SMED30028771

Overview
NameSMED30028771
Smed IDSMED30028771
Length (bp)1542
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30028771 (SMED30028771) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30028771 (SMED30028771) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30028771 (SMED30028771) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30028771 (SMED30028771) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SMED30028771 vs. Ensembl Human
Match: SNRPA1 (small nuclear ribonucleoprotein polypeptide A' [Source:HGNC Symbol;Acc:HGNC:11152])

HSP 1 Score: 108.612 bits (270), Expect = 3.138e-27
Identity = 50/90 (55.56%), Postives = 69/90 (76.67%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+
Sbjct:    5 TAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELI 94          
BLAST of SMED30028771 vs. Ensembl Human
Match: SNRPA1 (small nuclear ribonucleoprotein polypeptide A' [Source:HGNC Symbol;Acc:HGNC:11152])

HSP 1 Score: 108.612 bits (270), Expect = 3.138e-27
Identity = 50/90 (55.56%), Postives = 69/90 (76.67%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+
Sbjct:    5 TAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELI 94          
BLAST of SMED30028771 vs. Ensembl Human
Match: SNRPA1 (small nuclear ribonucleoprotein polypeptide A' [Source:HGNC Symbol;Acc:HGNC:11152])

HSP 1 Score: 109.768 bits (273), Expect = 1.316e-26
Identity = 50/90 (55.56%), Postives = 69/90 (76.67%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+
Sbjct:    5 TAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELI 94          
BLAST of SMED30028771 vs. Ensembl Celegans
Match: mog-2 (Probable U2 small nuclear ribonucleoprotein A' [Source:UniProtKB/Swiss-Prot;Acc:Q9BLB6])

HSP 1 Score: 77.7962 bits (190), Expect = 7.420e-16
Identity = 39/90 (43.33%), Postives = 55/90 (61.11%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T EL     Q  N +  RE++L+G KI +IEN+G T DQFD +D TDN+I + D FP   RL ++   NN+I  I+ D+   +PN+ TL 
Sbjct:    5 TTELFAERPQFVNSVNMREINLRGQKIPVIENMGVTRDQFDVIDLTDNDIRKLDNFPTFSRLNTLYLHNNRINYIAPDIATKLPNLKTLA 94          
BLAST of SMED30028771 vs. Ensembl Celegans
Match: mog-2 (Probable U2 small nuclear ribonucleoprotein A' [Source:UniProtKB/Swiss-Prot;Acc:Q9BLB6])

HSP 1 Score: 77.7962 bits (190), Expect = 7.420e-16
Identity = 39/90 (43.33%), Postives = 55/90 (61.11%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T EL     Q  N +  RE++L+G KI +IEN+G T DQFD +D TDN+I + D FP   RL ++   NN+I  I+ D+   +PN+ TL 
Sbjct:    5 TTELFAERPQFVNSVNMREINLRGQKIPVIENMGVTRDQFDVIDLTDNDIRKLDNFPTFSRLNTLYLHNNRINYIAPDIATKLPNLKTLA 94          
BLAST of SMED30028771 vs. Ensembl Fly
Match: U2A (gene:FBgn0033210 transcript:FBtr0088941)

HSP 1 Score: 97.4413 bits (241), Expect = 1.855e-22
Identity = 43/90 (47.78%), Postives = 65/90 (72.22%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELI  S+Q  NP ++RELDL+G KI  IENLG TLDQFD++D +DN++ + D  P+L RL  +   NN+I++IS+ L + +PN+ +++
Sbjct:    5 TPELINQSMQYINPCRERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNNRILRISEGLEEAVPNLGSII 94          
BLAST of SMED30028771 vs. Ensembl Zebrafish
Match: snrpa1 (small nuclear ribonucleoprotein polypeptide A' [Source:ZFIN;Acc:ZDB-GENE-041114-82])

HSP 1 Score: 108.612 bits (270), Expect = 3.264e-27
Identity = 48/90 (53.33%), Postives = 69/90 (76.67%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELIE + Q TNP++DRELDL+G KI ++ENLG TLDQFD++D +DNE+ + DGFP LKRL ++   NN+I +I ++L Q +P++  L+
Sbjct:    5 TAELIEQAAQYTNPVRDRELDLRGYKIPVLENLGATLDQFDTIDLSDNEVRKLDGFPLLKRLKTLLVNNNRICRIGENLEQALPDLKELI 94          
BLAST of SMED30028771 vs. Ensembl Zebrafish
Match: snrpa1 (small nuclear ribonucleoprotein polypeptide A' [Source:ZFIN;Acc:ZDB-GENE-041114-82])

