGLCYRAFTKERDKFYLTRSVILDLLQALKLKSPLPDTNLLLLVQFICTDVGTKLAESTIIHKQMIASLPGC----GTAAMECTRQYISELLDFIADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMEIT--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHGVVCVN-SPTPCMPIPLDAGSHVADHLIVILIGFPEQSKT--------------------------SVLHMCSLFHAFIFAQLWTVYCEQAAIAPSVQNQNEFSFTAVLTALEFWSRVTPSILQLMAHNTVMVEMVCLHLISLMEALQECNSTVFVKLIPMWLPMIQSNLKHLSAGLQLRLQAIQNNVNQQNLRMLQGSAQITHNSAVLRKWLQCTQFKMAQVEIQSSEAASQF 2554          

HSP 2 Score: 364.385 bits (934), Expect = 2.661e-100
Identity = 229/712 (32.16%), Postives = 374/712 (52.53%), Query Frame = 1
Query:  160 NKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKL-NNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECE----SYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCP----VQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH-----LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVG-SGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            +KI+ L+++H+R++  +  +PS  D+  TLKYF  TL S+L+++   P+E  G + +D Q+  + +P+  Y  L+  L+ L + +  L + Q  + ++I  T   L+PFL  D L  LP  + S +  FP   H  IIE L T+ +P     +   E    ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P     +++  Q        + AW  I C+  EC N  +K  A+KM  D   ++  G+K PPLY+C +C   ++      L DV+LP    + T   K C S    A +TCFS+ C   +G++P+R+C+ CH   H      GA ++ H++Q   P I   +C  E   C VEA++SL KE      Q+     E +    +G S +  +LD             A F + D        DD H  +++S +  + +   C P  NT  E L+R+VS +F WF+ T + +    G                  +EK+K  ++ KW++ V E   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I  + W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P +VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    4 SKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSVLRDS---PSER-GQQSRDAQL--SEYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLSDDILSTLPYTMISTLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGGVPAHVNLSASSMLMIAMQYTTNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAITEYRGLQ--------YTAWNPIHCQHIECHNAINKP-AVKMCIDASLSVALGDKPPPLYLCEECSQRIAGDHGEWLIDVLLP----QGTFIFKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSYHHSNEVGAGAAAETHLFQTSPPPINTRECGAEELVCAVEAVISLLKEAEFHAEQR---EYEMNRRRQMGLSSSHHSLDN------------ADFDNKD--------DDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVSMVFQWFHSTAYMMDDEVG----------------SLVEKLKPQFVTKWLKTVCEIRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQQVWECIMPEWLEAIRTEVPDTQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIVVPLQLLISMFSDGVNSVKE 657          

HSP 3 Score: 204.912 bits (520), Expect = 8.507e-52
Identity = 154/481 (32.02%), Postives = 232/481 (48.23%), Query Frame = 1
Query: 3307 EKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLN----NQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLD-GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQA--FNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDT 4728
            EK+ +L R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R  S+RS+  S             P      ++L    ST  P+ L            + SAP       +++           A+ +  N+     I++ L  D G    T+HQ + +L+KFMA  D   ++ ++   KA + V+RHL +LLG+  Q   F I P K+R ST F+AF++ VA+V+D N ++G  +L   + VL++CA PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y               IV +LI IT+NT+    H CK               P A    L  D SN S  ++   E D+
Sbjct:  947 EKVAVLCRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFDTLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAAMWKIKRARFARNRQKSVRSLRDSVKG----------PGESKRALSLPETLSTKIPVRLTR---------HEQSAPALGGTAEQTQ-----------AQQSPENDNI---IKDPLPEDAGIDHQTVHQLIIVLMKFMAK-DKSSAEADISSAKAFNTVKRHLYVLLGFDQQEGYFTIAPQKMRTSTCFNAFIAGVAQVMDYNINLGKHLLPLVVQVLKYCACPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYR--------EADLSKIVLHLIHITVNTLNAQYHSCK---------------PHATAGPLYSDNSNISRYSEKEKEEDS 1370          
BLAST of Protein unc-79 homolog vs. Ensembl Xenopus
Match: UNC79 (unc-79 homolog, NALCN channel complex subunit [Source:NCBI gene;Acc:100486994])

HSP 1 Score: 374.785 bits (961), Expect = 1.432e-103
Identity = 253/694 (36.46%), Postives = 372/694 (53.60%), Query Frame = 1
Query: 5506 SFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI------VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVE-------WXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            + M ++C+ C A+LE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   ++++P N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L + L+DF  +L+ F  + Q+LEGLN KK     NLP        +DN+A ++EALP       ++   N W   I  QF  F  KLP+ L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  LT+ +I +L  A+K K  +PD NLLLL+QFI  D G  +  + I         P       T A E  R ++ + + FI+D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+E++               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     +AD + VIL GFP+Q K                           SV+ M SL+HAF+  QLWT+YCE AA   SV N N +   AV TA++FW  + P+IL L+  +   V +V  HL+++ME L EC S    K+I +W P++Q   K L   LQ RLQ                   +  ++ +  KWL+   F + + E Q S A   F
Sbjct: 1864 TIMSDKCHDCGAVLEEYDEETLGLAIVVLLTFIHLSPDLAAPLLLDIMQSVGRLASSTNFS--NQAESMMIPGNAAGVAKQFLRCVFHQLAPNGIFTQLFQSNIKDGS-FLRTLANSLMDF-SELSSFAALSQLLEGLNNKK-----NLPAGGAMLRCLDNIATFMEALP-------MDSPSNLW-TTICNQFQTFFTKLPSVLPLKCSLDSSLRIMICLLKIPTSNATRSLLEPFSKLLSFVIQNGVFTLAYLVELCGLCYRAFTKERDKFYLTRSVILDLLQALKLKSPLPDTNLLLLVQFICTDVGTKLAESTIIHKQMIASLPGC----GTAAMECTRQYISELLDFIADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMEIT--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHGVVCVN-SPTPCMPIPLDAGSHVADHLIVILIGFPEQSKT--------------------------SVLHMCSLFHAFIFAQLWTVYCEQAAIAPSVQNQNEFSFTAVLTALEFWSRVTPSILQLMAHNTVMVEMVCLHLISLMEALQECNSTVFVKLIPMWLPMIQSNLKHLSAGLQLRLQAIQNNVNQQNLRMLQGSAQITHNSAVLRKWLQCTQFKMAQVEIQSSEAASQF 2494          

HSP 2 Score: 345.125 bits (884), Expect = 1.666e-94
Identity = 229/761 (30.09%), Postives = 371/761 (48.75%), Query Frame = 1
Query:  160 NKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNE-------------------------------------------------SYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKL-NNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECE----SYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCP----VQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH-----LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVG-SGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            +KI+ L+++H+R++  +  +PS  D+  TLKYF  TL SIL  +    N+                                                   G + +D Q+  + +P+  Y  L+  L+ L + +  L + Q  + ++I  T   L+PFL  D L  LP  + S +  FP   H  IIE L T+ +P     +   E    ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P     +++  Q        + AW  I C+  EC N  +K  A+KM  D   ++  G+K PPLY+C +C   ++      L DV+LP    + T   K C S    A +TCFS+ C   +G++P+R+C+ CH   H      GA ++ H++Q   P I   +C  E   C VEA++SL KE      Q+     E +    +G S +  +LD             A F + D        DD H  +++S +  + +   C P  NT  E L+R+VS +F WF+ T + +    G                  +EK+K  ++ KW++ V E   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I  + W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P +VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    4 SKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRSGKKENQDASNLTVPMTMCLFPVPFPLTPSLRPQVSSINPTVTRSLLYSVLRDSPSERGQQSRDAQL--SEYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLSDDILSTLPYTMISTLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGGVPAHVNLSASSMLMIAMQYTTNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAITEYRGLQ--------YTAWNPIHCQHIECHNAINKP-AVKMCIDASLSVALGDKPPPLYLCEECSQRIAGDHGEWLIDVLLP----QGTFIFKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSYHHSNEVGAGAAAETHLFQTSPPPINTRECGAEELVCAVEAVISLLKEAEFHAEQR---EYEMNRRRQMGLSSSHHSLDN------------ADFDNKD--------DDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVSMVFQWFHSTAYMMDDEVG----------------SLVEKLKPQFVTKWLKTVCEIRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQQVWECIMPEWLEAIRTEVPDTQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIVVPLQLLISMFSDGVNSVKE 710          

HSP 3 Score: 135.191 bits (339), Expect = 1.406e-30
Identity = 80/209 (38.28%), Postives = 109/209 (52.15%), Query Frame = 1
Query: 4075 GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQA--FNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            G    T+HQ + +L+KFMA  D   ++ ++   KA + V+RHL +LLG+  Q   F I P K+R ST F+AF++ VA+V+D N ++G  +L   + VL++CA PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y               IV +LI IT+NT+    H CK               P A    L  D SN S
Sbjct: 1206 GIDHQTVHQLIIVLMKFMAK-DKSSAEADISSAKAFNTVKRHLYVLLGFDQQEGYFTIAPQKMRTSTCFNAFIAGVAQVMDYNINLGKHLLPLVVQVLKYCACPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYR--------EADLSKIVLHLIHITVNTLNAQYHSCK---------------PHATAGPLYSDNSNIS 1390          

HSP 4 Score: 91.6633 bits (226), Expect = 1.925e-17
Identity = 54/156 (34.62%), Postives = 86/156 (55.13%), Query Frame = 1
Query: 3307 EKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVAR 3762
            EK+ +L R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R
Sbjct: 1000 EKVAVLCRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFDTLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAAMWKIKRARFARNR 1155          
BLAST of Protein unc-79 homolog vs. Ensembl Mouse
Match: Unc79 (unc-79 homolog [Source:MGI Symbol;Acc:MGI:2684729])

HSP 1 Score: 388.652 bits (997), Expect = 6.947e-108
Identity = 231/712 (32.44%), Postives = 374/712 (52.53%), Query Frame = 1
Query:  136 TTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKL-NNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVY---TWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH---LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            +TK + F +KI+ L+++H+R++  +  +PS  D+  TLKYF  TL S+L++    P+E  G + +D Q+  + +P+  Y  L+  L+ L + +  L + Q  + ++I  T   L+PFL  D L  LP  + S +  FP   H  IIE L T+ +P      +  E   ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P    S          + AW  I C+  EC N  +K  A+KM  DP  ++  G+K PPLY+C +C + +S      L DV+LP  ++   C  K C S    A +TCFS+ C   +G++P+R+C+ CH   H   +GA ++ H+YQ   P I   +C  E   C VEA++SL KE          F  E   +           +      LG+  S  S  + D        DD H  +++S +  + +   C P  NT  E L+R+V+ +F WF+ T + +    G                  +EK+K  ++ KW++ V +   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I+   W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P  VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    2 STKAEQFASKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSVLRDA---PSER-GPQSRDAQL--SDYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLNDDVLSTLPYTMISTLATFPPFLHKDIIEYLSTSFLPMAILGSSGREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHIECHNAINKP-AVKMCIDPSLSVALGDKPPPLYLCEECSERISGDHSEWLIDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGATAETHLYQTSPPPINTRECGAEELVCAVEAVISLLKEA--------EFHAEQREH-----------ELNRRRQLGLSSSHHSLDNTDF---DNKDDDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYMMDDEVG----------------SLVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVISQSVWECIMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSTVQEQALLWLHVLSELDITVPLQLLISMFSDGVNSVKE 664          

HSP 2 Score: 372.089 bits (954), Expect = 8.105e-103
Identity = 247/689 (35.85%), Postives = 370/689 (53.70%), Query Frame = 1
Query: 5506 SFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI-VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNG-------LFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            + M ++C+ C AILE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   +++VP N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L + L+DF ++L+    + Q+LEGLN KK +      I  ++N+A ++EALP       ++   + W   I+ QF  F  KLP  L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  L++ ++ EL  A+K K  +PD NLLLL+QFI  DAG  +  + I         P       T A E +R ++ + + F++D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+E+S               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     IAD + VIL GFP+Q K                            V+ M SL+HAF+  QLWT+YCE +A   +V N N +   A+ TA++FW  + P+IL L+  +   V +V  H++++ME L EC S    K+I +W P++Q   K L   LQ RLQ                +G          KWL+   F + + E Q S A   F
Sbjct: 2021 TVMADKCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGRLASSTTFS--NQAESMMVPGNAAGVAKQFLRCIFHQLAPNGIFPQLFQSAIKDGT-FLRTLATSLMDF-NELSSIAALSQLLEGLNNKKNLPAGGAMIRCLENIATFMEALP-------MDSPSSLW-TTISNQFQTFFAKLPCVLPLKCSLDSSLRIMICLLKIPSTNATRSLLEPFSKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDTNLLLLVQFICADAGTKLAESTILSKQMIASVPGC----GTAAMECIRQYVSEVLEFMADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMEIS--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASS-PCLPIPLDAGSHIADHLIVILIGFPEQSKT--------------------------CVLHMCSLFHAFIFAQLWTVYCEQSAVATNVQNQNEFSFTAILTALEFWSRVTPSILQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNTKHLSAGLQLRLQAIQNNVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAASQF 2651          

HSP 3 Score: 266.159 bits (679), Expect = 1.561e-70
Identity = 188/581 (32.36%), Postives = 294/581 (50.60%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLD-GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDT 4728
            +P+I+ ++L  +  L  H E L   +    + + YI    ++MLI  LW ++ SEFS L+  +VPLL+++ ++  GAD FW I+   F + DW++RF+AVEK+ ++ R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R  S+RS+  S       +RA S+P   +S +          P+ L   + S          P+   G++                   P N     I++ L  D G    T+HQ +T+L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R ST F+AF++ +A+V+D N ++G  +L   + VL++C+ PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y        ++        +LI IT+NT+    H CK               P A    L  D SN S  ++   E D+
Sbjct:  915 EPDILFNMLNCLKILCLHGECLYTARKDHPQFLAYIQ---DHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNRQKSVRSLRDSVKGPAESKRALSLPETLTSKI----------PVRLTRHEQSAPAL---GGTPEQTPGQQ------------------SPEND--NTIKDLLPEDAGIDHQTVHQLITVLMKFMAR-DESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQKMRLSTCFNAFIAGIAQVMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYRDCDVSKTLL--------HLIHITVNTLNAQYHSCK---------------PHATAGPLYTDNSNISRYSEKEKEEDS 1435          
BLAST of Protein unc-79 homolog vs. Ensembl Mouse
Match: Unc79 (unc-79 homolog [Source:MGI Symbol;Acc:MGI:2684729])

HSP 1 Score: 372.474 bits (955), Expect = 6.836e-103
Identity = 247/689 (35.85%), Postives = 370/689 (53.70%), Query Frame = 1
Query: 5506 SFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI-VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNG-------LFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            + M ++C+ C AILE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   +++VP N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L + L+DF ++L+    + Q+LEGLN KK +      I  ++N+A ++EALP       ++   + W   I+ QF  F  KLP  L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  L++ ++ EL  A+K K  +PD NLLLL+QFI  DAG  +  + I         P       T A E +R ++ + + F++D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+E+S               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     IAD + VIL GFP+Q K                            V+ M SL+HAF+  QLWT+YCE +A   +V N N +   A+ TA++FW  + P+IL L+  +   V +V  H++++ME L EC S    K+I +W P++Q   K L   LQ RLQ                +G          KWL+   F + + E Q S A   F
Sbjct: 1963 TVMADKCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGRLASSTTFS--NQAESMMVPGNAAGVAKQFLRCIFHQLAPNGIFPQLFQSAIKDGT-FLRTLATSLMDF-NELSSIAALSQLLEGLNNKKNLPAGGAMIRCLENIATFMEALP-------MDSPSSLW-TTISNQFQTFFAKLPCVLPLKCSLDSSLRIMICLLKIPSTNATRSLLEPFSKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDTNLLLLVQFICADAGTKLAESTILSKQMIASVPGC----GTAAMECIRQYVSEVLEFMADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMEIS--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASS-PCLPIPLDAGSHIADHLIVILIGFPEQSKT--------------------------CVLHMCSLFHAFIFAQLWTVYCEQSAVATNVQNQNEFSFTAILTALEFWSRVTPSILQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNTKHLSAGLQLRLQAIQNNVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAASQF 2593          

HSP 2 Score: 372.089 bits (954), Expect = 8.170e-103
Identity = 232/761 (30.49%), Postives = 372/761 (48.88%), Query Frame = 1
Query:  136 TTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNE-------------------------------------------------SYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKL-NNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVY---TWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH---LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            +TK + F +KI+ L+++H+R++  +  +PS  D+  TLKYF  TL SIL  T    N+                                                   G + +D Q+  + +P+  Y  L+  L+ L + +  L + Q  + ++I  T   L+PFL  D L  LP  + S +  FP   H  IIE L T+ +P      +  E   ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P    S          + AW  I C+  EC N  +K  A+KM  DP  ++  G+K PPLY+C +C + +S      L DV+LP  ++   C  K C S    A +TCFS+ C   +G++P+R+C+ CH   H   +GA ++ H+YQ   P I   +C  E   C VEA++SL KE          F  E   +           +      LG+  S  S  + D        DD H  +++S +  + +   C P  NT  E L+R+V+ +F WF+ T + +    G                  +EK+K  ++ KW++ V +   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I+   W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P  VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    2 STKAEQFASKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRTGKKENQDASNLTVPMTMCLFPVPFPLTPSLRPQVSSINPTVTRSLLYSVLRDAPSERGPQSRDAQL--SDYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLNDDVLSTLPYTMISTLATFPPFLHKDIIEYLSTSFLPMAILGSSGREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHIECHNAINKP-AVKMCIDPSLSVALGDKPPPLYLCEECSERISGDHSEWLIDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGATAETHLYQTSPPPINTRECGAEELVCAVEAVISLLKEA--------EFHAEQREH-----------ELNRRRQLGLSSSHHSLDNTDF---DNKDDDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYMMDDEVGS----------------LVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVISQSVWECIMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSTVQEQALLWLHVLSELDITVPLQLLISMFSDGVNSVKE 717          

HSP 3 Score: 159.458 bits (402), Expect = 4.083e-38
Identity = 89/256 (34.77%), Postives = 147/256 (57.42%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVAR 3762
            +P+I+ ++L  +  L  H E L   +    + + YI    ++MLI  LW ++ SEFS L+  +VPLL+++ ++  GAD FW I+   F + DW++RF+AVEK+ ++ R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R
Sbjct:  968 EPDILFNMLNCLKILCLHGECLYTARKDHPQFLAYIQ---DHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNR 1220          