HSP 1 Score: 109.768 bits (273), Expect = 1.599e-26
Identity = 48/90 (53.33%), Postives = 69/90 (76.67%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELIE + Q TNP++DRELDL+G KI ++ENLG TLDQFD++D +DNE+ + DGFP LKRL ++   NN+I +I ++L Q +P++  L+
Sbjct:    5 TAELIEQAAQYTNPVRDRELDLRGYKIPVLENLGATLDQFDTIDLSDNEVRKLDGFPLLKRLKTLLVNNNRICRIGENLEQALPDLKELI 94          
BLAST of SMED30028771 vs. Ensembl Xenopus
Match: SNRPA1 (small nuclear ribonucleoprotein polypeptide A' [Source:NCBI gene;Acc:100486145])

HSP 1 Score: 95.5153 bits (236), Expect = 1.214e-21
Identity = 48/90 (53.33%), Postives = 67/90 (74.44%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T +LIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++D +DNEI + DGFP LKRL ++   NN+I +I + +   +PN+T L+
Sbjct:    5 TADLIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDTIDCSDNEIRKLDGFPLLKRLKTLLLNNNRICRIGEGIEHALPNLTELI 94          
BLAST of SMED30028771 vs. Ensembl Xenopus
Match: SNRPA1 (small nuclear ribonucleoprotein polypeptide A' [Source:NCBI gene;Acc:100486145])

HSP 1 Score: 69.707 bits (169), Expect = 6.549e-13
Identity = 35/67 (52.24%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1271 GNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1471
            G KI +IENLG TLDQFD++D +DNEI + DGFP LKRL ++   NN+I +I + +   +PN+T L+
Sbjct:    5 GYKIPVIENLGATLDQFDTIDCSDNEIRKLDGFPLLKRLKTLLLNNNRICRIGEGIEHALPNLTELI 71          
BLAST of SMED30028771 vs. Ensembl Mouse
Match: Snrpa1 (small nuclear ribonucleoprotein polypeptide A' [Source:MGI Symbol;Acc:MGI:1916231])

HSP 1 Score: 108.612 bits (270), Expect = 2.154e-27
Identity = 50/90 (55.56%), Postives = 69/90 (76.67%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+
Sbjct:    5 TAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELI 94          
BLAST of SMED30028771 vs. Ensembl Mouse
Match: Snrpa1 (small nuclear ribonucleoprotein polypeptide A' [Source:MGI Symbol;Acc:MGI:1916231])

HSP 1 Score: 110.153 bits (274), Expect = 7.948e-27
Identity = 50/90 (55.56%), Postives = 69/90 (76.67%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+
Sbjct:    5 TAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELI 94          
BLAST of SMED30028771 vs. Ensembl Mouse
Match: Gm45213 (predicted gene 45213 [Source:MGI Symbol;Acc:MGI:5753789])