HSP 4 Score: 130.568 bits (327), Expect = 2.220e-29
Identity = 78/209 (37.32%), Postives = 110/209 (52.63%), Query Frame = 1
Query: 4075 GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            G    T+HQ +T+L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R ST F+AF++ +A+V+D N ++G  +L   + VL++C+ PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y        ++        +LI IT+NT+    H CK               P A    L  D SN S
Sbjct: 1271 GIDHQTVHQLITVLMKFMAR-DESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQKMRLSTCFNAFIAGIAQVMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYRDCDVSKTLL--------HLIHITVNTLNAQYHSCK---------------PHATAGPLYTDNSNIS 1455          
BLAST of Protein unc-79 homolog vs. Ensembl Mouse
Match: Unc79 (unc-79 homolog [Source:MGI Symbol;Acc:MGI:2684729])

HSP 1 Score: 372.089 bits (954), Expect = 7.436e-103
Identity = 247/689 (35.85%), Postives = 370/689 (53.70%), Query Frame = 1
Query: 5506 SFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI-VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNG-------LFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            + M ++C+ C AILE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   +++VP N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L + L+DF ++L+    + Q+LEGLN KK +      I  ++N+A ++EALP       ++   + W   I+ QF  F  KLP  L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  L++ ++ EL  A+K K  +PD NLLLL+QFI  DAG  +  + I         P       T A E +R ++ + + F++D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+E+S               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     IAD + VIL GFP+Q K                            V+ M SL+HAF+  QLWT+YCE +A   +V N N +   A+ TA++FW  + P+IL L+  +   V +V  H++++ME L EC S    K+I +W P++Q   K L   LQ RLQ                +G          KWL+   F + + E Q S A   F
Sbjct: 1825 TVMADKCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGRLASSTTFS--NQAESMMVPGNAAGVAKQFLRCIFHQLAPNGIFPQLFQSAIKDGT-FLRTLATSLMDF-NELSSIAALSQLLEGLNNKKNLPAGGAMIRCLENIATFMEALP-------MDSPSSLW-TTISNQFQTFFAKLPCVLPLKCSLDSSLRIMICLLKIPSTNATRSLLEPFSKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDTNLLLLVQFICADAGTKLAESTILSKQMIASVPGC----GTAAMECIRQYVSEVLEFMADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMEIS--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASS-PCLPIPLDAGSHIADHLIVILIGFPEQSKT--------------------------CVLHMCSLFHAFIFAQLWTVYCEQSAVATNVQNQNEFSFTAILTALEFWSRVTPSILQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNTKHLSAGLQLRLQAIQNNVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAASQF 2455          

HSP 2 Score: 322.013 bits (824), Expect = 1.373e-87
Identity = 189/583 (32.42%), Postives = 300/583 (51.46%), Query Frame = 1
Query:  520 VTSCINFFPSSQHAAIIELLCTAVIPFVY---TWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH---LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            + S +  FP   H  IIE L T+ +P      +  E   ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P    S          + AW  I C+  EC N  +K  A+KM  DP  ++  G+K PPLY+C +C + +S      L DV+LP  ++   C  K C S    A +TCFS+ C   +G++P+R+C+ CH   H   +GA ++ H+YQ   P I   +C  E   C VEA++SL KE          F  E   +           +      LG+  S  S  + D        DD H  +++S +  + +   C P  NT  E L+R+V+ +F WF+ T + +    G                  +EK+K  ++ KW++ V +   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I+   W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P  VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    1 MISTLATFPPFLHKDIIEYLSTSFLPMAILGSSGREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHIECHNAINKP-AVKMCIDPSLSVALGDKPPPLYLCEECSERISGDHSEWLIDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGATAETHLYQTSPPPINTRECGAEELVCAVEAVISLLKEA--------EFHAEQREH-----------ELNRRRQLGLSSSHHSLDNTDF---DNKDDDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYMMDDEVGS----------------LVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVISQSVWECIMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSTVQEQALLWLHVLSELDITVPLQLLISMFSDGVNSVKE 540          

HSP 3 Score: 159.458 bits (402), Expect = 3.861e-38
Identity = 89/256 (34.77%), Postives = 147/256 (57.42%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVAR 3762
            +P+I+ ++L  +  L  H E L   +    + + YI    ++MLI  LW ++ SEFS L+  +VPLL+++ ++  GAD FW I+   F + DW++RF+AVEK+ ++ R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R
Sbjct:  791 EPDILFNMLNCLKILCLHGECLYTARKDHPQFLAYIQ---DHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNR 1043          

HSP 4 Score: 130.954 bits (328), Expect = 2.059e-29
Identity = 78/209 (37.32%), Postives = 110/209 (52.63%), Query Frame = 1
Query: 4075 GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            G    T+HQ +T+L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R ST F+AF++ +A+V+D N ++G  +L   + VL++C+ PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y        ++        +LI IT+NT+    H CK               P A    L  D SN S
Sbjct: 1094 GIDHQTVHQLITVLMKFMAR-DESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQKMRLSTCFNAFIAGIAQVMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYRDCDVSKTLL--------HLIHITVNTLNAQYHSCK---------------PHATAGPLYTDNSNIS 1278          
BLAST of Protein unc-79 homolog vs. Ensembl Mouse
Match: Unc79 (unc-79 homolog [Source:MGI Symbol;Acc:MGI:2684729])

HSP 1 Score: 371.703 bits (953), Expect = 8.838e-103
Identity = 247/689 (35.85%), Postives = 370/689 (53.70%), Query Frame = 1
Query: 5506 SFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI-VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNG-------LFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            + M ++C+ C AILE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   +++VP N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L + L+DF ++L+    + Q+LEGLN KK +      I  ++N+A ++EALP       ++   + W   I+ QF  F  KLP  L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  L++ ++ EL  A+K K  +PD NLLLL+QFI  DAG  +  + I         P       T A E +R ++ + + F++D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+E+S               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     IAD + VIL GFP+Q K                            V+ M SL+HAF+  QLWT+YCE +A   +V N N +   A+ TA++FW  + P+IL L+  +   V +V  H++++ME L EC S    K+I +W P++Q   K L   LQ RLQ                +G          KWL+   F + + E Q S A   F
Sbjct: 1828 TVMADKCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGRLASSTTFS--NQAESMMVPGNAAGVAKQFLRCIFHQLAPNGIFPQLFQSAIKDGT-FLRTLATSLMDF-NELSSIAALSQLLEGLNNKKNLPAGGAMIRCLENIATFMEALP-------MDSPSSLW-TTISNQFQTFFAKLPCVLPLKCSLDSSLRIMICLLKIPSTNATRSLLEPFSKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDTNLLLLVQFICADAGTKLAESTILSKQMIASVPGC----GTAAMECIRQYVSEVLEFMADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMEIS--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASS-PCLPIPLDAGSHIADHLIVILIGFPEQSKT--------------------------CVLHMCSLFHAFIFAQLWTVYCEQSAVATNVQNQNEFSFTAILTALEFWSRVTPSILQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNTKHLSAGLQLRLQAIQNNVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAASQF 2458          

HSP 2 Score: 312.768 bits (800), Expect = 1.053e-84
Identity = 178/539 (33.02%), Postives = 282/539 (52.32%), Query Frame = 1
Query:  643 SIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH---LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P    S          + AW  I C+  EC N  +K  A+KM  DP  ++  G+K PPLY+C +C + +S      L DV+LP  ++   C  K C S    A +TCFS+ C   +G++P+R+C+ CH   H   +GA ++ H+YQ   P I   +C  E   C VEA++SL KE          F  E   +           +      LG+  S  S  + D        DD H  +++S +  + +   C P  NT  E L+R+V+ +F WF+ T + +    G                  +EK+K  ++ KW++ V +   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I+   W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P  VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:   26 SASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHIECHNAINKP-AVKMCIDPSLSVALGDKPPPLYLCEECSERISGDHSEWLIDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGATAETHLYQTSPPPINTRECGAEELVCAVEAVISLLKEA--------EFHAEQREH-----------ELNRRRQLGLSSSHHSLDNTDF---DNKDDDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYMMDDEVG----------------SLVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVISQSVWECIMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSTVQEQALLWLHVLSELDITVPLQLLISMFSDGVNSVKE 521          

HSP 3 Score: 265.003 bits (676), Expect = 3.553e-70
Identity = 186/570 (32.63%), Postives = 289/570 (50.70%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLD-GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            +P+I+ ++L  +  L  H E L   +    + + YI    ++MLI  LW ++ SEFS L+  +VPLL+++ ++  GAD FW I+   F + DW++RF+AVEK+ ++ R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R  S+RS+  S       +RA S+P   +S +          P+ L   + S          P+   G++                   P N     I++ L  D G    T+HQ +T+L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R ST F+AF++ +A+V+D N ++G  +L   + VL++C+ PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y        ++        +LI IT+NT+    H CK               P A    L  D SN S
Sbjct:  772 EPDILFNMLNCLKILCLHGECLYTARKDHPQFLAYIQ---DHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNRQKSVRSLRDSVKGPAESKRALSLPETLTSKI----------PVRLTRHEQSAPAL---GGTPEQTPGQQ------------------SPEND--NTIKDLLPEDAGIDHQTVHQLITVLMKFMAR-DESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQKMRLSTCFNAFIAGIAQVMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYRDCDVSKTLL--------HLIHITVNTLNAQYHSCK---------------PHATAGPLYTDNSNIS 1281          
BLAST of Protein unc-79 homolog vs. Ensembl Mouse
Match: Unc79 (unc-79 homolog [Source:MGI Symbol;Acc:MGI:2684729])

HSP 1 Score: 98.5969 bits (244), Expect = 4.544e-22
Identity = 70/220 (31.82%), Postives = 95/220 (43.18%), Query Frame = 1
Query: 4075 GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDT 4728
            G    T+HQ +T+L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R ST F+AF++ +A                                  QPP  SLW L+P  R  WL  LLV+LYKY Y                + +LI IT+NT+    H CK               P A    L  D SN S  ++   E D+
Sbjct:   57 GIDHQTVHQLITVLMKFMAR-DESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQKMRLSTCFNAFIAGIA----------------------------------QPPRCSLWSLKPHIRQMWLKALLVILYKYPYR--------DCDVSKTLLHLIHITVNTLNAQYHSCK---------------PHATAGPLYTDNSNISRYSEKEKEEDS 218          
BLAST of Protein unc-79 homolog vs. UniProt/SwissProt
Match: sp|Q0KK59|UNC79_MOUSE (Protein unc-79 homolog OS=Mus musculus OX=10090 GN=Unc79 PE=1 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 4.782e-102
Identity = 247/689 (35.85%), Postives = 370/689 (53.70%), Query Frame = 1
Query: 5506 SFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI-VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNG-------LFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            + M ++C+ C AILE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   +++VP N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L + L+DF ++L+    + Q+LEGLN KK +      I  ++N+A ++EALP       ++   + W   I+ QF  F  KLP  L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  L++ ++ EL  A+K K  +PD NLLLL+QFI  DAG  +  + I         P       T A E +R ++ + + F++D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+E+S               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     IAD + VIL GFP+Q K                            V+ M SL+HAF+  QLWT+YCE +A   +V N N +   A+ TA++FW  + P+IL L+  +   V +V  H++++ME L EC S    K+I +W P++Q   K L   LQ RLQ                +G          KWL+   F + + E Q S A   F
Sbjct: 1963 TVMADKCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGRLASSTTFS--NQAESMMVPGNAAGVAKQFLRCIFHQLAPNGIFPQLFQSAIKDGT-FLRTLATSLMDF-NELSSIAALSQLLEGLNNKKNLPAGGAMIRCLENIATFMEALP-------MDSPSSLW-TTISNQFQTFFAKLPCVLPLKCSLDSSLRIMICLLKIPSTNATRSLLEPFSKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDTNLLLLVQFICADAGTKLAESTILSKQMIASVPGC----GTAAMECIRQYVSEVLEFMADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMEIS--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASS-PCLPIPLDAGSHIADHLIVILIGFPEQSKT--------------------------CVLHMCSLFHAFIFAQLWTVYCEQSAVATNVQNQNEFSFTAILTALEFWSRVTPSILQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNTKHLSAGLQLRLQAIQNNVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAASQF 2593          

HSP 2 Score: 372.089 bits (954), Expect = 5.715e-102
Identity = 232/761 (30.49%), Postives = 372/761 (48.88%), Query Frame = 1
Query:  136 TTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNE-------------------------------------------------SYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKL-NNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVY---TWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH---LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            +TK + F +KI+ L+++H+R++  +  +PS  D+  TLKYF  TL SIL  T    N+                                                   G + +D Q+  + +P+  Y  L+  L+ L + +  L + Q  + ++I  T   L+PFL  D L  LP  + S +  FP   H  IIE L T+ +P      +  E   ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P    S          + AW  I C+  EC N  +K  A+KM  DP  ++  G+K PPLY+C +C + +S      L DV+LP  ++   C  K C S    A +TCFS+ C   +G++P+R+C+ CH   H   +GA ++ H+YQ   P I   +C  E   C VEA++SL KE          F  E   +           +      LG+  S  S  + D        DD H  +++S +  + +   C P  NT  E L+R+V+ +F WF+ T + +    G                  +EK+K  ++ KW++ V +   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I+   W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P  VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    2 STKAEQFASKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRTGKKENQDASNLTVPMTMCLFPVPFPLTPSLRPQVSSINPTVTRSLLYSVLRDAPSERGPQSRDAQL--SDYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLNDDVLSTLPYTMISTLATFPPFLHKDIIEYLSTSFLPMAILGSSGREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHIECHNAINKP-AVKMCIDPSLSVALGDKPPPLYLCEECSERISGDHSEWLIDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGATAETHLYQTSPPPINTRECGAEELVCAVEAVISLLKEA--------EFHAEQREH-----------ELNRRRQLGLSSSHHSLDNTDF---DNKDDDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYMMDDEVGS----------------LVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVISQSVWECIMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSTVQEQALLWLHVLSELDITVPLQLLISMFSDGVNSVKE 717          

HSP 3 Score: 159.458 bits (402), Expect = 2.856e-37
Identity = 89/256 (34.77%), Postives = 147/256 (57.42%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVAR 3762
            +P+I+ ++L  +  L  H E L   +    + + YI    ++MLI  LW ++ SEFS L+  +VPLL+++ ++  GAD FW I+   F + DW++RF+AVEK+ ++ R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R
Sbjct:  968 EPDILFNMLNCLKILCLHGECLYTARKDHPQFLAYIQ---DHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNR 1220          

HSP 4 Score: 130.568 bits (327), Expect = 1.553e-28
Identity = 78/209 (37.32%), Postives = 110/209 (52.63%), Query Frame = 1
Query: 4075 GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            G    T+HQ +T+L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R ST F+AF++ +A+V+D N ++G  +L   + VL++C+ PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y        ++        +LI IT+NT+    H CK               P A    L  D SN S
Sbjct: 1271 GIDHQTVHQLITVLMKFMAR-DESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQKMRLSTCFNAFIAGIAQVMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYRDCDVSKTLL--------HLIHITVNTLNAQYHSCK---------------PHATAGPLYTDNSNIS 1455          
BLAST of Protein unc-79 homolog vs. UniProt/SwissProt
Match: sp|Q9P2D8|UNC79_HUMAN (Protein unc-79 homolog OS=Homo sapiens OX=9606 GN=UNC79 PE=2 SV=4)

HSP 1 Score: 371.318 bits (952), Expect = 8.841e-102
Identity = 256/735 (34.83%), Postives = 390/735 (53.06%), Query Frame = 1
Query: 5374 DTKDDPGRRR-PRRSEFLTTDTTVNSTIGSSSSGT-KQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI-VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSV-NSNHYQ-EAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNG-------LFMKWLKKHVFVLGRNEDQHSAATHIF 7536
            D +  P R R   +S  L+  + V+  + +    T +QP       + M ++C+ C AILE YDEETLGLAIV    ++H  P LAAP L D++    ++AS   +S  N   +++VP N    A+QFLRC F+ L PNG+F QLFQ+ I++   F++ L S L+DF ++L+    + Q+LEGLN KK +      I  ++N+A ++EALP       ++   + W   I+ QF  F  KLP  L     +   LRI+I ++K    ++ +SL++ F+ +L F+++   F+L+ ++ELC + YR   KE+ K  L++ ++ EL  A+K K  +PD NLLLL+QFI  DAG  +  + I         P       T A E +R ++++ + F++D+ T+ K+K + K + SQ LHEDT G HLK  +AQ  A+++S               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H  V  N +   C PIPL     +AD + VIL GFP+Q K                           SV+ M SL+HAF+  QLWT+YCE +A   ++ N N +   A+ TA++FW  + P+IL L+  +   V +V  H++++ME L EC S    K+I +W P++Q   K L   LQ RLQ                +G          KWL+   F + + E Q S A   F
Sbjct: 1963 DLEGQPLRMRGATKSSLLSAPSIVSMFVPAPEEFTDEQP-------TVMTDKCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGRLASSTTFS--NQAESMMVPGNAAGVAKQFLRCIFHQLAPNGIFPQLFQSTIKDGT-FLRTLASSLMDF-NELSSIAALSQLLEGLNNKKNLPAGGAMIRCLENIATFMEALP-------MDSPSSLW-TTISNQFQTFFAKLPCVLPLKCSLDSSLRIMICLLKIPSTNATRSLLEPFSKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDTNLLLLVQFICADAGTKLAESTILSKQMIASVPGC----GTAAMECVRQYINEVLDFMADMHTLTKLKSHMK-TCSQPLHEDTFGGHLKVGLAQIAAMDIS--------------RGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASS-PCLPIPLDAGSHVADHLIVILIGFPEQSKT--------------------------SVLHMCSLFHAFIFAQLWTVYCEQSAVATNLQNQNEFSFTAILTALEFWSRVTPSILQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNIKHLSAGLQLRLQAIQNHVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAASQF 2632          

HSP 2 Score: 369.777 bits (948), Expect = 3.208e-101
Identity = 233/762 (30.58%), Postives = 376/762 (49.34%), Query Frame = 1
Query:  136 TTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNE-------------------------------------------------SYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKL-NNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVY---TWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH---LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVG-SGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDH--KVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            +TK + F +KI+ L+++H+R++  +  +PS  D+  TLKYF  TL SIL  T    N+                                                   G + +D Q+  + +P+  Y  L+  L+ L + +  L + Q  + ++I  T   L+PFL  D L  LP  + S +  FP   H  IIE L T+ +P      +  E   ++   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG ++ + PA  +LF+YWP L P    S          + AW  I C+  EC N  +K  A+KM  DP  ++  G+K PPLY+C +C + ++      L DV+LP  ++   C  K C S    A +TCFS+ C   +G++P+R+C+ CH   H   +GA ++ H+YQ   P I   +C  E   C VEA++SL KE      Q+     E +    +G S +  +LD             A F + D        DD H  +++S +  + +   C P  NT  E L+R+V+ +F WF+ T + +    G                  +EK+K  ++ KW++ V +   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I    W+ I+P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P +VQ+Q L WL +L+ + + +P++ L++MFS G+ S+ +
Sbjct:    2 STKAEQFASKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRTGKKENQDASNLTVPMTMCLFPVPFPLTPSLRPQVSSINPTVTRSLLYSVLRDAPSERGPQSRDAQL--SDYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLNDDILSTLPYTMISTLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHIECHNAINKP-AVKMCIDPSLSVALGDKPPPLYLCEECSERIAGDHSEWLIDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGAAAETHLYQTSPPPINTRECGAEELVCAVEAVISLLKEAEFHAEQR---EHELNRRRQLGLSSSHHSLDN------------ADFDNKD--------DDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYMMDDEVGS----------------LVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQSVWECIMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVKE 717          

HSP 3 Score: 160.614 bits (405), Expect = 1.303e-37
Identity = 89/256 (34.77%), Postives = 148/256 (57.81%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVAR 3762
            +P+I+ ++L  +  L  H E L + +    + + YI    ++MLI  LW ++ SEFS L+  +VPLL+++ ++  GAD FW I+   F + DW++RF+AVEK+ ++ R +D     +N  +  SLAHAFC  + A++D+N AVA R    L++IK  +L  +  CL++QFD+V+ DR  IL ++  L +        SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    + +RAR A  R
Sbjct:  968 EPDILFNMLNCLKILCLHGECLYIARKDHPQFLAYIQ---DHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNR 1220          

HSP 4 Score: 132.88 bits (333), Expect = 3.738e-29
Identity = 79/209 (37.80%), Postives = 110/209 (52.63%), Query Frame = 1
Query: 4075 GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            G    T+HQ +T+L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R ST F+AF++ +A+V+D N ++G  +L   + VL++C+ PQ      QPP  SLW L+P  R  WL  LLV+LYKY Y               I+ +LI IT+NT+    H CK               P A    L  D SN S
Sbjct: 1271 GIDHQTVHQLITVLMKFMAK-DESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQKMRLSTCFNAFIAGIAQVMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQQPPRCSLWSLKPHIRQMWLKALLVILYKYPYR--------DCDISKILLHLIHITVNTLNAQYHSCK---------------PHATAGPLYSDNSNIS 1455          
BLAST of Protein unc-79 homolog vs. UniProt/SwissProt
Match: sp|P42173|UNC79_CAEEL (Uncoordinated protein 79 OS=Caenorhabditis elegans OX=6239 GN=unc-79 PE=4 SV=3)

HSP 1 Score: 279.256 bits (713), Expect = 7.164e-77
Identity = 198/681 (29.07%), Postives = 330/681 (48.46%), Query Frame = 1
Query: 5521 RCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGP-------ILRXXXXXXKSNMISSCKS---LMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAAT 7527
            RC  C+  +E +DEET+ L ++    ++HREP++AAP L+ +L    ++    MY W ++   + VP N  S A+Q LR + ++L  + + +QLF T+I   D F   +   L DF +   ++  IQ ++E L +     P ++ +++ NLA Y+  +P+         M N    ++    + F ++  + +  D  + P       ++ ++  + K    SS KS   L++ FA  L   +     SL  +L +C+   R + +E+ K  +T+ L+ EL  AIKFK+ + + N + +   IL DAG  +E       L   FN        T A+E +R  L + + FI+D+  + K+K+          + D LG  LK  +A+ +A+E+S  S++R           D +   +++F+PW+ S P  TQ  P  F   V  VR L+WLLLG++            SC P+P+   + +AD +  +L+GF DQ K                          QSV+ MS+L+HAF LCQLWT+YCE AA++ S        A    +DFW  + P IL LL+ S     +VN H L  ++ L +  S  + ++ ++W PIL   + Q+P  L+ +L  C           +    L  +WLKK  + + + E Q SAA+
Sbjct:  280 RCGHCNEAIEMFDEETISLCLIALETFLHREPSMAAPILFKILYTVTRLIDTPMYPWHST--EMFVPANSRSVAKQMLRVSLHHLSTSAICLQLFDTKIPRPDAFWSVVALSLADFPELSPVYF-IQILMEDLEESW---PGSVKLIMKNLAFYIVEIPT--------DMYNNPWKDLVGHLETFFKRYHSAISADNGITPTRAEIENVIIVMTHVFKVQTFSSSKSPVTLVEAFARWLSESLHSADVSLESLLGVCTACNRALIRERDKQCITRALVTELMQAIKFKVKLHESNYVTIANMILQDAGEDIE----VPLLDDQFN--------TAASEAIRPFLFEVLDFIADLHVIAKLKKES--------NSDALGGDLKVKLAEAIAVEMS-RSNAR-----------DCRT--VIRFIPWLMSPPSVTQAAPSAFADSVTNVRVLSWLLLGAL--------HANHSCLPVPIECSQHMADYIHFVLAGFADQSK--------------------------QSVVHMSALFHAFHLCQLWTVYCERAATYSSTT------AFAHLVDFWARVTPAILQLLSHSKVLADMVNLHFLNTIQALQQVNSALLCQLYSMWAPILTAYHSQIPNQLRMKLDSC-------QNQPSLEAPLVTEWLKKVRYKISQVELQTSAAS 865          

HSP 2 Score: 103.219 bits (256), Expect = 2.145e-20
Identity = 62/184 (33.70%), Postives = 99/184 (53.80%), Query Frame = 1
Query: 4063 LDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGY--TDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIR---ITINTVENHLHVC 4599
            +D++   R T++  V+L + F++N +     DE  + K  S V RH   LLGY  T++ F IPP +LR + V +AF+S + ++LD N   GN +L     +L    SPQ+ ASD     +SL LL   TR  WL  L+++LYKY ++              + +Y++R   I + T++N +H C
Sbjct:    9 VDMENPERHTVYLVVSLFVTFLSNKN-STPTDEKANAKKQSLVFRHFNTLLGYSSTEKCFTIPPARLRKAAVCNAFISGLPEILDMNLHTGNQLLPTVAQLLIHLPSPQKLASDQNVTNYSLALLTQHTRHLWLQSLILILYKYRFDQL-----------PVSEYIVRLIGIVVKTLQNQVHEC 180          
BLAST of Protein unc-79 homolog vs. TrEMBL
Match: A0A2C9LTX0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106057650 PE=4 SV=1)

HSP 1 Score: 870.152 bits (2247), Expect = 0.000e+0
Identity = 556/1585 (35.08%), Postives = 860/1585 (54.26%), Query Frame = 1
Query:  136 TTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLN-NQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECE--SYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCP-------VQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAXXXXXXXXXXXXXXXXXCLCMMVKTIDVQLKMNDPHGHGNMSQQXXXXXXXXXXXXXXXCWSSENCKCKHLXXXXXXXXXXXRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKE--FDISXXXXXXXXXXXXXXXXHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQ-SSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXN------VAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANV-DMQVSKDELK--DKKALSKVQRHLALLLGY--TDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDTPQSPNGLLXXXXXXXXXXXXXTVHYTKKDK 4818
             T+  +F +KI+ LK++H ++I+ V  +P+  D+  TLKYF  TL S+LK+  +IP E+YG R KD  +R+++FP  +Y  L+  ++ + + +  +   Q ++ EA+L     L+PFLE D LD LP  V + +  FP + H   I+LLCT+++P   + +++CE  +YA ES  +I+ ++FQH +   +H+ ++E FMS KR++ KD+L +IAYG   ++ PA +LLFYYWP+L P       + ++     FP      AW AILC+R  C N+ +   A+KM  +P  AI  G+  PPLY+C DC   L +     + D+++P+  V + C++K C+S  N A  TCFS +C S N ++PIR+C  CH ++H  + S  HIY   + DIW C+ E+Q  +++AIVSL KE  P   ++M         V++G   +   D+               ++ D+  AG     + K++S Y  +++ E C P  +  IE+L R++  LF WF  T +      G                  IE++K +Y+  W+Q+V++ + EV+++ LLP+P+EY++VG      C               L+P   I  + WDY++P+WLE +RTE+PE D  EL++L+ K FD    P PF   K+Y F + RF++   AV +Q L WL IL+R+ + IPM ++L MF  G          VD IS+++    L+    S+   GS         +  +   I     L           + +S  +L C  MM+     Q+++ +   H  +  +T    + LLT ML   W  ++                    +    +++  C  CQN+  WHQ+++++++H+ P  P+ +P                   SK+      L K + I++ Q+E+  + EE ++  FD S   + L+L   L++ L     D + + +VL S+TYL+ H E L     TI +  ++I        IP+LW  + +E S LA   VPLL++  T+ +G+   W ++E +F +DDW+ RF AVEK+T+ AR ++  +F  NQ +MTSLAHAFC+LIG+++D+N++VA R + +LE+I+  +L C+V CLE+QFDSVI DR+LIL R+  L  AL    + SW+FF+ RF   S+EAQ+      DI   TDL +    ++ F  +  RAR A+ARTDS+RS+S S      YRRA SVPLH  + GVN   L               +K   RQ SAPQF+L RR    L  G  G N      + E+TD  + F   +Q A+DL+G  RDT++Q V LL+ FM    + +  +D L   D KA + V RH+ +LLGY  T+++F++PP+KLR+S VF+AFLS V  VLD NF +G  IL  TL+VLQ+C SPQRYASD QPPT++LW LEP +RI WL  LLV+LYKY+ + S           AI+  LI++ INTV    H C+  ++G+ PPTP + R  +K    + D  N    +     P + +   G +  S  +     S  VHY K  +
Sbjct:    2 ATRAATFTSKIRNLKEYHYKIINNVAPLPTGIDIANTLKYFSQTLLSVLKDVPSIPVENYGLRQKD-SVRLSIFPTLNYSGLYQAVLSILDLVPTIQIGQLALGEAVLNVLGWLVPFLEHDLLDALPYTVATTLAIFPPTLHKDTIDLLCTSLLPMTLS-SDDCEEPTYASESAAAIITMVFQHTENGAFHSQILECFMSLKRNVIKDVLSIIAYGPPSAKSPAAHLLFYYWPQLNPALSDRRGIHYKYCAMEFP------AWPAILCQRKGCINEGN-CQAVKMCINPALAIHSGDSPPPLYICSDCAQTLKKDHGGYMVDLLMPMPHVSSVCENKNCKSSQNIAVCTCFSIDCASFNSNRPIRYCSSCHERRHGSSGSINHIYHTSIIDIWSCSPELQRYLMDAIVSLLKEATPIGTKRM---------VEMGEDLRRMTDEE--------------ENFDVDDAG-----ERKLLSRYGIWLLVELCKPAEDIPIEVLGRLLGMLFQWFDATAYLPDDNIGNA----------------IERLKPEYIHNWLQEVMKTHFEVIVSCLLPHPVEYSRVG----GFC---------------LMPN--INLKIWDYVMPYWLEAIRTEVPEDDLHELKVLLSKAFDIDMCPLPFTLVKMYNFISDRFDDCSAAVMEQALQWLQILSRLDIVIPMHQILRMFKCG----------VDKISTDSDVADLLQHTHSILTPGSPIREHAAPLSPERFPHIPDPCEL----------YDRESELVLPCFIMMLDLCLKQMELQEAPQHLGIYNETSREVMALLTCMLCKKWDGQH--------------------TCDTETKRVNCTYCQNIALWHQLSAQLMEHVCPRDPLKIP-------------------SKELPKLDDL-KHQTITEAQNESNDQDEEKEDPVFDTSTMPMYLQLYNALLESL-VSVTDVDALFAVLSSLTYLILHGECLNY---TINQYTQFITLSFRRRFIPNLWKHVQTEHSQLATLCVPLLLHCITLPTGSQILWSLVEQDFGHDDWKARFAAVEKITVFARCLEPEVFRNNQIIMTSLAHAFCHLIGSVEDINASVAQRAIMFLETIRPIALKCLVSCLEFQFDSVIEDRSLILHRVQLLETALRDVQILSWEFFLCRFDTLSLEAQVDLESSGDIPYPTDLTSSDRHSELFLKKLNRARFALARTDSVRSVSQSMKGKPPYRRAISVPLHLITKGVNPPKLE-------------REKSCVRQWSAPQFSLPRRMPTKLNLGNFGSNMFPGGQLKEFTDEESNFAALLQRAMDLEGVDRDTVYQLVALLMMFMVQCNEHEEGEDTLSSYDSKAQNIVLRHMNVLLGYNQTEKSFSVPPFKLRSSAVFNAFLSGVMFVLDRNFKLGYVILPITLLVLQYCPSPQRYASDYQPPTYTLWYLEPHSRISWLKSLLVILYKYQISTSPRS--------AIIQTLIQLVINTVSAQHHRCRNSEDGFPPPTPTVQRNLSKIS--VSDLENIQETDTPPQSPSSQKQDTGDIGGSMDVRSHPSSGVVHYFKSSQ 1425          
BLAST of Protein unc-79 homolog vs. TrEMBL
Match: A0A2T7NZ42 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_14107 PE=4 SV=1)

HSP 1 Score: 728.398 bits (1879), Expect = 0.000e+0
Identity = 449/1296 (34.65%), Postives = 700/1296 (54.01%), Query Frame = 1
Query:  889 AWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAXXXXXXXXXXXXXXXXXCLCMMVKTIDVQLKMNDPHGHGNMSQQXXXXXXXXXXXXXXXCWSSENCKCKHLXXXXXXXXXXXRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISXXXXXXXXXXXXXXXXHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRK------SKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGY--TDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSM-DNDISGEPDT-PQSPNG 4746
            AW  ILC+R  C N +    A+KM  +P  AI  G+  PPLY+C DC + L  +    + D++LP+  V TTC++K C+S  N A  TCFS EC S NG++PIR+C  CH Q+H      +H++ L + DIW C+ E+   +++AIVSL KE  P   ++M         V++G   +  +++         + F + +D            + K++S Y  +++ E C P+ +  IE+L R++  LF WF  T +      G                  +EK+K +Y+  W+Q V++ + EV++  LLP+P+EY++VG  W++LC RT Q+K+GL+    L+PY+IITFE WDY++P+WLE++R E+PE +  EL++L+ K FD    P PF   K+Y F + RF +   +VQ+QVL WL IL+ + + IPM  LL +F  G++ +   +   + + ++A   S+++Q      + S              D  + +  L                  L C  +M+  +  Q+++ +   H  +  +T  L + LL +M+   W  ++                    S  + +++  C+ CQN+  WHQ+ S++++H+ P  P+ LP  +L     ++  K++  +    T  +   +E+K  D   +A     ++ +  I   +                 +D + + ++L S+ +L+ H E L     TI +   YI   ++   IP  W L+ +  S+LA   VPLL++  T+ +GA   W ++E +F++DDW+VRF AVEK+T+LAR ++  M   NQ + TSLAHAFC+++G+++D+NSAVA RT+ +LE+I+   L C+++CLE+QFD+VI DR LIL RI  LS+ L    + +WDFF++RF   S+EAQ+      DI   TDL +    ++ F  +  RARLA+ARTDSIRS+S S      YRRA SVPLH         +   V P     K   DK   RQ SAPQFNL RR       S        G ++ E+TD  + F   +Q A+DL+G  RD +H  V LL+K    + + +  +          V RHL +LLGY  T+++F++PP+KLR S VF+AF+S V  VLD NF +GN+IL  TL++LQ+  SPQRYASD QPP ++LW LEP TR+ WL   LV+LYKY+ +             AI+  L+++ INTVE   H C++ D+ +  PTP + R +A       D S  S+ D +   E DT PQSP+ 
Sbjct:  192 AWPPILCQRKGCIN-SGNCQAVKMCLNPALAIHSGDMPPPLYICSDCAEFLHHEHGDYMVDLLLPMPHVSTTCENKNCKSDKNIAICTCFSIECASYNGNRPIRYCASCHEQRHGQPDCPQHVFHLSITDIWSCSPEVMRYLMDAIVSLLKEASPLGTKRM---------VEMGEEHRQTIEE---------EEFFNVEDTG----------ERKLLSRYGIWLLVELCTPQEDIPIEVLGRLLGMLFQWFDATAYLPDDNVGNA----------------LEKLKPEYVFNWLQGVMQTHFEVIVACLLPHPVEYSRVGGFWETLCTRTTQIKEGLNCFFCLVPYNIITFEIWDYVMPYWLESIRMEVPEDELMELKVLLSKAFDIDMCPLPFTLEKMYNFVSNRFEDPSASVQEQVLQWLQILSSLDIIIPMHLLLKIFKSGVEHIQSDVREAEELQAQALPQSVLYQTSPAHEAVSPMSPQRFPVAPDPCDLYERDTELV-----------------LPCFIIMLDILLKQMELQETPRHLGIYNETTRLVMSLLREMMCKKWDGQH--------------------SCDNETKRINCMYCQNIALWHQLASQLMEHVCPRDPLKLPPKDLPK---AEEVKHQTISESPRTENAPTYREDKDKDFSIDAMPVYLQLYDALIEALANV---------------DDTDALFALLTSLKFLILHGESLNY---TINQYTNYITFTLDKTFIPMQWQLLQTARSHLATLIVPLLLHCMTLPTGATVLWHLVEDDFSSDDWKVRFAAVEKVTVLARCLESEMVRNNQVLQTSLAHAFCHMVGSVEDINSAVAQRTIMFLETIQPAGLKCLIQCLEFQFDTVIRDRCLILHRIQLLSFVLMKERILTWDFFLSRFDTLSLEAQVDLESTGDITCPTDLTSSDRHSEHFLKKVNRARLALARTDSIRSVSQSLKGKPPYRRAVSVPLHL--------ITKGVAP----PKVEKDKSCVRQWSAPQFNLTRRMTTKLNLSSFSHTMFPGGHLREFTDEESNFAALLQRAMDLEGIDRDVVHHLVALLMKVRTAL-LSIGTN---------VVLRHLNVLLGYNQTEKSFSVPPFKLRCSAVFNAFISGVPFVLDRNFKLGNTILPITLLLLQYSPSPQRYASDYQPPNYTLWYLEPHTRLSWLRAFLVILYKYQIS--------TSPVSAIIQTLVQLVINTVEAQHHRCRKTDDSFLVPTPTVHRSKA-------DLSKMSISDLENIQETDTPPQSPSS 1347          