HSP 1 Score: 68.5514 bits (166), Expect = 6.558e-14
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = -3
Query: 1325 GNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKI 1471
            G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I
Sbjct:   53 GYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRI 101          
BLAST of SMED30028771 vs. UniProt/SwissProt
Match: sp|P57784|RU2A_MOUSE (U2 small nuclear ribonucleoprotein A' OS=Mus musculus OX=10090 GN=Snrpa1 PE=1 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 5.559e-26
Identity = 50/90 (55.56%), Postives = 69/90 (76.67%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+
Sbjct:    5 TAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELI 94          
BLAST of SMED30028771 vs. UniProt/SwissProt
Match: sp|Q4R8Y8|RU2A_MACFA (U2 small nuclear ribonucleoprotein A' OS=Macaca fascicularis OX=9541 GN=SNRPA1 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 6.318e-26
Identity = 50/90 (55.56%), Postives = 69/90 (76.67%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+
Sbjct:    5 TAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELI 94          
BLAST of SMED30028771 vs. UniProt/SwissProt
Match: sp|P09661|RU2A_HUMAN (U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 6.318e-26
Identity = 50/90 (55.56%), Postives = 69/90 (76.67%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELIE + Q TN ++DRELDL+G KI +IENLG TLDQFD++DF+DNEI + DGFP L+RL ++   NN+I +I + L+Q +P +T L+
Sbjct:    5 TAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELI 94          
BLAST of SMED30028771 vs. UniProt/SwissProt
Match: sp|Q9V4Q8|RU2A_DROME (Probable U2 small nuclear ribonucleoprotein A' OS=Drosophila melanogaster OX=7227 GN=U2A PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.859e-21
Identity = 43/90 (47.78%), Postives = 65/90 (72.22%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELI  S+Q  NP ++RELDL+G KI  IENLG TLDQFD++D +DN++ + D  P+L RL  +   NN+I++IS+ L + +PN+ +++
Sbjct:    5 TPELINQSMQYINPCRERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNNRILRISEGLEEAVPNLGSII 94          
BLAST of SMED30028771 vs. UniProt/SwissProt
Match: sp|P43333|RU2A_ARATH (U2 small nuclear ribonucleoprotein A' OS=Arabidopsis thaliana OX=3702 GN=At1g09760 PE=2 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 1.121e-20
Identity = 45/90 (50.00%), Postives = 65/90 (72.22%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T +LI  S    N +K+RELDL+GNKI +IENLG T DQFD++D +DNEI + + FPYL RL ++   NN+I +I+ +L +F+P + +LV
Sbjct:    5 TADLIWKSPHFFNAIKERELDLRGNKIPVIENLGATEDQFDTIDLSDNEIVKLENFPYLNRLGTLLINNNRITRINPNLGEFLPKLHSLV 94          
BLAST of SMED30028771 vs. TrEMBL
Match: A0A0R3W6A7 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5718 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.923e-27
Identity = 54/90 (60.00%), Postives = 73/90 (81.11%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T++L+E ++Q TNPL+DRELDL+G K+  IENLG+TLDQFD++DFTDNEI + DGFP L+RL S+  T NKI++I +DL   IPN+ TL+
Sbjct:    5 TIDLVEGAMQYTNPLRDRELDLRGYKVPAIENLGSTLDQFDTIDFTDNEIRKLDGFPLLQRLKSLIMTGNKIIRIGEDLVSSIPNLETLI 94          
BLAST of SMED30028771 vs. TrEMBL
Match: A0A212EL18 (U2 small nuclear ribonucleoprotein A OS=Danaus plexippus plexippus OX=278856 GN=KGM_205764 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 5.134e-27
Identity = 53/90 (58.89%), Postives = 73/90 (81.11%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T ELI++S+Q  NP +DRELDL+G KI  IENLG TLDQFD++DF+DN+I + DGFP LKRL  + F NN+IV+++++L Q++PN+ TLV
Sbjct:    5 TTELIQSSMQYINPCRDRELDLRGYKIPQIENLGATLDQFDTIDFSDNDIRKLDGFPLLKRLKCLFFNNNRIVRLTENLEQYLPNLETLV 94          
BLAST of SMED30028771 vs. TrEMBL
Match: A0A068X2E0 (U2 small nuclear ribonucleoprotein A OS=Echinococcus granulosus OX=6210 GN=EgrG_000378600 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 5.899e-27
Identity = 54/90 (60.00%), Postives = 73/90 (81.11%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T++L+E ++Q TNPL+DRELDL+G K+  IENLG+TLDQFD++DFTDNEI + DGFP L+RL S+  T NKI++I +DL   IPN+ TL+
Sbjct:    5 TIDLVEGAMQYTNPLRDRELDLRGYKVPAIENLGSTLDQFDTIDFTDNEIRKLDGFPLLQRLKSLIMTGNKIIRIGEDLVSSIPNLETLI 94          
BLAST of SMED30028771 vs. TrEMBL
Match: A0A068XWA0 (U2 small nuclear ribonucleoprotein A OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000378600 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 5.958e-27
Identity = 54/90 (60.00%), Postives = 73/90 (81.11%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T++L+E ++Q TNPL+DRELDL+G K+  IENLG+TLDQFD++DFTDNEI + DGFP L+RL S+  T NKI++I +DL   IPN+ TL+
Sbjct:    5 TIDLVEGAMQYTNPLRDRELDLRGYKVPAIENLGSTLDQFDTIDFTDNEIRKLDGFPLLQRLKSLIMTGNKIIRIGEDLVSSIPNLETLI 94          
BLAST of SMED30028771 vs. TrEMBL
Match: A0A0R3UG10 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6109 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 6.307e-27
Identity = 54/90 (60.00%), Postives = 73/90 (81.11%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T +L+E ++Q TNPLKDRELDL+G K+  IENLG+TLDQFD++DFTDNEI + DGFP L+RL ++  T+NKIV+I +DL   +PN+ TL+
Sbjct:    5 TTDLVEGAMQYTNPLKDRELDLRGYKVPAIENLGSTLDQFDTIDFTDNEIRKLDGFPLLQRLKALILTDNKIVRIGEDLVSSVPNLETLI 94          
BLAST of SMED30028771 vs. Ensembl Cavefish
Match: snrpa1 (small nuclear ribonucleoprotein polypeptide A' [Source:ZFIN;Acc:ZDB-GENE-041114-82])