HSP 2 Score: 488.034 bits (1255), Expect = 8.417e-136
Identity = 294/764 (38.48%), Postives = 428/764 (56.02%), Query Frame = 1
Query: 5305 KPNYRQRKARKSGLTSVEIQKILD---------------TKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYH-RQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXS--NGLFMKWLKKHVFVLGRNEDQHSAATHIFV 7539
            KPN+RQRK RK+GLT++E+Q+                  +   P  RR RR+E L    T          G K+P+ + R  E+ +VERC++C+ +LE YD+ET+GL+I     ++HREP LA P L +ML   +++AS + YSW+    N+++P N VS ARQFLRC  + + PNG+F  LFQ+ +++ + F K +   L+DF ++L    P+  +LEGLN++K +  E + +++ NL+ YL         V +   +  W  NI  QFDIF R+LP+ L    +V P+L III ++K  +I++ +                                    E+ K LLT+ +I EL  A++FK  VPD NLL+++QF+++DAGGT+         ++L+   +  ++ T AAE MR HL DCI FI D++T+ KVK N K  GS SL+EDTLGS LKS IAQY+ALE++  +            G D +   I ++LPW+   P A QQG +EF  C+  +R L+WLL+GS+ +T VT     +SC P+PL     IAD V VI++GF  Q                             +V  MSSL+HAF+LCQLWTMY E+AA+ H+ +S  +Q  +   MDFW  + P IL LL+ S     +VN H L++ME L EC S  +AK+  +WTPIL   + QLPG+LQ RLQ  + WEPP P    +S  + + + WLK+  F LG+ E Q +AAT I+V
Sbjct: 1591 KPNFRQRKERKTGLTTIELQRKFPDLYEAATKLHDEASCSAAKPAGRRARRAELLAKTQT---------GGNKKPISNARCGENVIVERCSECNLVLEQYDDETIGLSITVLATFIHREPTLATPMLLNMLQCVSRVASSSQYSWQAE-SNIIIPGNSVSIARQFLRCVLHQMAPNGIFPMLFQSNLDDPN-FFKTMACALMDF-NELQSHAPLLYLLEGLNERKNVPQETVTLMLHNLSTYLSC-------VSLESSVPMWT-NILTQFDIFFRRLPSALPNACNVEPVLTIIITLLKVYVITNVR------------------------------------ERDKLLLTRTVIFELVQAMRFKSVVPDDNLLMMVQFVVLDAGGTLCLTNSLSEASALYTAQSQTLISTCAAECMRQHLPDCIYFIEDLETLTKVKSNTK-GGSSSLNEDTLGSQLKSGIAQYIALEIARGN------------GRDQR--AITRYLPWLYHPPSAMQQGQKEFEDCIGHIRLLSWLLIGSLTNTAVTEGSAPVSCLPVPLEASPHIADHVMVIMTGFAKQSNA--------------------------TVQHMSSLFHAFILCQLWTMYSESAAAIHAPSSEQHQTDLAMIMDFWARVTPGILQLLSHSKVLAEMVNLHFLSLMEALQECNSSVLAKLFPMWTPILYTYHAQLPGHLQVRLQTVLNWEPPHPTKDQSSFNSYILLTWLKRIQFKLGQIEIQSAAATQIYV 2257          

HSP 3 Score: 137.887 bits (346), Expect = 3.055e-28
Identity = 73/194 (37.63%), Postives = 115/194 (59.28%), Query Frame = 1
Query:  139 TKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDV---QMRINLFPNFHYDELFYLLIGLCEFIGKLN-NQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECE-SYAIESIPSILQIIFQHIDKSEYHAW 705
            T+  +F +KI+ LKDFH R+ + +   P+  D+  TLKYF  TL S+LK+  +IP ESYG + +D     +R+++FPN +Y  L+  ++G+ + +  +   Q  V EA+L     L+PFLE D LD LP  V S +  FP + H   I+LLC +++P    ++   E +YA ES  +I+ ++FQH   +E  AW
Sbjct:    3 TRAATFTSKIRNLKDFHYRITNNLTTQPTGTDIANTLKYFSQTLLSVLKDVPSIPAESYGPKQRDSVRDSVRLSIFPNLNYSGLYEAVLGIIDLVPLIQIGQLDVGEAVLNVLGCLVPFLEHDLLDSLPYTVASTLAIFPPTLHKDTIDLLCCSLLPMTLGYDGCSEPTYASESAAAIITMVFQH---TENGAW 193          
BLAST of Protein unc-79 homolog vs. TrEMBL
Match: A0A4S2MDX0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000752 PE=4 SV=1)

HSP 1 Score: 711.064 bits (1834), Expect = 0.000e+0
Identity = 355/794 (44.71%), Postives = 501/794 (63.10%), Query Frame = 1
Query:  130 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH------------------------LGA---------QSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQM---NFAEESSNNVDVGSGAK------------------GNLDQGSPSMLGVIKS---------------FASFQD-----------------------NDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMH 2235
            M+  +TQ+F++K+K L++  S+L    G IPSS DV + LKYF   L    KE   +    +  R+ D + R+   P   Y +L+  ++ L E   KL NQS+VC+ +++T + L+ FL++D L+ +PL ++  + +FP++  +++IEL+C  VIP VY   ++ ESYAI+SIPSIL ++FQH++K EYH WVVESF+SKK++L KDLLL+IAYG TE+R+PA  LLF+YWPE+ P  F ++Q   P  Y  E WK + C+RT+CPNKA K  AMKMT +P+ A   G K PPLYVCLDC DAL+R+    L D++LP K++   C+SKTCRSKNN A +TC+S++CT L G++ IRFC+ CH  +H                        LG           S +HIYQ+ LPD+WD  +++Q  MVEAIVSL +ET+PRWRQ +     A +   NV   SG                    G    GS +  G++ S               +A F                          ++ L G+Y+++DHKV+++Y A ++GEKC P+   NIE+L+RI +G+FNWF DT++T   G G D  + GT + +Y + + +EK+K +Y+LKWIQ+V   + E +  VLLP+P+E+A+VGSCWD+LCDRT QVK GL +I SLIPYDI+TFETWD+++P+WLE++RTE+P +DY ELEIL+KKIFD  AGPFPFLP K+Y FA +RF +TP +VQDQ L WL+ILT ++V IPMKELLTMF  G++   
Sbjct:    1 MSNQRTQTFSSKLKLLQESCSKLSGITGNIPSSSDVISYLKYFQSALHGFAKEIQELQISRFENRLNDHEWRLQFLPQLAYGDLYLCILNLSENAQKLGNQSAVCDHLMRTLHNLMIFLDYDCLEGVPLALSWMLTYFPAAAQSSVIELMCAVVIPLVYNCKDDQESYAIDSIPSILTLVFQHVEKIEYHVWVVESFLSKKKELHKDLLLIIAYGPTEARLPAVCLLFHYWPEIYPPGFHANQTLRPLHYVWEPWKPLTCDRTDCPNKAGKAFAMKMTVNPRIAAQHGGKPPPLYVCLDCADALNRRDFDQLVDILLPSKQISLICESKTCRSKNNQAAVTCYSTDCTFLTGNRAIRFCDACHTLRHSYGQATSSASVSSRTESRTTTSEPLGGTLSTTVRARHSGQHIYQMSLPDVWDMALDLQSSMVEAIVSLTRETMPRWRQILLGGGDAADDGTNVRAVSGLTCTGPNPPGGPPSGDMMLLGVNPPGSATGHGLLTSTGTGMQTMGITQCSPYAEFGQGTTSGSRGIAGLTPTGTNASGEVGELSLIGRYTEEDHKVLAVYGALLVGEKCWPREFLNIELLTRITAGIFNWFLDTIYTAEAGSGYD--VRGTFRQRYEVGDLLEKVKSEYILKWIQEVQRLHPEAIFAVLLPHPLEHARVGSCWDALCDRTTQVKHGLSRIGSLIPYDIVTFETWDFVMPYWLESIRTEVPRADYFELEILLKKIFDATAGPFPFLPQKVYHFAAERFISTPPSVQDQALAWLEILTSVEVPIPMKELLTMFRNGVEGFQ 792          

HSP 2 Score: 418.698 bits (1075), Expect = 1.493e-113
Identity = 204/403 (50.62%), Postives = 288/403 (71.46%), Query Frame = 1
Query: 5518 ERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNT-WLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPN--SSSRVTYSAISMAG 6717
            ERC  CH +LE YDE TLGL ++C   +VHREP+LAAPYL DML+++A++ + ++YSW+ +L +++VP NV S ARQFLRCT YNL PNGLF+QLFQT I +   F +C++SVL+DFE+ ++ FQP+ Q+LE LNK+K +  + LP++++N+A+YLE LP+L +DVK+NH + + W   I P  D+FLRKL       +++   +RI+  I+++ + S+ K+L DTF+ +L+ IVE   F LS ++ELCS++ R  KE+ K  LTK L+E  H AIKF+I +PD+NL+ L+QFILMDAGGT+EPN++ EGLT+LFNP TYH+  TGAAELMR HL DCIAF+SDV T+HKVKQ QKL+   ++H    G +     A  V     PN  +S+ +  S   M+G
Sbjct: 2415 ERCPWCHQVLERYDESTLGLGMLCLATFVHREPSLAAPYLKDMLLIAARLTNTSLYSWQTNLPHIIVPGNVASIARQFLRCTMYNLAPNGLFLQLFQTPIPDEH-FFRCIISVLVDFEEHMSFFQPVLQLLEALNKRKTLPTDTLPVLLENIASYLEHLPNLTDDVKVNHFIASGWADTIGP-LDLFLRKLATVTPIPSNLATTVRIMTYILRAPVASNFKTLPDTFSAILRLIVENVPFRLSSVIELCSLSSRTLKERTKIQLTKTLVELFHQAIKFRISIPDENLVKLLQFILMDAGGTLEPNQVVEGLTTLFNPQTYHLFSTGAAELMRPHLTDCIAFLSDVHTMHKVKQAQKLAIQLNIHVVGGGPYPGVNPANGVCGNGPPNLGASAGLMSSGTGMSG 2815          

HSP 3 Score: 349.362 bits (895), Expect = 1.971e-92
Identity = 191/423 (45.15%), Postives = 257/423 (60.76%), Query Frame = 1
Query: 3355 ENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSV----------PLHQSS------GVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVA----EYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQV----------------------SKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYN 4497
            E+  + ++LAHAFC L+G+L+D NS +A  T   L S+ + +L C ++CLE+QFD+VIADR LIL R++QLS  L  R VF+W+FF+NRFG+ +++AQ+      DI+ VTDLN     +  F+ QFERA  A+++   +RS+S  +    L   ACSV          P  Q S      G +    +S       I+     +    +   P F   RR+   +    G  +      E+ D +N+F  NI+ ALD D   RDTLH WV LLL+FM+ +++                        +KDEL+D+KALSK QRHLA LLGY D AFNIPP+ LRNSTVFH+FL++V  VLD N+ MG+ ILHQTLVVLQ+CASPQRYA+D+QPPTFSL LLEPQ R+ WL  LLV+LYKYEY+
Sbjct: 1464 ESPLLRSALAHAFCCLVGSLNDSNSIIAQYTASQLASLNNTALLCGIQCLEFQFDTVIADRCLILQRMHQLSSTLQNRQVFTWEFFVNRFGLLALQAQMTATGQQDIDAVTDLNGYHRNSQHFQSQFERACFAISKCTGLRSVSELSRAKALRSTACSVAAVTQSQLPAPAAQRSSYIDPGGGSQRGANSERNATGNISPTGDGQETASRPQTPHFQSSRRERPSMASFTGFFSSGPAGMEFMDSSNKFFCNIRNALDQDSEERDTLHLWVRLLLRFMSTIELDARPDDTSSGSGSLSGSGRHSVATAKDELRDRKALSKAQRHLAFLLGYADGAFNIPPHTLRNSTVFHSFLAHVMGVLDRNYGMGSCILHQTLVVLQYCASPQRYATDTQPPTFSLRLLEPQIRLDWLQTLLVILYKYEYS 1886          

HSP 4 Score: 270.396 bits (690), Expect = 2.074e-68
Identity = 126/253 (49.80%), Postives = 177/253 (69.96%), Query Frame = 1
Query: 6673 NSSSRV-TYSAISMAGADSK----DSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEW 7416
             SS R+ T+  +++A   S+    D+P+L  LPW+KSIPP++Q GPR+F++ V+RVRTL+WLLLG+ ++  +T   TG++C+P+P    +++ADLVK +LS FPDQQK                          QSV VMSSLYHAF+LCQ+WT+YCETAAS    +S  ++ AV TA+DFW  I+PT+L LL+IS+DFV+V+G LLT+MEEL+EC+   V K+  +W P+L GR++QLPGN+ KRLQKC+EW
Sbjct: 3049 TSSPRLGTHGHVTLAPTSSQNSQLDAPVLHLLPWLKSIPPSSQLGPRDFLVMVERVRTLSWLLLGATMNMALTREATGLACRPVPFVLVRAVADLVKALLSSFPDQQK--------------------------QSVTVMSSLYHAFLLCQVWTVYCETAASLSPAHSTQHKAAVATAVDFWTRIMPTVLRLLSISEDFVIVSGRLLTVMEELMECQCAVVTKLFPVWIPMLCGRHRQLPGNMLKRLQKCIEW 3275          

HSP 5 Score: 93.2041 bits (230), Expect = 1.104e-14
Identity = 38/80 (47.50%), Postives = 60/80 (75.00%), Query Frame = 1
Query: 3100 KIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVD 3339
            +  +I++L+   LIP+LW L+ SE S+LA ++VPLL++   +  GA  FW I+E+ F +DDWRVRFDA+E++T+L R++D
Sbjct: 1296 QANFIHYLVHCHLIPNLWGLLKSELSHLASWTVPLLLHCILLPGGAKVFWRIVESAFGHDDWRVRFDAIERVTVLMRELD 1375          
BLAST of Protein unc-79 homolog vs. TrEMBL
Match: A0A4V3SH41 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000752 PE=4 SV=1)

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 355/794 (44.71%), Postives = 501/794 (63.10%), Query Frame = 1
Query:  130 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH------------------------LGA---------QSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQM---NFAEESSNNVDVGSGAK------------------GNLDQGSPSMLGVIKS---------------FASFQD-----------------------NDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMH 2235
            M+  +TQ+F++K+K L++  S+L    G IPSS DV + LKYF   L    KE   +    +  R+ D + R+   P   Y +L+  ++ L E   KL NQS+VC+ +++T + L+ FL++D L+ +PL ++  + +FP++  +++IEL+C  VIP VY   ++ ESYAI+SIPSIL ++FQH++K EYH WVVESF+SKK++L KDLLL+IAYG TE+R+PA  LLF+YWPE+ P  F ++Q   P  Y  E WK + C+RT+CPNKA K  AMKMT +P+ A   G K PPLYVCLDC DAL+R+    L D++LP K++   C+SKTCRSKNN A +TC+S++CT L G++ IRFC+ CH  +H                        LG           S +HIYQ+ LPD+WD  +++Q  MVEAIVSL +ET+PRWRQ +     A +   NV   SG                    G    GS +  G++ S               +A F                          ++ L G+Y+++DHKV+++Y A ++GEKC P+   NIE+L+RI +G+FNWF DT++T   G G D  + GT + +Y + + +EK+K +Y+LKWIQ+V   + E +  VLLP+P+E+A+VGSCWD+LCDRT QVK GL +I SLIPYDI+TFETWD+++P+WLE++RTE+P +DY ELEIL+KKIFD  AGPFPFLP K+Y FA +RF +TP +VQDQ L WL+ILT ++V IPMKELLTMF  G++   
Sbjct:    1 MSNQRTQTFSSKLKLLQESCSKLSGITGNIPSSSDVISYLKYFQSALHGFAKEIQELQISRFENRLNDHEWRLQFLPQLAYGDLYLCILNLSENAQKLGNQSAVCDHLMRTLHNLMIFLDYDCLEGVPLALSWMLTYFPAAAQSSVIELMCAVVIPLVYNCKDDQESYAIDSIPSILTLVFQHVEKIEYHVWVVESFLSKKKELHKDLLLIIAYGPTEARLPAVCLLFHYWPEIYPPGFHANQTLRPLHYVWEPWKPLTCDRTDCPNKAGKAFAMKMTVNPRIAAQHGGKPPPLYVCLDCADALNRRDFDQLVDILLPSKQISLICESKTCRSKNNQAAVTCYSTDCTFLTGNRAIRFCDACHTLRHSYGQATSSASVSSRTESRTTTSEPLGGTLSTTVRARHSGQHIYQMSLPDVWDMALDLQSSMVEAIVSLTRETMPRWRQILLGGGDAADDGTNVRAVSGLTCTGPNPPGGPPSGDMMLLGVNPPGSATGHGLLTSTGTGMQTMGITQCSPYAEFGQGTTSGSRGIAGLTPTGTNASGEVGELSLIGRYTEEDHKVLAVYGALLVGEKCWPREFLNIELLTRITAGIFNWFLDTIYTAEAGSGYD--VRGTFRQRYEVGDLLEKVKSEYILKWIQEVQRLHPEAIFAVLLPHPLEHARVGSCWDALCDRTTQVKHGLSRIGSLIPYDIVTFETWDFVMPYWLESIRTEVPRADYFELEILLKKIFDATAGPFPFLPQKVYHFAAERFISTPPSVQDQALAWLEILTSVEVPIPMKELLTMFRNGVEGFQ 792          

HSP 2 Score: 418.698 bits (1075), Expect = 1.621e-113
Identity = 204/403 (50.62%), Postives = 288/403 (71.46%), Query Frame = 1
Query: 5518 ERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNT-WLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPN--SSSRVTYSAISMAG 6717
            ERC  CH +LE YDE TLGL ++C   +VHREP+LAAPYL DML+++A++ + ++YSW+ +L +++VP NV S ARQFLRCT YNL PNGLF+QLFQT I +   F +C++SVL+DFE+ ++ FQP+ Q+LE LNK+K +  + LP++++N+A+YLE LP+L +DVK+NH + + W   I P  D+FLRKL       +++   +RI+  I+++ + S+ K+L DTF+ +L+ IVE   F LS ++ELCS++ R  KE+ K  LTK L+E  H AIKF+I +PD+NL+ L+QFILMDAGGT+EPN++ EGLT+LFNP TYH+  TGAAELMR HL DCIAF+SDV T+HKVKQ QKL+   ++H    G +     A  V     PN  +S+ +  S   M+G
Sbjct: 2408 ERCPWCHQVLERYDESTLGLGMLCLATFVHREPSLAAPYLKDMLLIAARLTNTSLYSWQTNLPHIIVPGNVASIARQFLRCTMYNLAPNGLFLQLFQTPIPDEH-FFRCIISVLVDFEEHMSFFQPVLQLLEALNKRKTLPTDTLPVLLENIASYLEHLPNLTDDVKVNHFIASGWADTIGP-LDLFLRKLATVTPIPSNLATTVRIMTYILRAPVASNFKTLPDTFSAILRLIVENVPFRLSSVIELCSLSSRTLKERTKIQLTKTLVELFHQAIKFRISIPDENLVKLLQFILMDAGGTLEPNQVVEGLTTLFNPQTYHLFSTGAAELMRPHLTDCIAFLSDVHTMHKVKQAQKLAIQLNIHVVGGGPYPGVNPANGVCGNGPPNLGASAGLMSSGTGMSG 2808          

HSP 3 Score: 349.362 bits (895), Expect = 2.105e-92
Identity = 191/423 (45.15%), Postives = 257/423 (60.76%), Query Frame = 1
Query: 3355 ENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSV----------PLHQSS------GVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVA----EYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQV----------------------SKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYN 4497
            E+  + ++LAHAFC L+G+L+D NS +A  T   L S+ + +L C ++CLE+QFD+VIADR LIL R++QLS  L  R VF+W+FF+NRFG+ +++AQ+      DI+ VTDLN     +  F+ QFERA  A+++   +RS+S  +    L   ACSV          P  Q S      G +    +S       I+     +    +   P F   RR+   +    G  +      E+ D +N+F  NI+ ALD D   RDTLH WV LLL+FM+ +++                        +KDEL+D+KALSK QRHLA LLGY D AFNIPP+ LRNSTVFH+FL++V  VLD N+ MG+ ILHQTLVVLQ+CASPQRYA+D+QPPTFSL LLEPQ R+ WL  LLV+LYKYEY+
Sbjct: 1464 ESPLLRSALAHAFCCLVGSLNDSNSIIAQYTASQLASLNNTALLCGIQCLEFQFDTVIADRCLILQRMHQLSSTLQNRQVFTWEFFVNRFGLLALQAQMTATGQQDIDAVTDLNGYHRNSQHFQSQFERACFAISKCTGLRSVSELSRAKALRSTACSVAAVTQSQLPAPAAQRSSYIDPGGGSQRGANSERNATGNISPTGDGQETASRPQTPHFQSSRRERPSMASFTGFFSSGPAGMEFMDSSNKFFCNIRNALDQDSEERDTLHLWVRLLLRFMSTIELDARPDDTSSGSGSLSGSGRHSVATAKDELRDRKALSKAQRHLAFLLGYADGAFNIPPHTLRNSTVFHSFLAHVMGVLDRNYGMGSCILHQTLVVLQYCASPQRYATDTQPPTFSLRLLEPQIRLDWLQTLLVILYKYEYS 1886          

HSP 4 Score: 270.396 bits (690), Expect = 2.197e-68
Identity = 126/253 (49.80%), Postives = 177/253 (69.96%), Query Frame = 1
Query: 6673 NSSSRV-TYSAISMAGADSK----DSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEW 7416
             SS R+ T+  +++A   S+    D+P+L  LPW+KSIPP++Q GPR+F++ V+RVRTL+WLLLG+ ++  +T   TG++C+P+P    +++ADLVK +LS FPDQQK                          QSV VMSSLYHAF+LCQ+WT+YCETAAS    +S  ++ AV TA+DFW  I+PT+L LL+IS+DFV+V+G LLT+MEEL+EC+   V K+  +W P+L GR++QLPGN+ KRLQKC+EW
Sbjct: 3042 TSSPRLGTHGHVTLAPTSSQNSQLDAPVLHLLPWLKSIPPSSQLGPRDFLVMVERVRTLSWLLLGATMNMALTREATGLACRPVPFVLVRAVADLVKALLSSFPDQQK--------------------------QSVTVMSSLYHAFLLCQVWTVYCETAASLSPAHSTQHKAAVATAVDFWTRIMPTVLRLLSISEDFVIVSGRLLTVMEELMECQCAVVTKLFPVWIPMLCGRHRQLPGNMLKRLQKCIEW 3268          

HSP 5 Score: 93.2041 bits (230), Expect = 1.095e-14
Identity = 38/80 (47.50%), Postives = 60/80 (75.00%), Query Frame = 1
Query: 3100 KIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVD 3339
            +  +I++L+   LIP+LW L+ SE S+LA ++VPLL++   +  GA  FW I+E+ F +DDWRVRFDA+E++T+L R++D
Sbjct: 1296 QANFIHYLVHCHLIPNLWGLLKSELSHLASWTVPLLLHCILLPGGAKVFWRIVESAFGHDDWRVRFDAIERVTVLMRELD 1375          
BLAST of Protein unc-79 homolog vs. TrEMBL
Match: A0A4S2MDY3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000752 PE=4 SV=1)

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 350/794 (44.08%), Postives = 495/794 (62.34%), Query Frame = 1
Query:  130 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH------------------------LGA---------QSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQM---NFAEESSNNVDVGSGAK------------------GNLDQGSPSMLGVIKS---------------FASFQD-----------------------NDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMH 2235
            M+  +TQ+F++K+K L++  S+L    G IPSS DV + LKYF   L    KE   +    +  R+ D + R+   P   Y +L+  ++ L E   KL NQS+VC+ +++T + L+ FL++D L+ +PL ++  + +FP++  +++IEL+C  VIP VY   ++ ESYAI+SIPSIL ++FQH++K EYH WVVESF+SKK++L KDLLL+IAYG TE+R+PA  LLF+YWPE+ P  F ++Q   P  Y  E WK + C+RT+CPNKA K  AMKMT +P+ A   G K PPLYVCLDC DAL+R+    L D++LP K++   C+SKTCRSKNN A +TC+S++CT L G++ IRFC+ CH  +H                        LG           S +HIYQ+ LPD+WD  +++Q  MVEAIVSL +ET+PRWRQ +     A +   NV   SG                    G    GS +  G++ S               +A F                          ++ L G+Y+++DHKV+++Y A ++GEKC P+   NIE+L+RI +G+FNWF DT++T               +D+  + + +EK+K +Y+LKWIQ+V   + E +  VLLP+P+E+A+VGSCWD+LCDRT QVK GL +I SLIPYDI+TFETWD+++P+WLE++RTE+P +DY ELEIL+KKIFD  AGPFPFLP K+Y FA +RF +TP +VQDQ L WL+ILT ++V IPMKELLTMF  G++   
Sbjct:    1 MSNQRTQTFSSKLKLLQESCSKLSGITGNIPSSSDVISYLKYFQSALHGFAKEIQELQISRFENRLNDHEWRLQFLPQLAYGDLYLCILNLSENAQKLGNQSAVCDHLMRTLHNLMIFLDYDCLEGVPLALSWMLTYFPAAAQSSVIELMCAVVIPLVYNCKDDQESYAIDSIPSILTLVFQHVEKIEYHVWVVESFLSKKKELHKDLLLIIAYGPTEARLPAVCLLFHYWPEIYPPGFHANQTLRPLHYVWEPWKPLTCDRTDCPNKAGKAFAMKMTVNPRIAAQHGGKPPPLYVCLDCADALNRRDFDQLVDILLPSKQISLICESKTCRSKNNQAAVTCYSTDCTFLTGNRAIRFCDACHTLRHSYGQATSSASVSSRTESRTTTSEPLGGTLSTTVRARHSGQHIYQMSLPDVWDMALDLQSSMVEAIVSLTRETMPRWRQILLGGGDAADDGTNVRAVSGLTCTGPNPPGGPPSGDMMLLGVNPPGSATGHGLLTSTGTGMQTMGITQCSPYAEFGQGTTSGSRGIAGLTPTGTNASGEVGELSLIGRYTEEDHKVLAVYGALLVGEKCWPREFLNIELLTRITAGIFNWFLDTIYTA--------------EDE--VGDLLEKVKSEYILKWIQEVQRLHPEAIFAVLLPHPLEHARVGSCWDALCDRTTQVKHGLSRIGSLIPYDIVTFETWDFVMPYWLESIRTEVPRADYFELEILLKKIFDATAGPFPFLPQKVYHFAAERFISTPPSVQDQALAWLEILTSVEVPIPMKELLTMFRNGVEGFQ 778          

HSP 2 Score: 418.698 bits (1075), Expect = 1.457e-113
Identity = 204/403 (50.62%), Postives = 288/403 (71.46%), Query Frame = 1
Query: 5518 ERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNT-WLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPN--SSSRVTYSAISMAG 6717
            ERC  CH +LE YDE TLGL ++C   +VHREP+LAAPYL DML+++A++ + ++YSW+ +L +++VP NV S ARQFLRCT YNL PNGLF+QLFQT I +   F +C++SVL+DFE+ ++ FQP+ Q+LE LNK+K +  + LP++++N+A+YLE LP+L +DVK+NH + + W   I P  D+FLRKL       +++   +RI+  I+++ + S+ K+L DTF+ +L+ IVE   F LS ++ELCS++ R  KE+ K  LTK L+E  H AIKF+I +PD+NL+ L+QFILMDAGGT+EPN++ EGLT+LFNP TYH+  TGAAELMR HL DCIAF+SDV T+HKVKQ QKL+   ++H    G +     A  V     PN  +S+ +  S   M+G
Sbjct: 2394 ERCPWCHQVLERYDESTLGLGMLCLATFVHREPSLAAPYLKDMLLIAARLTNTSLYSWQTNLPHIIVPGNVASIARQFLRCTMYNLAPNGLFLQLFQTPIPDEH-FFRCIISVLVDFEEHMSFFQPVLQLLEALNKRKTLPTDTLPVLLENIASYLEHLPNLTDDVKVNHFIASGWADTIGP-LDLFLRKLATVTPIPSNLATTVRIMTYILRAPVASNFKTLPDTFSAILRLIVENVPFRLSSVIELCSLSSRTLKERTKIQLTKTLVELFHQAIKFRISIPDENLVKLLQFILMDAGGTLEPNQVVEGLTTLFNPQTYHLFSTGAAELMRPHLTDCIAFLSDVHTMHKVKQAQKLAIQLNIHVVGGGPYPGVNPANGVCGNGPPNLGASAGLMSSGTGMSG 2794          

HSP 3 Score: 349.362 bits (895), Expect = 1.895e-92
Identity = 191/423 (45.15%), Postives = 257/423 (60.76%), Query Frame = 1
Query: 3355 ENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSV----------PLHQSS------GVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVA----EYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQV----------------------SKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYN 4497
            E+  + ++LAHAFC L+G+L+D NS +A  T   L S+ + +L C ++CLE+QFD+VIADR LIL R++QLS  L  R VF+W+FF+NRFG+ +++AQ+      DI+ VTDLN     +  F+ QFERA  A+++   +RS+S  +    L   ACSV          P  Q S      G +    +S       I+     +    +   P F   RR+   +    G  +      E+ D +N+F  NI+ ALD D   RDTLH WV LLL+FM+ +++                        +KDEL+D+KALSK QRHLA LLGY D AFNIPP+ LRNSTVFH+FL++V  VLD N+ MG+ ILHQTLVVLQ+CASPQRYA+D+QPPTFSL LLEPQ R+ WL  LLV+LYKYEY+
Sbjct: 1450 ESPLLRSALAHAFCCLVGSLNDSNSIIAQYTASQLASLNNTALLCGIQCLEFQFDTVIADRCLILQRMHQLSSTLQNRQVFTWEFFVNRFGLLALQAQMTATGQQDIDAVTDLNGYHRNSQHFQSQFERACFAISKCTGLRSVSELSRAKALRSTACSVAAVTQSQLPAPAAQRSSYIDPGGGSQRGANSERNATGNISPTGDGQETASRPQTPHFQSSRRERPSMASFTGFFSSGPAGMEFMDSSNKFFCNIRNALDQDSEERDTLHLWVRLLLRFMSTIELDARPDDTSSGSGSLSGSGRHSVATAKDELRDRKALSKAQRHLAFLLGYADGAFNIPPHTLRNSTVFHSFLAHVMGVLDRNYGMGSCILHQTLVVLQYCASPQRYATDTQPPTFSLRLLEPQIRLDWLQTLLVILYKYEYS 1872          

HSP 4 Score: 270.396 bits (690), Expect = 2.066e-68
Identity = 126/253 (49.80%), Postives = 177/253 (69.96%), Query Frame = 1
Query: 6673 NSSSRV-TYSAISMAGADSK----DSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEW 7416
             SS R+ T+  +++A   S+    D+P+L  LPW+KSIPP++Q GPR+F++ V+RVRTL+WLLLG+ ++  +T   TG++C+P+P    +++ADLVK +LS FPDQQK                          QSV VMSSLYHAF+LCQ+WT+YCETAAS    +S  ++ AV TA+DFW  I+PT+L LL+IS+DFV+V+G LLT+MEEL+EC+   V K+  +W P+L GR++QLPGN+ KRLQKC+EW
Sbjct: 3028 TSSPRLGTHGHVTLAPTSSQNSQLDAPVLHLLPWLKSIPPSSQLGPRDFLVMVERVRTLSWLLLGATMNMALTREATGLACRPVPFVLVRAVADLVKALLSSFPDQQK--------------------------QSVTVMSSLYHAFLLCQVWTVYCETAASLSPAHSTQHKAAVATAVDFWTRIMPTVLRLLSISEDFVIVSGRLLTVMEELMECQCAVVTKLFPVWIPMLCGRHRQLPGNMLKRLQKCIEW 3254          

HSP 5 Score: 93.2041 bits (230), Expect = 1.058e-14
Identity = 38/80 (47.50%), Postives = 60/80 (75.00%), Query Frame = 1
Query: 3100 KIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVD 3339
            +  +I++L+   LIP+LW L+ SE S+LA ++VPLL++   +  GA  FW I+E+ F +DDWRVRFDA+E++T+L R++D
Sbjct: 1282 QANFIHYLVHCHLIPNLWGLLKSELSHLASWTVPLLLHCILLPGGAKVFWRIVESAFGHDDWRVRFDAIERVTVLMRELD 1361          
BLAST of Protein unc-79 homolog vs. Ensembl Cavefish
Match: UNC79 (unc-79 homolog, NALCN channel complex subunit [Source:HGNC Symbol;Acc:HGNC:19966])

HSP 1 Score: 375.17 bits (962), Expect = 6.467e-104
Identity = 251/723 (34.72%), Postives = 385/723 (53.25%), Query Frame = 1
Query: 5404 PRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYD-MLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPI-VIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAA---SHHSVNSNHYQE-AVKTAMDFWMNILPTILHLLTISDDFV-VVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLF----MKWLKKHVFVLGRNEDQHSAATHIF 7536
            P ++  L+  +TV+  + +         ++ +  + M +RC  C A+LE YDEETL LA+V    ++H  P LAAP L D M  V   I S +  +  +++ ++++P N    A+QFLRC  + L PNG+  QLFQ+ I++   F++ L + LIDF ++L+    + Q+LEGLN KK++      +  +DN+A ++EALP       ++   N W  NI  QF  FL KLP  L     +   LRIII ++K    ++ +SL++  + +L F+++   FSLS ++ELC + Y+   KE+ K  +++ ++ EL  A+KFK  +PD NLLLL+QF+  D G  +  + I +       P       T A E +R +L + + FI+D+ T+ K+K + K +  Q LHEDT G +LK  +AQ  A+E+S               G    +  ++++LPW+   P A QQGP+EFI CV  +R L+WLLLGS+ H C    G+  SC PIPL     IAD + VIL GFP+Q K                           SV+ MSSL+HAF+  QLWT+YCE AA   +  + N N +   A+ T ++FW  + P+IL L+  +   V +V  H++++ME L EC S    K+I +W P++Q     L   LQ RLQ  ++            +G F     KWL+   F + + E Q S A   F
Sbjct: 1766 PTKTSLLSAPSTVSMYVPAPED------FNDEQPTNMADRCRDCGAVLEEYDEETLALAVVVLSMFIHLSPDLAAPLLLDIMQSVGRYICSSD--TVLSAVCSMLIPGNAAGVAKQFLRCVLHQLAPNGILPQLFQSNIKDGS-FLRTLATSLIDF-NELSSVAALSQLLEGLNNKKSLPAGGTMLHCLDNIATFMEALP-------MDSPSNLW-TNICNQFQTFLTKLPAVLPLKYPLDSSLRIIICLLKIPTSNATRSLLEPSSKLLSFVIQYGVFSLSYLVELCGLCYKTFSKERDKFYMSRVVVLELLQALKFKSPIPDTNLLLLVQFVCADIGTRLSESTILQKHMISAIPGC----TTAAMECLRQYLSELLDFIADMHTLTKLKSHMK-ACCQPLHEDTFGGNLKVGLAQVAAMEIS--------------KGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRQLSWLLLGSLTH-CALHQGS-TSCMPIPLDAGSHIADHLIVILIGFPEQSKT--------------------------SVLHMSSLFHAFMFAQLWTIYCEQAAAAPAGQNQNQNEFSSGAILTGLEFWSRVTPSILQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNLNHLSAGLQLRLQA-IQNRVNHQCLQGPGSGSFPIALRKWLQCTQFKMAQVEIQSSEAASQF 2422          

HSP 2 Score: 303.138 bits (775), Expect = 6.070e-82
Identity = 181/583 (31.05%), Postives = 297/583 (50.94%), Query Frame = 1
Query:  520 VTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECE----SYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKH---LGAQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDD-DHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            + S +  FP   H  IIE L T+ +P     +   E    +Y   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +I+YG ++ + PA  +LF+YWP L P    S          + AW  I C+  EC N  +K  A+KM  DP  ++  G+K PPLY+C +C   ++      L DV+LP              S    A +TCFS+ C   +G++P+R+C+ CH+  H   +GA ++ H+YQ   P I   +C  E   C VE+++SL KE      Q+                     +      +G+  S  S   +++    K  D  D +++S +  +++   C P  NT  E L+R+VS +F WF+ T + +    G                  +EK+K  ++ KW++ V +   +VM+  LLP P+E+A+VG  WD  C   +Q+K+GL++I  LIPY++I+   W+  +P WLE +RTE+P++   E   ++ K+FD    P PF   +++ F + RF   P +VQ+Q L WL +L+++ + +P++ L+ MFS G+ S+ +
Sbjct:    1 MISTLATFPPFLHKDIIEYLSTSFLPMAILGSTRREGGVPAYVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVISYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHIECQNSINKP-AVKMCIDPTLSVALGDKPPPLYICEECSQRIAGDHAEWLVDVLLP-----------QGHSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHVNHHSSEVGASAETHLYQTSPPPINTRECGAEELVCTVESVISLLKEAEIHAEQR-------------------EFEMNRRRQMGLSTSHHSL--DNLEFDNKEDDQHDQRLLSQFGIWLLVSLCTPSENTPTESLARLVSMVFQWFHSTAYMMDDEVG----------------SLVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPVEFARVGGYWDKSCSTVSQLKEGLNRILCLIPYNVISQPLWECFMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPASVQEQALLWLHVLSQLDIVVPLQLLIGMFSDGVNSLKE 530          

HSP 3 Score: 270.011 bits (689), Expect = 9.243e-72
Identity = 181/570 (31.75%), Postives = 283/570 (49.65%), Query Frame = 1
Query: 3007 DPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDL----NNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLD-GSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQ--AFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFS 4695
            +P+I+ ++L  +  L  H E L    +  + +  ++ ++ E MLIP LW ++ SEF  LA  +VP L+++ +++ GAD FW+++E+ F + DW++RF+AVE++ +L R +D     ++  +  SLAH FC  + +++D+N AVA R    L++IK  SL  +  C+++QFD+V+ DR +IL ++  L          SW+FF+NRF   S+EAQ+  + + +    T +     N   ++D    +  RAR A  R  S+RS+  S             P       +L        P  L NK        RQSS P+ + G                             I++ L  D G    T+HQ + +L+KFMA  D   ++ ++   KA + V+RHL +LLGY  Q   F I P K+R+ST F+AF++ +A+V+D N  +G  +L   + VL++C  PQ   +  + P  SLW L P  R  WL  LLV+LYKY Y             + +V +LI ITINT+    H C               RP A    L  D SN S
Sbjct:  777 EPDILFNMLNCLKILCLHGECL---YHARKDQPHFLAYIQEKMLIPCLWSMLKSEFCQLASLAVPQLLHALSLSHGADIFWMLVESSFNSKDWKIRFEAVERVAVLCRFLDIGSVTKSHLLKYSLAHCFCCFLASIEDVNPAVATRARLLLDTIKRPSLQGLCLCMDFQFDTVVRDRPIILSKLLLLHSLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNTANLSDAAMWKIRRARFARNRQKSVRSLRDSIKG----------PAESKRAFSL--------PETLSNK-------LRQSSPPEEDSG-----------------------------IRDLLPEDVGIDHQTVHQLIMVLMKFMAK-DKSSAEADIGSAKAFNTVKRHLYVLLGYDQQMGCFMITPQKMRSSTCFNAFIAGIAQVMDYNIGLGKQMLPLVVQVLKYCTCPQLRPNFQEAPRCSLWALRPHIRQMWLKALLVILYKYPYRDMDMS-------KEVVLHLIHITINTLNAQYHSC---------------RPHASAGPLYSDNSNMS 1266          
BLAST of Protein unc-79 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006301.1 (pep scaffold:Pmarinus_7.0:GL476404:254978:273050:1 gene:ENSPMAG00000005689.1 transcript:ENSPMAT00000006301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 357.451 bits (916), Expect = 2.736e-105
Identity = 225/721 (31.21%), Postives = 355/721 (49.24%), Query Frame = 1
Query:  121 HYSMATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETS-AIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKL-NNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIP--------FVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLG---AQSKKHIYQLPLPDI--WDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHD 2238
            H +  +TK + F +KI+ L+++H+R+   +  +P+  D+  TLKYF  TL S+L++ +     +S  AR+ +       +P+  Y  L+  L+ L + +  L + Q  + ++I  T   L+PFL  D L  LP  + S +  FP+  H  I++ + +  +P        FV+        Y   S  S+L I  Q+     YH  ++E  M  K+++WKDLL +IAYG  + + PA  +LF+YWP L P    S          + AW  I C+ TEC N  +K  A+KM  DP  A+  G+K PPLY+C DC   L    I      +    ++   C  K C S    A +TCFS  C    G+KP+RFC  CH   H G   A  + H+YQ   P I   +C  E   C VEA+V   ++  P  R Q   A    +     +  K +L                               D +++S +A +++   C P  NT  E LSR+VS +F WF+ T + +    G                  +EK+K  ++ KW++ V E   +VM+  LLP P+E+A+VG  WD  C   +Q+K+GL +I SLIPY+++T   W+ I+P WLE +RT++PES   E   ++ K+FD    P PF   +++ F + RF     + Q+Q L WL +L+ + + +P++ L+ MF  G+ S+ +
Sbjct:   11 HNASMSTKAEQFASKIRYLQEYHNRVTHNIYPVPTGTDIANTLKYFSQTLLSVLRDVAFDCAQQSRDARLAE-------YPSLDYQGLYATLVSLIDLVPMLQHGQYDLGQSIFYTMACLVPFLNDDTLSTLPYTMVSTLATFPAFLHKDILDFISSTFLPMAMRKKTYFVHI------PYVNVSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPAQVKPPAVQMLFHYWPNLKPPGAISEYRGL----QYTAWNPIHCQHTECHNPINKP-AVKMCMDPSLAVTRGDKPPPLYLCEDCSQKLPSH-IHGTSCFLCSCTEISAICQKKNCSSHVKRAVVTCFSEGCCKRFGNKPVRFCRRCHHSHHSGEGAAGGEPHLYQTSPPPINTRECGAEELVCTVEAVVRGPRQESPS-RGQAGVASSQHSLDHTETETKDDLRH-----------------------------DQRLLSQFAIWLLLSLCTPSENTPTESLSRLVSMVFQWFHSTAYMVDDEVG----------------SLVEKLKPQFVTKWLKTVCETRFDVMVMCLLPKPMEFARVGGYWDKSCSVVSQLKEGLTRILSLIPYNVVTQPVWECIMPEWLEAIRTDVPESHIKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYSASTQEQALLWLHVLSELDIVVPLQLLIGMFCDGVHSIQE 666          
BLAST of Protein unc-79 homolog vs. Ensembl Nematostella
Match: EDO32376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV85])

HSP 1 Score: 221.861 bits (564), Expect = 1.219e-57
Identity = 167/636 (26.26%), Postives = 297/636 (46.70%), Query Frame = 1
Query:  370 YDELFYLLIGLCEFIGKLN-NQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFV-YTWNEEC--ESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTEC--PNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVN----LHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQS-KKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCL-PKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMF----ATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKS 2229
            Y +L++ L+ L   +  +     +  ++IL     LIPFL  D L+ LPL +   +  +P + H  I+ LLC  V+P V Y  +      SYA  + PS++  + QH   S+  A  VE+ M  K D+  DLL ++AYG       A  +L +Y+P    +  Q     +  +Y +E+W    C+  +C  PN+        + +D  +A    +  PP ++C  C +  +   + +    L   + P+  V T C   +C+ +   + + CFS EC +LN  +    C+ C++  H   +   +H+ Q   PD W      Q    EA+V L +E  P    +               G  G++ +        ++      DNDI        ++ +++S +  +++   C  P    + E L R+V+ +  W  DT              T +L   Y + E ++++   +  KW+  V ++ +E+    + P P EYA+VG+CWD+L     Q  +GLH+I  LIP+D++  E W+ ++P W++ ++ ++P  D P+ ++L+ K+FDP   PF + PA++ +     A +  N+T +    Q L WL +L+  +V I +  L  MF   I+S
Sbjct:    3 YADLYHALVKLARVVPVVELGGEAFAKSILSIMASLIPFLPKDQLNSLPLTLAINLATWPETMHFMILNLLCGYVMPTVLYLLHPPPGRPSYASLACPSLIMTVLQHCPDSKQQAQFVEALMQCKPDVCMDLLAVVAYGPQPILNSAGQILLHYFP----LWTQGGADDW--QYVYESWFPSKCQNKDCLSPNQGH---CAYICYDACYAAKNCDIPPPAFICAKCNEE-AENELADCPEFLVKTVQPLGPVPTKCQGPSCKGQGKPSAVMCFSPECATLNRKRGAALCQECNVLYHENEKGGARHVVQTLFPDPWSMEGCDQAYATEAVVRLLREAKPCQGTRCE-----------AMGLAGDVLR--------LEQVDDEIDNDI--------NNRRMLSRFGIWLLVGICSDPTKCESPERLGRLVAMVIAWI-DT--------------TSSLMRDY-VGELLKRLASQHASKWLSAVRDDKMELFCACISPSPPEYARVGTCWDALTSTVRQYVEGLHRICCLIPFDLLNIEVWETVMPLWMDAIKADVPPEDLPKFKVLLCKLFDPLLSPFKW-PAEISLGFVKKAVESSNHTQLV---QGLSWLQMLSTEEVIIKVHMLTNMFLKAIQS 581          

HSP 2 Score: 181.03 bits (458), Expect = 2.923e-45
Identity = 162/609 (26.60%), Postives = 272/609 (44.66%), Query Frame = 1
Query: 3025 SVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINR-------------FGIFSIEAQIG---------NNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTR---QSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMA--NVDMQVSKDELKDKKALSKV--QRHLALLLGYTDQA--FNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTV----GLLDDTSNFSMDNDISGEPDTPQSPNG 4746
            +VL  +  L+   + L+V    +E +  ++ +L E   IP+LW+L+ +E S L+E +  +L++   +  GA++    +E+ FT  DWRVRF  VEK+T+LAR ++      N   M++LA  F  L+GA++D+ + V+ R +  L++IK  +L  +  C+E+Q+D++  DR L++     L   LP  T     FFI R             FG   I +  G         + + T + +VTD   + G    F        L V    S   IS  +S           P    +    S           +  D SD+ +     Q++ P         K         + +E +  +      + ++ +L+ ++    HQ VTL++ F+A    +    + +    ++   V    +L +L+GY  +   F   P +LR+  VFHA++S + +VLD N   G  +L+ TL +L FCA+P R  + +Q P F+L  L P  R  WL  +L++LYKY ++            R     LI + +NT+E+  H C              P PR+  V      L D    + D+  +  PDTP SP  
Sbjct:  856 NVLKCLQVLVLRGDYLRV---AMEAEPDFLAYLQEIFFIPNLWELLQAEHSDLSEIATRILLHCICLPYGAEKLCDNVESAFTEHDWRVRFAGVEKVTVLARFLEKENVKSNNIAMSALAQCFTFLVGAVEDVCTPVSTRAIAMLDTIKASALKILYSCIEHQYDAMPKDRLLLIHTCRILHRILPHYTPLCGMFFIGRFKHLLIENADYVSFGSPKIRSSAGAASNYVSPSSEVHTPLESVTDSGKRPGEHYLF--------LLVTLFHSDMEISIRSSSGESISYNKQPPASDGNSTGGSGRQRRTGGFGQMTSDLSDRMFLGGRVQNNLPTVIEEGDSEKGDKESQRLSHASEDSSLSQEANQAVADSGNLEAAAT---HQLVTLVMDFLAYPGANKNSKRGQFVQTQSFEVVTMSNYLGVLMGYDIKVGEFTGDPRRLRSFPVFHAYMSGIVQVLDQNQEWGGELLNLTLQLLLFCAAP-RPMNRTQAPDFTLIRLPPPMRRIWLLAVLIILYKYPFH--------EDSHRRDTRNLIAVVLNTLESQNHKC--------------PGPRSAQVKRQSLSLLDLDTLNPDDGCAARPDTPSSPRA 1427          

HSP 3 Score: 177.563 bits (449), Expect = 3.148e-44
Identity = 142/495 (28.69%), Postives = 237/495 (47.88%), Query Frame = 1
Query: 5347 TSVEIQKILDTKDDPGRRRPRRSEFLTT------DTTVNSTIGSSSSGT-KQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFE--DQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYR-MCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHI---LKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQG 6792
            T   ++ IL    +   R+P R + LT       D ++  ++        K+P    +++   ++ C +C A LE ++EETL L+IV    YVH+ P++A PYL  ML                   +V++P +    A+QFLRC    L PNG+F +LF+T   ++D  +K +   L DF   DQ++   PI  +LE +   + +  + + +++ NLA Y +               + W   +A  F+ F RKLP+ L  ++D  P   I+  I+ +   SS K L+  F+ V+ F + K  F L  +L+LCS       KE+ K  LT+ ++ EL  A++F+ Y+PD NL  ++QF+ +DAG     ++I  G     +   Y +    +T A + M+ +  + I FI D +   K     +     +L+ DT+  HLK+++AQ  ALEL+    S   Y+               + L W+KS P  +Q G
Sbjct: 1541 TKESVEGILSLGLEDTTRKPSRPKLLTGMSFRSMDRSLEKSLDRLGDLVDKEP----ELQDIDLDSCPECGASLEEFEEETLNLSIVVLSTYVHQSPSMAMPYLLKMLECVGS--------------DVLIPGSTTEVAKQFLRCVLIKLAPNGIFSELFRTAFRSDDTLLKAVAYALNDFSAFDQMS---PIAYLLEDILGFRTLG-DRVMVLLANLATYFKH--------ASKEPTSAWQSQLA-HFENFFRKLPSVLPENSDFSPAFHIMSEILTAAN-SSFKVLLQPFSVVVTFSINKGSFHLQDLLDLCSKCNETFPKERDKLFLTRAVVTELMHAVRFRSYLPDLNLQSILQFLAIDAG-----SRITFGGDG--DHTEYSLPFGSRTRAMDCMQPYYGEAIEFIRDWNFTSKSSNENRRLSEPNLNFDTVPIHLKASVAQLAALELTKQPKSGKLYT---------------KALSWLKSPPTPSQLG 1981          
BLAST of Protein unc-79 homolog vs. Ensembl Nematostella
Match: EDO32374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV83])

HSP 1 Score: 86.6557 bits (213), Expect = 1.885e-19
Identity = 58/180 (32.22%), Postives = 85/180 (47.22%), Query Frame = 1
Query: 6793 PREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGH-LLTIMEELIECRSQTVAKV 7329
            P+E + CV  +R L WLL GS+ H  V S  T  +CQPI L     IAD V +IL  F +  K+                            + +++LYHAF LC+LWT+YC+          +    +    ++FW  + P ILHLLT + +   + GH  L ++E L EC   ++ KV
Sbjct:    1 PKELLECVSNMRLLTWLLHGSLSHM-VHSKITHANCQPISLDENIHIADYVLIILFSFAEPLKE---------------------------SLNVTALYHAFHLCELWTLYCDYTKLQGEYGMD---PSTPIVLEFWGKVTPGILHLLTKAKEMSDLVGHNFLNLLEALQECNCTSLPKV 149          
BLAST of Protein unc-79 homolog vs. Ensembl Nematostella
Match: EDO27181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9Z1])

HSP 1 Score: 70.4774 bits (171), Expect = 7.818e-13
Identity = 37/110 (33.64%), Postives = 61/110 (55.45%), Query Frame = 1
Query: 3313 LTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIE 3642
            +T+LAR ++      N   M++LA  F  L+GA++D+ + V+ R +  L++IK  +L  +  C+E+Q+D++  DR L++     L   LP  T     FFI RF    IE
Sbjct:    1 VTVLARFLEKENVKSNNIAMSALAQCFTFLVGAVEDVCTPVSTRAIAMLDTIKASALKILYSCIEHQYDAMPKDRLLLIHTCRILHRILPHYTPLCGMFFIGRFKHLLIE 110          
BLAST of Protein unc-79 homolog vs. Ensembl Medaka
Match: ENSORLT00000040797.1 (pep primary_assembly:ASM223467v1:22:12404970:12405529:1 gene:ENSORLG00000022067.1 transcript:ENSORLT00000040797.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 2.187e-23
Identity = 47/136 (34.56%), Postives = 76/136 (55.88%), Query Frame = 1
Query: 1627 LFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMK 2034
            +F WF+ T + +    G                  +EK+K  ++ KW++ V E   +VM+  LLP P+E+A+VG  WD  C    Q+K+GL++I  LIPY++I+   W+  IP WLE +RTE+P+S   E   +++
Sbjct:    2 VFQWFHSTAYMMDDEVGS----------------LVEKLKPQFVTKWLKTVCEVRFDVMVMCLLPKPVEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVISQPLWECFIPEWLEAIRTEVPDSQLKEFREVLR 121          
BLAST of Protein unc-79 homolog vs. Planmine SMEST
Match: SMESG000053097.1 (SMESG000053097.1)

HSP 1 Score: 4669.76 bits (12111), Expect = 0.000e+0
Identity = 2463/2477 (99.43%), Postives = 2463/2477 (99.43%), Query Frame = 1
Query:  130 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAXXXXXXXXXXXXXXXXXCLCMMVKTIDVQLKMNDPHGHGNMSQQXXXXXXXXXXXXXXXCWSSENCKCKHLXXXXXXXXXXXRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISXXXXXXXXXXXXXXXXHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDTPQSPNGLLXXXXXXXXXXXXXTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRXXXXXXXXXXXXXXXXXXXXXTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKT------PVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ 7542
            MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSKKRDLWKDLLLLIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAISGTTSLSNSDSFSILSCLCMMVKTIDVQLKMNDPHGHGNMSQQTPTLTLGLLTDMLLLCWSSENCKCKHLNDSNNAASSSNRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISEFSVDLKLLFLLVKELHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDSIRSISSSASLSHLYRRACSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKPLLPGLGGLNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLN        YEYNASGAGSGVVGGFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDTPQSPNGLLSDSFSISRASRSSTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRSVTSGNLSSSGNNNSLVEEESTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKT      PVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRIIIIIIKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWEPPEPEALAASNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ
Sbjct:    1 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSKKRDLWKDLLLLIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAISGTTSLSNSDSFSILSCLCMMVKTIDVQLKMNDPHGHGNMSQQTPTLTLGLLTDMLLLCWSSENCKCKHLNDSNNAASSSNRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISEFSVDLKLLFLLVKELHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDSIRSISSSASLSHLYRRACSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKPLLPGLGGLNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLN--------YEYNASGAGSGVVGGFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDTPQSPNGLLSDSFSISRASRSSTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRSVTSGNLSSSGNNNSLVEEESTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKTSSTNLQPVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRIIIIIIKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWEPPEPEALAASNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ 2469          
BLAST of Protein unc-79 homolog vs. Planmine SMEST
Match: SMESG000053097.1 (SMESG000053097.1)

HSP 1 Score: 4660.9 bits (12088), Expect = 0.000e+0
Identity = 2463/2490 (98.92%), Postives = 2463/2490 (98.92%), Query Frame = 1
Query:  130 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAXXXXXXXXXXXXXXXXXCLCMMVKTIDVQLKMNDPHGHGNMSQQXXXXXXXXXXXXXXXCWSSENCKCKHLXXXXXXXXXXXRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISXXXXXXXXXXXXXXXXHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDTPQSPNGLLXXXXXXXXXXXXXTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRXXXXXXXXXXXXXXXXXXXXXTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKT------PVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQK-------------KLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ 7542
            MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSKKRDLWKDLLLLIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAISGTTSLSNSDSFSILSCLCMMVKTIDVQLKMNDPHGHGNMSQQTPTLTLGLLTDMLLLCWSSENCKCKHLNDSNNAASSSNRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISEFSVDLKLLFLLVKELHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDSIRSISSSASLSHLYRRACSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKPLLPGLGGLNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLN        YEYNASGAGSGVVGGFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDTPQSPNGLLSDSFSISRASRSSTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRSVTSGNLSSSGNNNSLVEEESTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKT      PVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRIIIIIIKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQK             KLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWEPPEPEALAASNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ
Sbjct:    1 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSKKRDLWKDLLLLIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAISGTTSLSNSDSFSILSCLCMMVKTIDVQLKMNDPHGHGNMSQQTPTLTLGLLTDMLLLCWSSENCKCKHLNDSNNAASSSNRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISEFSVDLKLLFLLVKELHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDSIRSISSSASLSHLYRRACSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKPLLPGLGGLNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLN--------YEYNASGAGSGVVGGFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDTPQSPNGLLSDSFSISRASRSSTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRSVTSGNLSSSGNNNSLVEEESTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKTSSTNLQPVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRIIIIIIKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKILNEPHSKSIPPLKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWEPPEPEALAASNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ 2482          
BLAST of Protein unc-79 homolog vs. Planmine SMEST
Match: SMESG000053097.1 (SMESG000053097.1)

HSP 1 Score: 4658.59 bits (12082), Expect = 0.000e+0
Identity = 2450/2471 (99.15%), Postives = 2455/2471 (99.35%), Query Frame = 1
Query:  130 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAXXXXXXXXXXXXXXXXXCLCMMVKTIDVQLKMNDPHGHGNMSQQXXXXXXXXXXXXXXXCWSSENCKCKHLXXXXXXXXXXXRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISXXXXXXXXXXXXXXXXHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDTPQSPNGLLXXXXXXXXXXXXXTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRXXXXXXXXXXXXXXXXXXXXXTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKTPVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ 7542
            MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSKKRDLWKDLLLLIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAISGTTSLSNSDSFSILSCLCMMVKTIDVQLKMNDPHGHGNMSQQTPTLTLGLLTDMLLLCWSSENCKCKHLNDSNNAASSSNRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISEFSVDLKLLFLLVKELHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDSIRSISSSASLSHLYRRACSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKPLLPGLGGLNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLL+   ++E        GVVGGFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPR  + G + DTSNFSMDNDISGEPDTPQSPNGLLSDSFSISRASRSSTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRSVTSGNLSSSGNNNSLVEEESTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKTPVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRIIIIIIKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWEPPEPEALAASNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ
Sbjct:    1 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSKKRDLWKDLLLLIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAISGTTSLSNSDSFSILSCLCMMVKTIDVQLKMNDPHGHGNMSQQTPTLTLGLLTDMLLLCWSSENCKCKHLNDSNNAASSSNRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISEFSVDLKLLFLLVKELHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDSIRSISSSASLSHLYRRACSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKPLLPGLGGLNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLLYYIRFEC-YFMICRGVVGGFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRVVS-GAVPDTSNFSMDNDISGEPDTPQSPNGLLSDSFSISRASRSSTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRSVTSGNLSSSGNNNSLVEEESTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKTPVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRIIIIIIKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWEPPEPEALAASNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ 2469          
BLAST of Protein unc-79 homolog vs. Planmine SMEST
Match: SMESG000053097.1 (SMESG000053097.1)

HSP 1 Score: 4657.82 bits (12080), Expect = 0.000e+0
Identity = 2456/2471 (99.39%), Postives = 2458/2471 (99.47%), Query Frame = 1
Query:  130 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAXXXXXXXXXXXXXXXXXCLCMMVKTIDVQLKMNDPHGHGNMSQQXXXXXXXXXXXXXXXCWSSENCKCKHLXXXXXXXXXXXRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISXXXXXXXXXXXXXXXXHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDTPQSPNGLLXXXXXXXXXXXXXTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRXXXXXXXXXXXXXXXXXXXXXTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKTPVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ 7542
            MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSKKRDLWKDLLLLIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAISGTTSLSNSDSFSILSCLCMMVKTIDVQLKMNDPHGHGNMSQQTPTLTLGLLTDMLLLCWSSENCKCKHLNDSNNAASSSNRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISEFSVDLKLLFLLVKELHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDSIRSISSSASLSHLYRRACSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKPLLPGLGGLNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLN        YEYNASGAGSGVVGGFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPR  + G + DTSNFSMDNDISGEPDTPQSPNGLLSDSFSISRASRSSTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRSVTSGNLSSSGNNNSLVEEESTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKTPVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRIIIIIIKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWEPPEPEALAASNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ
Sbjct:    1 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSKKRDLWKDLLLLIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAISGTTSLSNSDSFSILSCLCMMVKTIDVQLKMNDPHGHGNMSQQTPTLTLGLLTDMLLLCWSSENCKCKHLNDSNNAASSSNRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISEFSVDLKLLFLLVKELHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDSIRSISSSASLSHLYRRACSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKPLLPGLGGLNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLN--------YEYNASGAGSGVVGGFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRVVS-GAVPDTSNFSMDNDISGEPDTPQSPNGLLSDSFSISRASRSSTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRSVTSGNLSSSGNNNSLVEEESTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKTPVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRIIIIIIKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWEPPEPEALAASNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ 2462          
BLAST of Protein unc-79 homolog vs. Planmine SMEST
Match: SMESG000053097.1 (SMESG000053097.1)

HSP 1 Score: 4644.72 bits (12046), Expect = 0.000e+0
Identity = 2451/2477 (98.95%), Postives = 2451/2477 (98.95%), Query Frame = 1
Query:  130 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSXXXXXXXXXXXXIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAXXXXXXXXXXXXXXXXXCLCMMVKTIDVQLKMNDPHGHGNMSQQXXXXXXXXXXXXXXXCWSSENCKCKHLXXXXXXXXXXXRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISXXXXXXXXXXXXXXXXHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDXXXXXXXXXXXXXXXXXXCSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKXXXXXXXXXNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVLYKYEYNXXXXXXXXXXXFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDTPQSPNGLLXXXXXXXXXXXXXTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRXXXXXXXXXXXXXXXXXXXXXTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKT------PVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRXXXXXXKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWXXXXXXXXXXSNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ 7542
            MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSKKRDLWKDLLLLIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAISGTTSLSNSDSFSILSCLCMMVKTIDVQLKMNDPHGHGNMSQQTPTLTLGLLTDMLLLCWSSENCKCKHLNDSNNAASSSNRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISEFSVDLKLLFLLVKELHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDSIRSISSSASLSHLYRRACSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKPLLPGLGGLNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLL  LY          SGVVGGFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPR        DTSNFSMDNDISGEPDTPQSPNGLLSDSFSISRASRSSTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRSVTSGNLSSSGNNNSLVEEESTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKT      PVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRIIIIIIKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWEPPEPEALAASNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ
Sbjct:    1 MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSILKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNNQSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELLCTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSKKRDLWKDLLLLIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKYHHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDCYDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSLNGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIVSLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFASFQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGLFNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQVVENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYDIITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPAKLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKSMHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDIDPEAGLTGAISGTTSLSNSDSFSILSCLCMMVKTIDVQLKMNDPHGHGNMSQQTPTLTLGLLTDMLLLCWSSENCKCKHLNDSNNAASSSNRPLSVGDASQQDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKVKTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISEFSVDLKLLFLLVKELHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLMENMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTNDDWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNSAVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWALPGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRIQFERARLAVARTDSIRSISSSASLSHLYRRACSVPLHQSSGVNLSNLHSTVQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKPLLPGLGGLNVAEYTDPNNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKALSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMGNSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLL--LY--------YISGVVGGFRAIVDYLIRITINTVENHLHVCKRMDEGYSPPTPHMPRPR--------DTSNFSMDNDISGEPDTPQSPNGLLSDSFSISRASRSSTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRSVTSGNLSSSGNNNSLVEEESTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKTSSTNLQPVIEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEFTLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDTKDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCNKCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHNMYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENNDCFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAAYLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPILRIIIIIIKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRMCKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPNKICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQKLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSKDSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTSNGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLHKSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEAVKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKVITLWTPILQGRNKQLPGNLQKRLQKCVEWEPPEPEALAASNGLFMKWLKKHVFVLGRNEDQHSAATHIFVQ 2459          
The following BLAST results are available for this feature:
BLAST of Protein unc-79 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC791.150e-10232.29unc-79 homolog, NALCN channel complex subunit [Sou... [more]
UNC791.150e-10232.29unc-79 homolog, NALCN channel complex subunit [Sou... [more]
UNC791.409e-10234.83unc-79 homolog, NALCN channel complex subunit [Sou... [more]
UNC791.409e-10234.83unc-79 homolog, NALCN channel complex subunit [Sou... [more]
UNC791.409e-10234.83unc-79 homolog, NALCN channel complex subunit [Sou... [more]
back to top
BLAST of Protein unc-79 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
unc-795.632e-7829.07Uncoordinated protein 79 [Source:UniProtKB/Swiss-... [more]
unc-795.632e-7829.07Uncoordinated protein 79 [Source:UniProtKB/Swiss-... [more]
unc-797.341e-7828.23Uncoordinated protein 79 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Protein unc-79 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc791.731e-11828.27gene:FBgn0038693 transcript:FBtr0301694[more]
unc797.706e-11328.37gene:FBgn0038693 transcript:FBtr0301692[more]
unc791.203e-11228.37gene:FBgn0038693 transcript:FBtr0344553[more]
unc791.516e-11228.27gene:FBgn0038693 transcript:FBtr0344552[more]
unc792.093e-11228.27gene:FBgn0038693 transcript:FBtr0301693[more]
back to top
BLAST of Protein unc-79 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein unc-79 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
UNC795.474e-10432.89unc-79 homolog, NALCN channel complex subunit [Sou... [more]
UNC791.201e-10336.46unc-79 homolog, NALCN channel complex subunit [Sou... [more]
UNC791.432e-10336.46unc-79 homolog, NALCN channel complex subunit [Sou... [more]
back to top
BLAST of Protein unc-79 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Unc796.947e-10832.44unc-79 homolog [Source:MGI Symbol;Acc:MGI:2684729][more]
Unc796.836e-10335.85unc-79 homolog [Source:MGI Symbol;Acc:MGI:2684729][more]
Unc797.436e-10335.85unc-79 homolog [Source:MGI Symbol;Acc:MGI:2684729][more]
Unc798.838e-10335.85unc-79 homolog [Source:MGI Symbol;Acc:MGI:2684729][more]
Unc794.544e-2231.82unc-79 homolog [Source:MGI Symbol;Acc:MGI:2684729][more]
back to top
BLAST of Protein unc-79 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q0KK59|UNC79_MOUSE4.782e-10235.85Protein unc-79 homolog OS=Mus musculus OX=10090 GN... [more]
sp|Q9P2D8|UNC79_HUMAN8.841e-10234.83Protein unc-79 homolog OS=Homo sapiens OX=9606 GN=... [more]
sp|P42173|UNC79_CAEEL7.164e-7729.07Uncoordinated protein 79 OS=Caenorhabditis elegans... [more]
back to top
BLAST of Protein unc-79 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9LTX00.000e+035.08Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2T7NZ428.417e-13634.65Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A4S2MDX01.493e-11344.71Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4V3SH411.621e-11344.71Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2MDY31.457e-11344.08Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Protein unc-79 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
UNC796.467e-10434.72unc-79 homolog, NALCN channel complex subunit [Sou... [more]
back to top
BLAST of Protein unc-79 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006301.12.736e-10531.21pep scaffold:Pmarinus_7.0:GL476404:254978:273050:1... [more]
back to top
BLAST of Protein unc-79 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein unc-79 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO323761.219e-5726.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323741.885e-1932.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO271817.818e-1333.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein unc-79 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000040797.12.187e-2334.56pep primary_assembly:ASM223467v1:22:12404970:12405... [more]
back to top
BLAST of Protein unc-79 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053097.10.000e+099.43SMESG000053097.1[more]
SMESG000053097.10.000e+098.92SMESG000053097.1[more]
SMESG000053097.10.000e+099.15SMESG000053097.1[more]
SMESG000053097.10.000e+099.39SMESG000053097.1[more]
SMESG000053097.10.000e+098.95SMESG000053097.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028777 ID=SMED30028777|Name=Protein unc-79 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=7667bp
ATGACATAAGAAATGAATAATTAAATTATATTAATGAATTTATTACGATA
TTTTTAATATTTATAAAAAAAGGATTGGAATTATTTCTATTTTTTCGTGA
AAAATAAATTTCAAATTCTTCACTATTCAATGGCTACTACGAAGACACAA
TCATTCAATAACAAAATTAAAGCACTTAAAGATTTTCATTCACGTTTAAT
TTCTGGTGTTGGTGGCATTCCATCTTCAGGAGACGTTCAAGCTACATTAA
AATATTTTTGCATAACATTAAAAAGTATTCTGAAAGAAACCTCGGCAATA
CCAAATGAAAGTTACGGTGCAAGAATTAAAGACGTTCAAATGAGAATTAA
TTTGTTTCCAAATTTTCACTATGATGAATTATTTTATTTACTTATTGGGT
TATGTGAATTTATCGGGAAATTAAACAATCAATCAAGCGTCTGTGAAGCC
ATACTGAAGACATTCAACGTTTTAATTCCATTCCTGGAGTTCGATAATCT
GGATATGCTTCCACTGATTGTCACTTCCTGCATCAATTTCTTTCCCAGTT
CTCAACATGCAGCAATTATTGAATTGCTCTGCACAGCTGTTATTCCCTTT
GTTTATACTTGGAATGAGGAATGTGAATCGTATGCTATTGAATCAATTCC
ATCGATTTTACAGATAATTTTTCAGCATATTGATAAATCAGAGTATCACG
CATGGGTGGTTGAATCGTTTATGAGTAAGAAACGTGATTTGTGGAAGGAT
CTATTGCTACTGATTGCGTATGGTAGTACTGAAAGCAGAGTTCCTGCTAC
TTATCTTTTATTTTATTATTGGCCAGAATTATGTCCAGTGCAATTTCAAT
CAAGCCAAGCACGGTTTCCATCGAAATACCACCATGAAGCGTGGAAAGCG
ATATTGTGTGAACGAACTGAATGTCCAAACAAAGCTAGTAAAACGGTAGC
AATGAAGATGACATTTGATCCTCAGCACGCTATTATGTTCGGCAATAAGG
TTCCGCCTTTGTATGTGTGCTTGGATTGCTATGATGCACTAAGCAGGCAA
CGAATCGTTAATCTCCATGATGTCATTTTACCAATAAAAAAGGTGAAAAC
AACCTGTGATTCGAAAACTTGCCGAAGTAAAAATAACAATGCGCATATAA
CATGTTTCAGTTCTGAATGCACTTCATTAAACGGTCATAAGCCAATCAGG
TTTTGTGAAGGCTGCCATATACAAAAACATCTAGGAGCACAATCTAAAAA
GCATATTTATCAATTGCCATTACCTGATATTTGGGATTGTAATATGGAAA
TACAGCCTTGCATGGTGGAGGCAATTGTCAGTCTTTGTAAGGAAACGTTA
CCCCGTTGGCGACAACAAATGAATTTTGCTGAGGAGTCTTCAAATAATGT
TGACGTTGGGAGTGGTGCTAAAGGAAATCTTGATCAAGGATCACCATCTA
TGTTAGGAGTTATAAAAAGTTTTGCAAGCTTTCAGGATAATGATATACCG
CTAGCTGGGAAGTATAGTGATGACGACCATAAAGTTATATCACTATACGC
TGCATTCATTATCGGGGAAAAATGTTTACCGAAACCAAACACAAATATAG
AAATTCTCAGCCGAATCGTATCAGGACTTTTCAACTGGTTTTACGACACA
GTTTTCACAATTTGTGGAGGTTTCGGTCAAGATTACTTTCTCACGGGCAC
TCTACAAGACAAGTATAGCCTCGATGAATTTATCGAAAAAATTAAAAAAG
ACTATTTATTAAAATGGATTCAACAAGTTGTTGAAAACAATCTTGAAGTG
ATGCTCACTGTTCTGTTGCCATACCCTATAGAGTACGCTAAAGTTGGGTC
TTGTTGGGATTCGTTGTGTGACAGAACTGCCCAAGTGAAACAAGGCTTAC
ACAAGATATCCAGTTTGATTCCATATGACATAATAACCTTTGAAACATGG
GATTATATTATTCCATTTTGGTTAGAAACATTGAGAACCGAAATTCCTGA
GAGTGATTATCCTGAATTGGAAATATTGATGAAAAAAATATTCGATCCAC
ATGCTGGTCCATTTCCATTTTTACCAGCCAAACTTTATATGTTTGCCACT
CAAAGATTCAATAATACTCCTGTTGCAGTTCAAGATCAAGTGCTTTGCTG
GCTGGATATATTGACTAGAATGAAAGTTCAAATTCCTATGAAAGAGTTAT
TGACTATGTTTTCTGTTGGAATCAAAAGCATGCATGATCCTATTCCATTA
GTCGATGTAATCTCTAGTGAAGCTAGTAGACCATCACTGATTCATCAAGA
AGAATCTCTATCCAATTCCGGCAGTGATACAGGAGCCGGAAATGTAAATC
AAACAAGCACCCAGCTTGATGACATCGATCCCGAAGCTGGATTGACCGGA
GCAATAAGTGGTACGACATCTTTAAGCAATTCTGATTCGTTTTCAATCCT
TTCTTGCCTTTGTATGATGGTTAAAACAATTGACGTTCAATTGAAAATGA
ATGATCCACACGGTCATGGGAATATGAGTCAACAAACTCCAACTCTGACT
TTGGGTTTGCTCACTGACATGTTATTATTATGTTGGAGCTCAGAAAATTG
CAAATGTAAACATTTGAACGACTCAAATAACGCAGCCAGTTCCAGCAATC
GGCCACTGTCAGTAGGAGATGCTTCACAGCAAGATACTTGTATCACTTGT
CAGAACGTATTATCATGGCATCAAGTGACCTCTAAAGTTTTACAACATAT
AGTTCCCATTCATCCTATCAATTTACCAGACACAAATCTCACAGTGGAAT
CAATTTCGCAAAACAATAAAAACAAAGTGAAAACTTCCAAAGATGGTACA
ACTGAATCACAATTGAATAAAGAGGAAAAAATCTCTGATAAACAAGATGA
AGCACAAGTGAAGAAAGAAGAAATCAAAGAATTTGATATTTCTGAGTTTT
CCGTTGATTTGAAACTTCTATTTTTATTGGTTAAGGAACTCCATCGACAC
CATAATGATCCTGAAATAATTCACAGTGTCTTGATCTCCATAACCTATCT
TATGAGACACGCGGAATTATTAAAAGTCGATCAGAATACTATTGAAAAAA
AGATTAAGTACATCAATCATCTAATGGAAAATATGTTGATTCCACATTTA
TGGGACTTAATGTGTTCTGAATTTTCGTACCTGGCTGAATATTCGGTTCC
ATTATTAATATATTCTTTCACCATCAACAGTGGTGCTGATCAATTTTGGT
TGATTTTGGAAACGGAATTCACCAATGACGATTGGCGGGTGCGATTTGAT
GCGGTTGAAAAGCTTACAATTCTTGCCAGGCAAGTAGACGATTCCATGTT
TGGTGAAAACCAAGCAGTTATGACGTCTCTGGCTCACGCTTTCTGCAATT
TGATTGGTGCGCTTGATGACTTGAACTCAGCGGTCGCCGCTAGGACAGTT
TTCTATCTGGAATCTATAAAGGATCGATCACTGAGTTGCATTGTGAAATG
CTTAGAATATCAATTTGATTCTGTTATCGCCGACCGAACTCTTATATTGT
TACGGATTTATCAACTAAGCTGGGCCTTACCTGGCCGAACAGTGTTTTCG
TGGGATTTCTTTATCAACAGATTCGGTATATTTTCAATTGAAGCCCAAAT
CGGCAATAACCTTGATACCGATATTAATAACGTCACGGATTTAAATAATC
AGAAGGGAGTCACTGATTTCTTCCGCATCCAATTCGAGAGGGCACGATTA
GCTGTTGCTCGAACCGACAGTATTCGTTCAATCAGCTCAAGTGCTTCTTT
AAGCCATCTTTATCGGAGAGCATGTTCAGTTCCTCTTCACCAAAGTTCCG
GTGTTAACCTTTCCAATTTACATTCAACAGTTCAACCACTTAATTTAATC
AACAAAGACAGCTCCGATAAGCATTATACAAGACAGTCTTCTGCTCCTCA
ATTTAATCTAGGTCGTCGGAAATCGAAACCTCTTTTGCCAGGATTAGGAG
GACTCAATGTCGCTGAATATACGGATCCTAATAATAGATTTTTAACAAAT
ATTCAAGAAGCTTTAGATTTAGATGGTTCAAGCCGTGATACACTTCATCA
ATGGGTTACATTGCTCCTGAAGTTTATGGCAAATGTTGATATGCAAGTTT
CGAAAGATGAATTAAAGGATAAAAAAGCTCTGAGTAAAGTCCAGAGACAT
CTGGCTTTATTATTGGGTTATACGGATCAAGCATTCAATATTCCTCCTTA
CAAATTGAGAAATTCCACGGTATTTCATGCTTTTCTATCGAATGTTGCGA
AAGTGCTTGATTGCAATTTTTCCATGGGAAATTCCATTTTGCATCAAACC
TTGGTAGTGTTACAATTCTGTGCATCTCCGCAGCGATACGCCAGTGACAG
TCAACCTCCAACCTTTAGTTTATGGTTACTAGAACCACAAACGAGAATAC
ATTGGCTGAATGTTTTACTTGTAGTATTATATAAGTATGAATACAATGCG
TCAGGTGCTGGCAGTGGAGTTGTCGGTGGATTCCGAGCTATTGTTGATTA
TTTAATTAGGATTACCATAAACACAGTAGAAAATCATTTACATGTTTGTA
AAAGAATGGATGAAGGATATTCTCCTCCTACTCCACATATGCCGAGACCT
AGAGCGAAAACCGTCGGCTTGCTTGATGATACAAGCAACTTTAGCATGGA
CAATGATATTTCTGGAGAACCGGACACTCCACAAAGTCCAAATGGTCTTC
TCTCGGATTCGTTTAGTATTTCTCGGGCTTCGAGATCTTCGACGGTTCAT
TACACTAAGAAAGATAAAGAATTGGAAATGTTGACATCTCGATTTACGAG
TCCAGTTATTAAGAAAAAAGTTGCTAGACAATATCGTGGGCGATCAGTTA
CGTCCGGAAATTTGAGTTCTTCAGGAAATAACAACAGTCTAGTTGAAGAA
GAATCCACACCAGCACCCAACCAGATCAACCCAGATCCTTCCAATGCACC
GTATGATAATCCGATCAAAGAAATTATACTCTCTCCAATAACTGTCAGTT
CCAAGGATAAAAATATTAAAACCCCGGTTATTGAAGAAAGTGGCGACATG
AAGGACGATAGCAATCGGAATAGCTTGTTAATAAACGTTGAAAACAAAAT
GGCGGAACAGCTGTGTGAATTCGTCATGGATATTGATAAGAACAAAAAGC
CGGACTCTAATGCTTCCCCTGACGAATTCACTTTGTCACTGAAAGAAGCT
ACAATAGCAGAGGATAAAGAAAAATCAGAGGACGAAATGGATCTATTTGA
TGACAAGCCAAATTATCGACAGAGAAAAGCACGGAAATCAGGTTTAACAA
GTGTAGAAATTCAAAAGATATTAGACACCAAAGATGATCCAGGAAGAAGG
AGACCGAGACGAAGTGAATTCCTTACAACAGATACGACCGTTAATTCTAC
TATTGGAAGTTCTAGTAGTGGAACAAAACAACCCTTGTATCATCGACAAG
TCGAAAGCTTTATGGTTGAAAGATGTAACAAATGTCATGCTATACTAGAA
CATTATGATGAAGAGACGTTGGGTTTAGCAATTGTTTGTTTCGGTGCATA
TGTTCATCGGGAGCCGGCACTAGCGGCTCCATATCTCTATGATATGTTGA
TTGTGTCAGCAAAGATTGCATCTCATAATATGTATTCGTGGAAAAACAGT
TTGCACAATGTCGTTGTACCAAATAATGTCGTTAGCTGTGCTCGACAGTT
CTTGCGTTGCACATTTTACAATCTCTTCCCAAACGGCCTATTTGTTCAAC
TTTTTCAAACCGAAATCGAAAATAATGATTGTTTCATGAAATGCCTTGTG
TCTGTCCTGATTGATTTCGAGGATCAGTTGAACATTTTCCAACCCATTCA
GCAAGTCCTTGAAGGATTGAATAAGAAAAAGGCAATATCTCCTGAAAATC
TTCCGATTGTTATTGACAATTTAGCGGCATATTTGGAAGCACTGCCATCA
TTGATTGAAGATGTCAAAATCAACCATATGCTCAATACTTGGTTGTATAA
TATCGCTCCACAATTTGACATATTCCTGCGTAAATTGCCAAATAACCTAT
TACCAGACACAGATGTCGGCCCAATTCTTCGGATAATCATCATTATCATC
AAGTCTAATATGATTAGTAGTTGTAAATCATTGATGGATACTTTTGCCTA
TGTTCTGAAATTTATAGTAGAGAAATGCAAGTTTTCCCTGTCACCCATGC
TTGAACTGTGCTCTATGACGTATAGAATGTGTAAAGAAAAGGGGAAAAAT
TTGTTAACAAAATGTTTAATCGAGGAACTACATTTGGCAATCAAATTTAA
GATTTATGTTCCTGATAAAAATCTCTTGCTACTAATACAGTTTATTCTAA
TGGATGCCGGGGGAACTGTGGAGCCAAATAAAATATGTGAAGGATTGACA
AGTTTGTTTAATCCTGCCACATATCATATTCTTAAAACTGGTGCTGCTGA
ATTAATGAGATTGCACCTGCATGACTGTATCGCATTTATAAGTGATGTGG
ATACCGTTCACAAGGTGAAACAAAATCAAAAACTTTCTGGTTCGCAAAGC
TTACATGAAGACACTCTAGGTTCTCATTTAAAATCTGCGATTGCCCAATA
TGTTGCTCTCGAATTGAGCCCGAACAGTTCGTCTAGGGTAACATACAGTG
CGATCAGTATGGCAGGTGCCGACAGCAAGGATTCGCCAATCTTGCAATTC
TTGCCATGGATAAAATCAATCCCCCCTGCTACTCAACAAGGTCCTCGAGA
GTTCATTCTCTGTGTTGACCGAGTGAGAACTCTCAATTGGTTATTGCTCG
GTTCAATGATCCACACCTGTGTGACAAGTAACGGCACCGGAATATCATGC
CAGCCGATTCCGTTGGGATTTAAAAAATCTATTGCTGATTTGGTGAAAGT
CATTTTATCAGGATTTCCTGACCAACAAAAGAAACTTACTGCCATATCTA
AATCGAAAAGCTTTTATCCATTTCTTCATAAATCTCAATATTCACGATTT
AATTTAGGACAATCGGTTATCGTTATGTCTTCTCTTTACCATGCGTTCGT
GCTTTGTCAGTTGTGGACCATGTATTGTGAAACTGCTGCTAGCCATCATT
CGGTCAACAGTAATCACTATCAAGAGGCGGTTAAGACTGCGATGGACTTT
TGGATGAATATCTTACCCACAATTCTCCATTTATTAACCATTTCTGATGA
TTTTGTCGTAGTCAATGGCCACCTGTTAACTATTATGGAAGAGCTGATTG
AATGTCGATCTCAAACCGTTGCCAAGGTCATTACGCTATGGACTCCCATT
TTGCAGGGCCGGAATAAACAATTACCTGGAAATCTTCAAAAACGTTTACA
GAAATGTGTGGAATGGGAACCCCCTGAACCTGAAGCTTTAGCTGCGTCTA
ATGGGCTTTTTATGAAGTGGTTGAAGAAACACGTATTTGTTCTTGGTCGA
AATGAGGATCAACACTCGGCTGCTACTCACATTTTTGTTCAATGAATATT
TTAAATTGCATATATCATTTTTGATCTCATTAGTCAGGATTGTTTTTGAT
TTATATCAAATATATTGTTTTCATACTTACTCTTTGTCTACTAAATATTT
CTCGACTCTTATTCGAT
back to top

protein sequence of SMED30028777-orf-1

>SMED30028777-orf-1 ID=SMED30028777-orf-1|Name=SMED30028777-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2472bp
MATTKTQSFNNKIKALKDFHSRLISGVGGIPSSGDVQATLKYFCITLKSI
LKETSAIPNESYGARIKDVQMRINLFPNFHYDELFYLLIGLCEFIGKLNN
QSSVCEAILKTFNVLIPFLEFDNLDMLPLIVTSCINFFPSSQHAAIIELL
CTAVIPFVYTWNEECESYAIESIPSILQIIFQHIDKSEYHAWVVESFMSK
KRDLWKDLLLLIAYGSTESRVPATYLLFYYWPELCPVQFQSSQARFPSKY
HHEAWKAILCERTECPNKASKTVAMKMTFDPQHAIMFGNKVPPLYVCLDC
YDALSRQRIVNLHDVILPIKKVKTTCDSKTCRSKNNNAHITCFSSECTSL
NGHKPIRFCEGCHIQKHLGAQSKKHIYQLPLPDIWDCNMEIQPCMVEAIV
SLCKETLPRWRQQMNFAEESSNNVDVGSGAKGNLDQGSPSMLGVIKSFAS
FQDNDIPLAGKYSDDDHKVISLYAAFIIGEKCLPKPNTNIEILSRIVSGL
FNWFYDTVFTICGGFGQDYFLTGTLQDKYSLDEFIEKIKKDYLLKWIQQV
VENNLEVMLTVLLPYPIEYAKVGSCWDSLCDRTAQVKQGLHKISSLIPYD
IITFETWDYIIPFWLETLRTEIPESDYPELEILMKKIFDPHAGPFPFLPA
KLYMFATQRFNNTPVAVQDQVLCWLDILTRMKVQIPMKELLTMFSVGIKS
MHDPIPLVDVISSEASRPSLIHQEESLSNSGSDTGAGNVNQTSTQLDDID
PEAGLTGAISGTTSLSNSDSFSILSCLCMMVKTIDVQLKMNDPHGHGNMS
QQTPTLTLGLLTDMLLLCWSSENCKCKHLNDSNNAASSSNRPLSVGDASQ
QDTCITCQNVLSWHQVTSKVLQHIVPIHPINLPDTNLTVESISQNNKNKV
KTSKDGTTESQLNKEEKISDKQDEAQVKKEEIKEFDISEFSVDLKLLFLL
VKELHRHHNDPEIIHSVLISITYLMRHAELLKVDQNTIEKKIKYINHLME
NMLIPHLWDLMCSEFSYLAEYSVPLLIYSFTINSGADQFWLILETEFTND
DWRVRFDAVEKLTILARQVDDSMFGENQAVMTSLAHAFCNLIGALDDLNS
AVAARTVFYLESIKDRSLSCIVKCLEYQFDSVIADRTLILLRIYQLSWAL
PGRTVFSWDFFINRFGIFSIEAQIGNNLDTDINNVTDLNNQKGVTDFFRI
QFERARLAVARTDSIRSISSSASLSHLYRRACSVPLHQSSGVNLSNLHST
VQPLNLINKDSSDKHYTRQSSAPQFNLGRRKSKPLLPGLGGLNVAEYTDP
NNRFLTNIQEALDLDGSSRDTLHQWVTLLLKFMANVDMQVSKDELKDKKA
LSKVQRHLALLLGYTDQAFNIPPYKLRNSTVFHAFLSNVAKVLDCNFSMG
NSILHQTLVVLQFCASPQRYASDSQPPTFSLWLLEPQTRIHWLNVLLVVL
YKYEYNASGAGSGVVGGFRAIVDYLIRITINTVENHLHVCKRMDEGYSPP
TPHMPRPRAKTVGLLDDTSNFSMDNDISGEPDTPQSPNGLLSDSFSISRA
SRSSTVHYTKKDKELEMLTSRFTSPVIKKKVARQYRGRSVTSGNLSSSGN
NNSLVEEESTPAPNQINPDPSNAPYDNPIKEIILSPITVSSKDKNIKTPV
IEESGDMKDDSNRNSLLINVENKMAEQLCEFVMDIDKNKKPDSNASPDEF
TLSLKEATIAEDKEKSEDEMDLFDDKPNYRQRKARKSGLTSVEIQKILDT
KDDPGRRRPRRSEFLTTDTTVNSTIGSSSSGTKQPLYHRQVESFMVERCN
KCHAILEHYDEETLGLAIVCFGAYVHREPALAAPYLYDMLIVSAKIASHN
MYSWKNSLHNVVVPNNVVSCARQFLRCTFYNLFPNGLFVQLFQTEIENND
CFMKCLVSVLIDFEDQLNIFQPIQQVLEGLNKKKAISPENLPIVIDNLAA
YLEALPSLIEDVKINHMLNTWLYNIAPQFDIFLRKLPNNLLPDTDVGPIL
RIIIIIIKSNMISSCKSLMDTFAYVLKFIVEKCKFSLSPMLELCSMTYRM
CKEKGKNLLTKCLIEELHLAIKFKIYVPDKNLLLLIQFILMDAGGTVEPN
KICEGLTSLFNPATYHILKTGAAELMRLHLHDCIAFISDVDTVHKVKQNQ
KLSGSQSLHEDTLGSHLKSAIAQYVALELSPNSSSRVTYSAISMAGADSK
DSPILQFLPWIKSIPPATQQGPREFILCVDRVRTLNWLLLGSMIHTCVTS
NGTGISCQPIPLGFKKSIADLVKVILSGFPDQQKKLTAISKSKSFYPFLH
KSQYSRFNLGQSVIVMSSLYHAFVLCQLWTMYCETAASHHSVNSNHYQEA
VKTAMDFWMNILPTILHLLTISDDFVVVNGHLLTIMEELIECRSQTVAKV
ITLWTPILQGRNKQLPGNLQKRLQKCVEWEPPEPEALAASNGLFMKWLKK
HVFVLGRNEDQHSAATHIFVQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0030534adult behavior
GO:0035264multicellular organism growth
GO:0048149behavioral response to ethanol