HSP 1 Score: 98.2117 bits (243), Expect = 1.835e-24
Identity = 44/72 (61.11%), Postives = 58/72 (80.56%), Query Frame = -3
Query: 1325 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKI 1540
            + ELIE + Q TNP++DRELDL+G KI ++ENLG TLDQFD++DF+DNEI + DGFP LKRL ++   NN+I
Sbjct:    5 SAELIEQAAQYTNPVRDRELDLRGYKIPVLENLGATLDQFDTIDFSDNEIRKLDGFPLLKRLKTVLMNNNRI 76          
BLAST of SMED30028771 vs. Ensembl Nematostella
Match: EDO45144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTT8])

HSP 1 Score: 101.293 bits (251), Expect = 2.477e-24
Identity = 44/90 (48.89%), Postives = 69/90 (76.67%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            T EL+    Q TN +KDRELDL+G KI++IEN+G TLDQFD++DF+DN+I + +GFP LKRL +I   NN++ ++++ L + +PN+ +++
Sbjct:    4 TAELMLQCPQFTNAVKDRELDLRGCKISVIENMGATLDQFDTIDFSDNDIRKIEGFPLLKRLKTILLNNNRVCRVAEGLGECLPNLESII 93          
BLAST of SMED30028771 vs. Planmine SMEST
Match: SMESG000014464.1 (SMESG000014464.1)

HSP 1 Score: 182.185 bits (461), Expect = 1.092e-53
Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = -3
Query: 1271 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 1540
            TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV
Sbjct:    5 TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEIHRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLV 94          

HSP 2 Score: 114.39 bits (285), Expect = 1.220e-28
Identity = 54/55 (98.18%), Postives = 55/55 (100.00%), Query Frame = -1
Query:  793 DSSKQVIMRPSSADMYALRASIQNATTMEEVDRLNFILNSGKYAGFASAPRQMRG 957
            DSSKQVIMRPSSADMYALRA+IQNATTMEEVDRLNFILNSGKYAGFASAPRQMRG
Sbjct:  201 DSSKQVIMRPSSADMYALRAAIQNATTMEEVDRLNFILNSGKYAGFASAPRQMRG 255          
The following BLAST results are available for this feature:
BLAST of SMED30028771 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SNRPA13.138e-2755.56small nuclear ribonucleoprotein polypeptide A' [So... [more]
SNRPA13.138e-2755.56small nuclear ribonucleoprotein polypeptide A' [So... [more]
SNRPA11.316e-2655.56small nuclear ribonucleoprotein polypeptide A' [So... [more]
back to top
BLAST of SMED30028771 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mog-27.420e-1643.33Probable U2 small nuclear ribonucleoprotein A' [S... [more]
mog-27.420e-1643.33Probable U2 small nuclear ribonucleoprotein A' [S... [more]
back to top
BLAST of SMED30028771 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
U2A1.855e-2247.78gene:FBgn0033210 transcript:FBtr0088941[more]
back to top
BLAST of SMED30028771 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snrpa13.264e-2753.33small nuclear ribonucleoprotein polypeptide A' [So... [more]
snrpa11.599e-2653.33small nuclear ribonucleoprotein polypeptide A' [So... [more]
back to top
BLAST of SMED30028771 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SNRPA11.214e-2153.33small nuclear ribonucleoprotein polypeptide A' [So... [more]
SNRPA16.549e-1352.24small nuclear ribonucleoprotein polypeptide A' [So... [more]
back to top
BLAST of SMED30028771 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Snrpa12.154e-2755.56small nuclear ribonucleoprotein polypeptide A' [So... [more]
Snrpa17.948e-2755.56small nuclear ribonucleoprotein polypeptide A' [So... [more]
Gm452136.558e-1461.22predicted gene 45213 [Source:MGI Symbol;Acc:MGI:57... [more]
back to top
BLAST of SMED30028771 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P57784|RU2A_MOUSE5.559e-2655.56U2 small nuclear ribonucleoprotein A' OS=Mus muscu... [more]
sp|Q4R8Y8|RU2A_MACFA6.318e-2655.56U2 small nuclear ribonucleoprotein A' OS=Macaca fa... [more]
sp|P09661|RU2A_HUMAN6.318e-2655.56U2 small nuclear ribonucleoprotein A' OS=Homo sapi... [more]
sp|Q9V4Q8|RU2A_DROME1.859e-2147.78Probable U2 small nuclear ribonucleoprotein A' OS=... [more]
sp|P43333|RU2A_ARATH1.121e-2050.00U2 small nuclear ribonucleoprotein A' OS=Arabidops... [more]
back to top
BLAST of SMED30028771 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3W6A74.923e-2760.00Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A212EL185.134e-2758.89U2 small nuclear ribonucleoprotein A OS=Danaus ple... [more]
A0A068X2E05.899e-2760.00U2 small nuclear ribonucleoprotein A OS=Echinococc... [more]
A0A068XWA05.958e-2760.00U2 small nuclear ribonucleoprotein A OS=Echinococc... [more]
A0A0R3UG106.307e-2760.00Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of SMED30028771 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
snrpa11.835e-2461.11small nuclear ribonucleoprotein polypeptide A' [So... [more]
back to top
BLAST of SMED30028771 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028771 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028771 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO451442.477e-2448.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30028771 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028771 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000014464.11.092e-53100.00SMESG000014464.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028771 ID=SMED30028771|Name=SMED30028771|organism=Schmidtea mediterranea sexual|type=transcript|length=1542bp
CGCAAATAAACCAATTCAAGCCCGGATTTATTGGACCCTGGCCATAATCG
ATCAAACATTACCAGGAATGCAAAAATGTAGCTAATTGGACTTAAATTTA
GTGTGAACTCCGATATATAAATATCCGCGATTAAAACTGTAATAGAGAGA
ATTATCTCAGCAACTTCTAGCACCGGAGACGGTTCAATGGTGAAATATGA
ATGAGAATGTCCATCAGAAGTGTCATCACGTTATTCACTGTAGCTAATTT
GTTTCAATTCGTCCGTTAGCAACGATATCCTNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNAATGAAAATCATTCAAATATTCCACTCAA
AATCCTCCAATCAAATAAAGGCAAAGACAACAATTCAATTATTTACATGC
TAATGAACTCAATAAACAGAAAACTATATTATATTCATCTCAGCCGCGCA
TTTGACGAGGAGCCGATGCAAAACCTGCATATTTGCCAGAATTAAGGATG
AAATTCAGCCTGTCGACCTCCTCCATGGTGGTCGCGTTCTGGATTGACGC
TCGAAGCGCATACATGTCTGCCGATGAGGGTCTCATTATGACCTGCTTGG
AACTGTCGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNAAAACAAGAGTTGTGATGTTGGGAATAAATTG
ATTCAGATCTTTTGAGATTTTCACAATTTTGTTATTTGTAAAATTAATAC
TTGCCAATCTTTTTAAGTATGGAAACCCATCAAATCTGTGAATTTCATTA
TCTGTAAAATCTAATGAATCAAACTGATCTAAAGTAGTTCCAAGATTTTC
AATAAGCGCTATTTTATTTCCTTTTAAGTCTAATTCTCGGTCTTTCAATG
GATTAGTACGCTGGATTGAATTTTCAATTAATTCAAGAGTTA
back to top

protein sequence of SMED30028771-orf-1

>SMED30028771-orf-1 ID=SMED30028771-orf-1|Name=SMED30028771-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=233bp
TLELIENSIQRTNPLKDRELDLKGNKIALIENLGTTLDQFDSLDFTDNEI
HRFDGFPYLKRLASINFTNNKIVKISKDLNQFIPNITTLVXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFQAG
HNETLIGRHVCASSVNPERDHHGGGRQAEFHP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf