Regulator of G-protein signaling 22

Overview
NameRegulator of G-protein signaling 22
Smed IDSMED30028743
Length (bp)3727
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulator of G-protein signaling 22 (SMED30028743) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulator of G-protein signaling 22 (SMED30028743) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulator of G-protein signaling 22 (SMED30028743) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulator of G-protein signaling 22 (SMED30028743) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028743

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30028743SMESG000069110.1 SmedASXL_015758SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30028743SMESG000069110.1 dd_Smed_v4_11778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30028743SMESG000069110.1 dd_Smed_v4_11778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028743SMESG000069110.1 dd_Smed_v4_11778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028743SMESG000069110.1 dd_Smed_v4_11778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028743SMESG000069110.1 dd_Smed_v4_11778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30028743SMESG000069110.1 dd_Smed_v4_11778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30028743SMESG000069110.1 dd_Smed_v4_11778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028743SMESG000081574.1 SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000069110.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig48540uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028743SMESG000081574.1 SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000069110.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig48540newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028743SMESG000069110.1 Contig47814uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028743SMESG000069110.1 Contig47814newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30028743SMESG000069110.1 dd_Smed_v6_11778_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30028743SMESG000069110.1 dd_Smed_v4_11778_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30028743SMESG000069110.1 dd_Smed_v4_11778_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Human
Match: RGS22 (regulator of G protein signaling 22 [Source:HGNC Symbol;Acc:HGNC:24499])

HSP 1 Score: 58.151 bits (139), Expect = 1.054e-7
Identity = 42/129 (32.56%), Postives = 66/129 (51.16%), Query Frame = 2
Query: 2918 ILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSKEINLGIFDEATYHCLKNLLPYWAGF 3304
            I+A + A   P++ +   F  ++  KG     + LE  L F+ EV K +++C +  DE + +KKI  I N F+ S  PP++QI+IP + AQ+II         KE+   +F EA       L  +W  F
Sbjct: 1006 IIAFRKALLNPVTSR--QFQRFVALKG-----DLLENGLLFWQEVQKYKDLCHSHCDESVIQKKITTIINCFINSSIPPALQIDIPVEQAQKIIEHR------KELGPYVFREAQMTIFGVLFKFWPQF 1121          
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Human
Match: RGS22 (regulator of G protein signaling 22 [Source:HGNC Symbol;Acc:HGNC:24499])

HSP 1 Score: 58.151 bits (139), Expect = 1.088e-7
Identity = 42/129 (32.56%), Postives = 66/129 (51.16%), Query Frame = 2
Query: 2918 ILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSKEINLGIFDEATYHCLKNLLPYWAGF 3304
            I+A + A   P++ +   F  ++  KG     + LE  L F+ EV K +++C +  DE + +KKI  I N F+ S  PP++QI+IP + AQ+II         KE+   +F EA       L  +W  F
Sbjct:  838 IIAFRKALLNPVTSR--QFQRFVALKG-----DLLENGLLFWQEVQKYKDLCHSHCDESVIQKKITTIINCFINSSIPPALQIDIPVEQAQKIIEHR------KELGPYVFREAQMTIFGVLFKFWPQF 953          
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Human
Match: RGS22 (regulator of G protein signaling 22 [Source:HGNC Symbol;Acc:HGNC:24499])

HSP 1 Score: 58.151 bits (139), Expect = 1.111e-7
Identity = 42/129 (32.56%), Postives = 66/129 (51.16%), Query Frame = 2
Query: 2918 ILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSKEINLGIFDEATYHCLKNLLPYWAGF 3304
            I+A + A   P++ +   F  ++  KG     + LE  L F+ EV K +++C +  DE + +KKI  I N F+ S  PP++QI+IP + AQ+II         KE+   +F EA       L  +W  F
Sbjct: 1019 IIAFRKALLNPVTSR--QFQRFVALKG-----DLLENGLLFWQEVQKYKDLCHSHCDESVIQKKITTIINCFINSSIPPALQIDIPVEQAQKIIEHR------KELGPYVFREAQMTIFGVLFKFWPQF 1134          
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Human
Match: RGS22 (regulator of G protein signaling 22 [Source:HGNC Symbol;Acc:HGNC:24499])

HSP 1 Score: 58.151 bits (139), Expect = 1.177e-7
Identity = 42/129 (32.56%), Postives = 66/129 (51.16%), Query Frame = 2
Query: 2918 ILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSKEINLGIFDEATYHCLKNLLPYWAGF 3304
            I+A + A   P++ +   F  ++  KG     + LE  L F+ EV K +++C +  DE + +KKI  I N F+ S  PP++QI+IP + AQ+II         KE+   +F EA       L  +W  F
Sbjct: 1007 IIAFRKALLNPVTSR--QFQRFVALKG-----DLLENGLLFWQEVQKYKDLCHSHCDESVIQKKITTIINCFINSSIPPALQIDIPVEQAQKIIEHR------KELGPYVFREAQMTIFGVLFKFWPQF 1122          
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Xenopus
Match: ENSXETT00000018771.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:113311720:113334466:1 gene:ENSXETG00000007858.1 transcript:ENSXETT00000018771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 1.805e-6
Identity = 37/133 (27.82%), Postives = 64/133 (48.12%), Query Frame = 2
Query: 3008 KMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSKEINLG--IFDEATYHCLKNLLPYWAGFQKNWKEPMENKFNPINKYQRL-----LERRMK 3385
            K + LE  L F++EV K +++C +  D+   + KI  I N F+ S  PP++QI+IP + A         ++  +  +LG  +F EA       +  +W  F    +   E K  P    ++L     ++RRM+
Sbjct:  369 KGDFLENGLLFWIEVQKYKDLCHSHCDDFTIQNKITAIINCFINSSIPPALQIDIPQEQA--------EKILERRRDLGPYVFREAQMTVFSIMFKFWPEFCDFRRNLTEEKILPFLDRKKLKQTEAVKRRMR 493          
BLAST of Regulator of G-protein signaling 22 vs. UniProt/SwissProt
Match: sp|Q8NE09|RGS22_HUMAN (Regulator of G-protein signaling 22 OS=Homo sapiens OX=9606 GN=RGS22 PE=1 SV=3)

HSP 1 Score: 58.151 bits (139), Expect = 5.337e-7
Identity = 42/129 (32.56%), Postives = 66/129 (51.16%), Query Frame = 2
Query: 2918 ILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSKEINLGIFDEATYHCLKNLLPYWAGF 3304
            I+A + A   P++ +   F  ++  KG     + LE  L F+ EV K +++C +  DE + +KKI  I N F+ S  PP++QI+IP + AQ+II         KE+   +F EA       L  +W  F
Sbjct: 1019 IIAFRKALLNPVTSR--QFQRFVALKG-----DLLENGLLFWQEVQKYKDLCHSHCDESVIQKKITTIINCFINSSIPPALQIDIPVEQAQKIIEHR------KELGPYVFREAQMTIFGVLFKFWPQF 1134          
BLAST of Regulator of G-protein signaling 22 vs. TrEMBL
Match: A0A267DJF9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019187g1 PE=4 SV=1)

HSP 1 Score: 451.825 bits (1161), Expect = 1.351e-134
Identity = 299/888 (33.67%), Postives = 502/888 (56.53%), Query Frame = 2
Query: 1001 IEGRQKISLQRLKEMIIGTHEGMNEFGKFLMSTVGKSLCEFWLDCEQLKDLSYFRTEEENIDLRNNLMRNLKDKYKLSLTKAAKDQLNEAMKNSEKLHSIFLQAQYDTLRRLRSYWLPRYIIHQETLMRQYTITDLQFLRFPSFHSDTT---SIQSGVFPKILLQKTLPYSTDKTKLEKM--NWTEIMCMSNR--SVIEPTKTDSTSRETSGNSNGIFRRSAFQNRLRFALGFDAAAGGPFKNYLNSQNQIQQI-RHVEFFQEVLKFKSIFSRNSDRLLRISHAWSIVNKFLLPVESNFLEIPIEDSKEIILMIQKYKSSIKSTIFDEIVEISVKKVQQQWLIYLKEEVKRFMESSLTHFDNETPPNXXXXXXXXXXXXXXXXRR----KLNIKGTEEKQSTWNKLSKKEKRNRREAALRLKEITENERQKVLKAVKKRIQE---------------EIKRSQXXXXXXXXXXXXNAIVSGEEMEIKVEEK--------IPEAKNVLRSKTMLSLFKKYATDHADKIGKDATNSVMLLNDLATYFSFG-GIDKAVISTKDSKASFIYKNYFDKTAKRLVPL-SGKIRNKLSNEQERPKTPTLKDVQNHVYNMLTEAFNEFWKFEITELGVKSEVLAKMNEKELLLIAENQLLEIXXXXXXXXXXXXXX--XXEDKKELILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSK---EINLGIFDEATYHCLKNLLPYWAGFQKNWKEPMENKFNPINKYQRLLERRMKIYNDIPIPKADVVSLPMVPKSTN--LTTLSYTMNDGAKWKSQEQAQDSNNN 3532
            +E RQ +   RLKE+++   +G+ EF +FL  T G  L +FWLDCE  KD +  R++ +N   R  L+R+L+DKY+L LT+ AK Q+  A  + +K +SI L+ QYD LRRLRSYWLPRYIIH+E  +   T +DLQ     ++ +D T   S  S +FP + L  ++P   D      +  +W  +     +    I   K     ++ +  +  +     FQ RLR AL  D  AGGPF+++L  +++  ++   + FFQEV ++     R +DR LR+ HAW+I N++L    +  +++   +++ I+  +++ K ++ + +F +  +  V ++   WL +LKE+VK F+ESS++H D+++PP   DE++V IE+ KI+V+R    +   +   +++ +W+ L+ +EK  RR+AA   + +TE ER+K LKA +KR++E               E    Q+E      +   +A+    E     ++          PE K + +++ +++LFKKYA+D   K GKD+ N++ L  +   +     G+       +D  A ++YK Y +K  KR V + S +++ +L+ +++RPKTPTLKD+ +H+++ L   F+ FW+++  E+G+    L  M+EKEL + A+   L++         +T     TKEDK E ++AL+     PLSLQ+LYF+ YL++    DK+ +L+++LFFYVE  K +E      DEE  K+KI  IS+ FLESV PP +QI + ND+ Q+ +R  Q+  + K   EI+  IFDEA +   K +LPYWAGF K W  P   ++ P+++ +R+LE R++ +     P  +   LP +P  +   +++L+ ++ DG KWK  +  +   N+
Sbjct:  322 LEARQNLPFDRLKELMLANRQGVQEFFEFLRPTAGLHLVDFWLDCEFYKDTALERSDADNRQTRGRLLRDLQDKYRLRLTEEAKAQMRNAANDHQKANSILLRTQYDVLRRLRSYWLPRYIIHKERELTGQTFSDLQ----QAWLNDATRRASAMSTIFPSLSLVNSMPVRPDLAHNLAITESWDRVRAGGRQLDDRIRSAKGGPQLQQPALAAKPVSASRPFQARLRDALTVDRIAGGPFRSFLEMRHRDPELLACLMFFQEVEEYSRRDERTADRFLRLGHAWNIFNRYLNVSAAQPVKVDKRENQLILDALRRSKDTVPAKVFAKAQDSVVVRMGDTWLRFLKEDVKNFLESSVSHRDSDSPPKTSDEIQVYIENGKIIVKRIQPERSQAQLQLQRRRSWDFLTDEEKAERRKAAAERRRVTELERKKALKAARKRLKEMEESGRKKKTLVPLEEESEIQDETPETTFDSRPDAVKEDYEGRASAKKVEEEEEVEKAPELKEMTKNRAVMALFKKYASD---KEGKDSVNALSLYQETLEFLELPPGVSDKAKKKRDGNALYLYKTYLEKGCKRRVEVTSERLQQRLTVDKDRPKTPTLKDLSSHLHSKLNLLFSNFWQYQSEEMGIDMSALKNMSEKELRMRAD---LDVGAGGRRGKKATGKAPPTKEDKVEFLVALEKNLSGPLSLQMLYFYRYLMQYAVQDKVPHLDKNLFFYVEAQKYKEFALGGCDEEFLKRKIHVISSIFLESVFPPPLQITVSNDVHQRTLRNAQKFYSPKFKEEISPTIFDEAQFAVFKEMLPYWAGFMKQWT-PTGKEYRPVSQQKRMLEERLQKFEKSDKPNVN-FKLPELPAHSGGPISSLTMSLMDGIKWKDDDDKRPRRND 1197          

HSP 2 Score: 126.331 bits (316), Expect = 2.030e-25
Identity = 60/114 (52.63%), Postives = 79/114 (69.30%), Query Frame = 1
Query:  139 GNITVENLQDLLIYDDTFLDYFNVFLKLPVFPQPLEYQRLTDSFTILDEGGDSVV--SGNSNPPFMASEAEHCKLLEWAQKYRLPLFLKTDLFRELKLSKLLIKPVETLCCSSR 474
            G   +ENL+D+LIYDD FLDYFN FL LP FPQ L+Y RLT +F I+D   DS+V  S +S P + A++ E   ++ WAQ  RLPLF KT+L+RE KL KLL++PV+     +R
Sbjct:    7 GRQALENLEDMLIYDDMFLDYFNAFLSLPAFPQVLQYHRLTGTFRIVDTADDSLVEWSNSSEPLYGATDDERETIMTWAQNERLPLFTKTELYREYKLCKLLLRPVDARKIGTR 120          
BLAST of Regulator of G-protein signaling 22 vs. TrEMBL
Match: A0A267H2P4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019187g2 PE=4 SV=1)

HSP 1 Score: 448.743 bits (1153), Expect = 2.052e-133
Identity = 298/888 (33.56%), Postives = 501/888 (56.42%), Query Frame = 2
Query: 1001 IEGRQKISLQRLKEMIIGTHEGMNEFGKFLMSTVGKSLCEFWLDCEQLKDLSYFRTEEENIDLRNNLMRNLKDKYKLSLTKAAKDQLNEAMKNSEKLHSIFLQAQYDTLRRLRSYWLPRYIIHQETLMRQYTITDLQFLRFPSFHSDTT---SIQSGVFPKILLQKTLPYSTDKTKLEKM--NWTEIMCMSNR--SVIEPTKTDSTSRETSGNSNGIFRRSAFQNRLRFALGFDAAAGGPFKNYLNSQNQIQQI-RHVEFFQEVLKFKSIFSRNSDRLLRISHAWSIVNKFLLPVESNFLEIPIEDSKEIILMIQKYKSSIKSTIFDEIVEISVKKVQQQWLIYLKEEVKRFMESSLTHFDNETPPNXXXXXXXXXXXXXXXXRR----KLNIKGTEEKQSTWNKLSKKEKRNRREAALRLKEITENERQKVLKAVKKRIQE---------------EIKRSQXXXXXXXXXXXXNAIVSGEEMEIKVEEK--------IPEAKNVLRSKTMLSLFKKYATDHADKIGKDATNSVMLLNDLATYFSFG-GIDKAVISTKDSKASFIYKNYFDKTAKRLVPL-SGKIRNKLSNEQERPKTPTLKDVQNHVYNMLTEAFNEFWKFEITELGVKSEVLAKMNEKELLLIAENQLLEIXXXXXXXXXXXXXX--XXEDKKELILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSK---EINLGIFDEATYHCLKNLLPYWAGFQKNWKEPMENKFNPINKYQRLLERRMKIYNDIPIPKADVVSLPMVPKSTN--LTTLSYTMNDGAKWKSQEQAQDSNNN 3532
            +E RQ +   RLKE+++   +G+ EF +FL  T G  L +FWLDCE  KD +  R+  +N   R  L+R+L+DKY+L LT+ AK Q+  A  + +K +SI L+ QYD LRRLRSYWLPRYIIH+E  +   T +DLQ     ++ +D T   S  S +FP + L  ++P   D      +  +W  +     +    I   K     ++ +  +  +     FQ RLR AL  D  AGGPF+++L  +++  ++   + FFQEV ++     R +DR LR+ HAW+I N++L    +  +++   +++ I+  +++ K ++ + +F +  +  V ++   WL +LKE+VK F+ESS++H D+++PP   DE++V IE+ KI+V+R    +   +   +++ +W+ L+ +EK  RR+AA   + +TE ER+K LKA +KR++E               E    Q+E      +   +A+    E     ++          PE K + +++ +++LFKKYA+D   K GKD+ N++ L  +   +     G+       +D  A ++YK Y +K  KR V + S +++ +L+ +++RPKTPTLKD+ + +++ L   F+ FW+++  E+G+    L  M+EKEL + A+   L++         +T     TKEDK E ++AL+     PLSLQ+LYF+ YL++    DK+ +L+++LFFYVE  K +E  +   DEE  K+KI  IS+ FLESV PP +QI + ND+ Q+ +R  Q+  + K   EI+  IFDEA +   K +LPYWAGF K W  P   ++ P+++ +R+LE R++ +     P  +   LP +P  +   +++L+ ++ DG KWK  +  +   N+
Sbjct:  322 LEARQNLPFDRLKELMLANRQGVQEFFEFLRPTAGLHLVDFWLDCEFYKDTALERSNADNRQTRGRLLRDLQDKYRLRLTEEAKAQMRNAANDHQKANSILLRTQYDVLRRLRSYWLPRYIIHKERELTGQTFSDLQ----QAWLNDATRRASAMSTIFPSLSLVNSMPVRPDLAHNLAITESWDRVRAGGRQLDDRIRSAKGGPQLQQPALAAKPVSASRPFQARLRDALTVDRIAGGPFRSFLEMRHRDPELLACLMFFQEVEEYSRRDERTADRFLRLGHAWNIFNRYLNVSAAQPVKVDKRENQLILDALRRSKDTVPAKVFAKAQDSVVVRMGDTWLRFLKEDVKNFLESSVSHRDSDSPPKTSDEIQVYIENGKIIVKRIQPERSQAQLQLQRRRSWDFLTDEEKAERRKAAAERRRVTELERKKALKAARKRLKEMEESGRKKKTLVPLEEESEIQDETPETTFDSRPDAVKEDYEGRASTKKVEEEEEVEKAPELKEMTKNRAVMALFKKYASD---KEGKDSVNALSLYQETLEFLELPPGVSDKAKKKRDGNALYLYKTYLEKGCKRRVEVTSERLQQRLTVDKDRPKTPTLKDLSSRLHSKLNLLFSNFWQYQSEEMGIDMSALKNMSEKELRMRAD---LDVGAGGRRGKKATGKAPPTKEDKVEFLVALEKNLSGPLSLQMLYFYRYLMQYAVQDKVPHLDKNLFFYVEAQKYKEFAQGGCDEEFLKRKIHVISSIFLESVFPPPLQITVSNDVHQRTLRNAQKFYSPKFKEEISPTIFDEAQFAVFKEMLPYWAGFMKQWT-PTGKEYRPVSQQKRMLEERLQKFEKSDKPNVN-FKLPELPAHSGGPISSLTMSLMDGIKWKDDDDKRPRRND 1197          

HSP 2 Score: 126.331 bits (316), Expect = 2.265e-25
Identity = 60/114 (52.63%), Postives = 79/114 (69.30%), Query Frame = 1
Query:  139 GNITVENLQDLLIYDDTFLDYFNVFLKLPVFPQPLEYQRLTDSFTILDEGGDSVV--SGNSNPPFMASEAEHCKLLEWAQKYRLPLFLKTDLFRELKLSKLLIKPVETLCCSSR 474
            G   +ENL+D+LIYDD FLDYFN FL LP FPQ L+Y RLT +F I+D   DS+V  S +S P + A++ E   ++ WAQ  RLPLF KT+L+RE KL KLL++PV+     +R
Sbjct:    7 GRQALENLEDMLIYDDMFLDYFNAFLSLPAFPQVLQYHRLTGTFRIVDTADDSLVEWSNSSEPLYGATDDERETIMTWAQNERLPLFTKTELYREYKLCKLLLRPVDARKIGTR 120          
BLAST of Regulator of G-protein signaling 22 vs. TrEMBL
Match: A0A267DKL7 (RGS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009911g1 PE=4 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 2.105e-115
Identity = 260/792 (32.83%), Postives = 445/792 (56.19%), Query Frame = 2
Query: 1259 LNEAMKNSEKLHSIFLQAQYDTLRRLRSYWLPRYIIHQETLMRQYTITDLQFLRFPSFHSDTT---SIQSGVFPKILLQKTLPYSTDKTKLEKM--NWTEIMCMSNR--SVIEPTKTDSTSRETSGNSNGIFRRSAFQNRLRFALGFDAAAGGPFKNYLNSQNQIQQI-RHVEFFQEVLKFKSIFSRNSDRLLRISHAWSIVNKFLLPVESNFLEIPIEDSKEIILMIQKYKSSIKSTIFDEIVEISVKKVQQQWLIYLKEEVKRFMESSLTHFDNETPPNXXXXXXXXXXXXXXXXRR----KLNIKGTEEKQSTWNKLSKKEKRNRREAALRLKEITENERQKVLKAVKKRI---QEEIKRSQXXXXXXXXXXXXNAIVSGEEMEIKVE----------EKIPEAKNVLRSKTMLSLFKKYATDHADKIGKDATNSVMLLNDLATYFSFG-GIDKAVISTKDSKASFIYKNYFDKTAKRLVPL-SGKIRNKLSNEQERPKTPTLKDVQNHVYNMLTEAFNEFWKFEITELGVKSEVLAKMNEKELLLIAENQLLEIXXXXXXXXXXXXXX--XXEDKKELILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSK---EINLGIFDEATYHCLKNLLPYWAGFQKNWKEPMENKFNPINKYQRLLERRMKIYNDIPIPKADVVSLPMVPKSTN--LTTLSYTMNDGAKWKSQEQAQDSNNN 3532
            +  A  + +K +SI L+ QYD LRRLRSYWLPRYIIH+E  +   T +DLQ     ++ +D T   S  S +FP + L  ++P   D      +  +W  +     +    I   K     ++ +  +  +     FQ RLR AL  D  AGGPF+++L  +++  ++   + FFQEV ++     R +DR LR+ HAW+I N++L    +  +++   +++ I+  +++ K ++ + +F +  +  V ++   WL +LKE+VK F+ESS++H D+++PP   DE++V IE+ KI+V+R    +   +   +++ +W+ L+ +EK  RR+     + +TE ER+K LKA +KR+   +E  ++S+ + E              E+ E +            EK PE K + +++ +++LFKKYA+D   K GKD+ N++ L  +   +     G+       +D  A ++YK Y +K  KR V + S +++ +L+ +++RPKTPTLKD+ +H+++ L   F+ FW+++  E+G+    L  M+EKEL + A+   L++         +T     TKEDK E ++AL+     PLSLQ+LYF+ YL++    DK+ +L+++LFFYVE  K +E      DEE  K+KI  IS+ FLESV PP +QI + ND+ Q+ +R  Q+  + K   EI+  IFDEA +   K +LPYWAGF K W  P   ++ P+++ +R+LE R++ +     P  +   LP +P  +   +++L+ ++ DG KWK  +  +   N+
Sbjct:    1 MRNAANDHQKANSILLRTQYDVLRRLRSYWLPRYIIHKERELTGQTFSDLQ----QAWLNDATRRASAMSTIFPSLSLVNSMPVRPDLAHNLAITESWDRVRAGGRQLDDRIRSAKGGPQLQQPALAAKPVSASRPFQARLRDALTVDRIAGGPFRSFLEMRHRDPELLACLMFFQEVEEYSRRDERTADRFLRLGHAWNIFNRYLNVSAAQPVKVDKRENQLILDALRRSKDTVPAKVFAKAQDSVVVRMGDTWLRFLKEDVKNFLESSVSHRDSDSPPKTSDEIQVYIENGKIIVKRIQPERSQAQLQLQRRRSWDFLTDEEKAERRKVTAERRRVTELERKKALKAARKRLKEMEESGRKSEIQDETPETTFDSRPDAVKEDYEGRASAKKVEEEEEVEKAPELKEMTKNRAVMALFKKYASD---KEGKDSVNALSLYQETLEFLELPPGVSDKAKKKRDGNALYLYKTYLEKGCKRRVEVTSERLQQRLTVDKDRPKTPTLKDLSSHLHSKLNLLFSNFWQYQSEEMGIDMSALKNMSEKELRMRAD---LDVGAGGRRGKKATGKAPPTKEDKVEFLVALEKNLSGPLSLQMLYFYRYLMQYAVQDKVPHLDKNLFFYVEAQKYKEFALGGCDEEFLKRKIHVISSIFLESVFPPPLQITVSNDVHQRTLRNAQKFYSPKFKEEISPTIFDEAQFAVFKEMLPYWAGFMKQWT-PTGKEYRPVSQQKRMLEERLQKFEKSDKPNVN-FKLPELPAHSGGPISSLTMSLMDGIKWKDDDDKRPRRND 780          
BLAST of Regulator of G-protein signaling 22 vs. TrEMBL
Match: A0A210QCF5 (Regulator of G-protein signaling 22 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09701 PE=4 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 4.139e-100
Identity = 267/931 (28.68%), Postives = 480/931 (51.56%), Query Frame = 2
Query: 1001 IEGRQKISLQRLKEMIIGTHEGMNEFGKFLMSTVGKSLCEFWLDCEQLKDLSYFRTEEENIDLRNNLMRNLKDKYKLSLTKAAKDQLNEAMKNSEKLHSIFLQAQYDTLRRLRSYWLPRYIIHQETLMRQYTITDLQFLRFPSFHSDTTSIQSGVFPKILLQKTLPYSTDK--TKLEKMNWTEI----MCMSNRSVIEPTKTDSTSRETSGNSNGIFRRSAFQNRLRFALGFDAAAGGPFKNYLNSQNQIQQIRHVEFFQEVLKFKSIFSRNSDRLLRISHAWSIVNKFLLPVESNFLEIPIEDSKEIILMIQKYKSSIKSTIFDEIVEISVKKVQQQWLIYLKEEVKRFMESSLTHFDNETPPNXXXXXXXXXXXXXXXXRRKL----NIKGTEEKQS--------TWNKLSKKEKRNRREAALRLKEITENERQKVLKAVKKRIQEEIKRSQXXXXXXXXXXXXNAIVSGEEMEIKVEEKIPEAK------NVLRSKTMLSLFKKYATDHADKIGKDATNSVMLLNDLATYFSFGGIDKAVISTKDSKASFIYKNYFDKTAKRLVPLSGKIRNKLSNEQERPKTPTLKDVQNHVYNMLTEAFNEFWKFEITELGVKSEVLAKMNEKELLLIAENQ---------------------------LLEIXXXXXXXXXXXXXXXXEDKKELILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSKEINLGIFDEATYHCLKNLLPYWAGFQKNWKEPMENKFNPINKYQRLLERRMKIYNDIPIPKADVVSLPMVPKSTNLTTLSYTMNDGAKWK--SQEQAQ---DSNNNRQDGPGS-ESGKSVIIPYGKKFTRKASRLSV 3622
            +EGR K+S+Q+LKE  +G++ GM  + +FL  T G  L  FWLDCE  KD      E    DLRN L R+++D+YK++LT+ A++Q+++   ++   H+IFL+ QYD LRRLR+YW+PR++IHQE L     I     +   +  ++ T      FP I L  ++    D   T  +  NW  I     C+ NR       T +  R+      G       +NR   AL  D  AGGPF+ +L+ Q+    + ++ F+Q+V ++     R++DRLLR+ HAWSI NK+LLP     +     +  E+   + K K  +++++F+     S++++++ W+ YL+E++K F+++ +     E+PP+  D +++ +  +++++ R +     +  T+ +++            +  +++   R  A   ++  E ER+K ++A  +R++E  +R   E E             G++ME  ++++   AK       +  +K  +S FKK+  +  D   K+  N V L  D   Y + G   KA +  K+S++ FIYK Y D   K+ +  + K+ N++    ERPKT  +K++Q+ V   L EAF+ F   + +E G+     A +++ EL L    +                                ++  +     A  TK+D++E   AL+ ++   L+L +LYF+ YL + G  +    L++DLFFY+EV K ++      DEE  ++K+Q I + FL+++  P++QI++      + IR  QR +  K++   IFDE      K LLPYWAGF++ ++ P +    P+ K+Q++L++R++   +  IP ++   LP +P+ + +   +++++DG +W+  + E+AQ    S  +R +   +   GKS +    +K  +  S LSV
Sbjct:  360 LEGRLKMSIQQLKEQALGSYGGMEAYKEFLKGTAGDQLVNFWLDCEYYKDTVENFDELSKNDLRNRLFRDIRDRYKMNLTEDARNQISKTASSANLSHTIFLRTQYDVLRRLRAYWVPRFLIHQERLREFSDIGVGMGITMMAKLANGTRHSLPFFPSISLVNSMAVRPDDVLTYSKTKNWEYISQGGRCLDNRV------TSAKVRQLPPARIG-------KNRFIMALMGDKVAGGPFQRFLDRQSDRLLLSNLLFWQDVTEYGQSEDRSADRLLRLCHAWSIYNKYLLPSSEYSIGFSEAERDELHATLLKAKDFVEASVFNMAKFHSMERLERAWMRYLQEDLKTFLDAHVRP-GAESPPSTADVIQIAVVGDELLITRPMPWVKRVSTTDSQRALRLRQALGLGADMDSEQRAAMRAKARERRKEMERERKKAIRAAYRRVKEAKQRKDTEKE------------DGDDMEYDLDDEKRSAKPPPPFTEMTHNKQFMSNFKKHLLEAED---KERLNMVSLYLDTDNYLNLGS-SKADVKKKESQSGFIYKTYVDSHGKKHLTFTDKLTNRIG---ERPKTGAIKEMQSTVIPKLEEAFSTFLVEKASENGMDPRDFANLSQSELALRMGTETSMNWKKGRKGKEESARTTSQTDQGAGARRGRRNKINVKTGRAQPTKDDREEFFKALKSSAAGHLTLTMLYFYKYLQKHGEEENAPLLDKDLFFYIEVQKFKDGSHAYSDEESLRRKVQSIMDCFLDAIVSPALQIDVTAATQDKAIRAAQRYLAGKDVMASIFDEPQLMVFKELLPYWAGFRRTFQPPDDPTKRPVTKHQKMLKKRLEAIENYEIP-SNEFHLPSIPEGS-IAAYTFSLSDGVRWREVTTEEAQSILGSPIDRSETATTLRGGKSGVESTLRKRVKSQSHLSV 1255          

HSP 2 Score: 102.834 bits (255), Expect = 4.165e-18
Identity = 56/120 (46.67%), Postives = 73/120 (60.83%), Query Frame = 1
Query:  142 NITVENLQDLLIYDDTFLDYFNVFLKLPVFPQPLEYQRLTDSF---TILDEGGDSVVSGNSNPP--FMASEAEHCKLLEWAQKYRLPLFLKTDLFRELKLSKLLIKPVETLCCSSRETFT 486
            +IT EN +DLL YDD FLDYFN FL L VFP    Y RLT SF      D  G+   SG+S+    +  ++ E  +LL WA++ RLPLFL T LFRE KL KLL++ ++    + R + T
Sbjct:   23 DITGENFEDLLAYDDLFLDYFNAFLALNVFPIATTYNRLTGSFEEVNYTDNDGNRASSGSSDRTLQYAPTDEERDQLLVWAREERLPLFLSTQLFREFKLCKLLLRALDDRYSAGRHSNT 142          
BLAST of Regulator of G-protein signaling 22 vs. TrEMBL
Match: A0A1I8GF58 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 4.415e-87
Identity = 211/625 (33.76%), Postives = 362/625 (57.92%), Query Frame = 2
Query: 1001 IEGRQKISLQRLKEMIIGTHEGMNEFGKFLMSTVGKSLCEFWLDCEQLKDLSYFRTEEENIDLRNNLMRNLKDKYKLSLTKAAKDQLNEAMKNSEKLHSIFLQAQYDTLRRLRSYWLPRYIIHQETLMRQYTITDLQFLRFPSFHSDTT---SIQSGVFPKILLQKTLPYSTDKTKLEKM--NWTEIMCMSNR--SVIEPTKTDSTSRETSGNSNGIFRRSAFQNRLRFALGFDAAAGGPFKNYLNSQNQIQQ-IRHVEFFQEVLKFKSIFSRNSDRLLRISHAWSIVNKFLLPVESNFLEIPIEDSKEIILMIQKYKSSIKSTIFDEIVEISVKKVQQQWLIYLKEEVKRFMESSLTHFDNETPPNXXXXXXXXXXXXXXXXRR----KLNIKGTEEKQSTWNKLSKKEKRNRREAALRLKEITENERQKVLKAVKKRIQEEIKRSQXXXXXXXXXXXXNAIVSGEEMEIKVEEKIPEAKNVLRSKTMLSLFKKYATDHADKIGKDATNSVMLLNDLATYFSF-GGIDKAVISTKDSKASFIYKNYFDKTAKRLVPL-SGKIRNKLSNEQERPKTPTLKDVQNHVYNMLTEAFNEFWKFEITELGVKSEVLAKMNEKELLLIAE 2833
            +E RQ +   RLKE+++   +G+ EF +FL  T G  L +FWLDCE  KD +  R++ +N   R  L+R+L+DKY+L LT+ AK Q+  A  + +K +SI L+ QYD LRRLRSYWLPRYIIH+E  +   T +DLQ     ++ +D T   S  S +FP + L  ++P   D      +  +W  +     +    I   K     ++ +  +  +     FQ RLR AL  D  AGGPF+++L  +++  + +  + FFQEV ++     R +DR LR+ HAW+I N++L    +  +++   +++ I+  +++ K ++ + +F +  +  V ++   WL +LKE+VK F+ESS++H D+++PP   DE++V IE+ KI+V+R    +   +   +++ +W+ L+ +EK  RR+AA   + +TE ER+K LKA +KR++E         E    +  E    + +  E +  EK PE K + +++ +++LFKKYA+   DK GKD+ N++ L  +   +     G+       +D  A ++YK Y +K  KR V + S +++ +L+ +++RPKTPTLKD+ +H+++ L   F+ FW+++  E+G+    L  M+EKEL + A+
Sbjct:  322 LEARQNLPFDRLKELMLANRQGVQEFFEFLRPTAGLHLVDFWLDCEFYKDTALERSDADNRQTRGRLLRDLQDKYRLRLTEEAKAQMRNAANDHQKANSILLRTQYDVLRRLRSYWLPRYIIHKERELTGQTFSDLQ----QAWLNDATRRASAMSTIFPSLSLVNSMPVRPDLAHNLAITESWDRVRAGGRQLDDRIRSAKGGPQLQQPALAAKPVSASRPFQARLRDALTVDRIAGGPFRSFLEMRHRDPELLACLMFFQEVEEYSRRDERTADRFLRLGHAWNIFNRYLNVSAAQPVKVDKRENQLILDALRRSKDTVPAKVFAKAQDSVVVRMGDTWLRFLKEDVKNFLESSVSHRDSDSPPKTSDEIQVYIENGKIIVKRIQPERSQAQLQLQRRRSWDFLTDEEKAERRKAAAERRRVTELERKKALKAARKRLKE--------MEESGRKDYEGRASAKKVEEEEEVEKAPELKEMTKNRAVMALFKKYAS---DKEGKDSVNALSLYQETLEFLELPPGVSDKAKKKRDGNALYLYKTYLEKGCKRRVEVTSERLQQRLTVDKDRPKTPTLKDLSSHLHSKLNLLFSNFWQYQSEEMGIDMSALKNMSEKELRMRAD 931          

HSP 2 Score: 153.68 bits (387), Expect = 1.034e-33
Identity = 92/249 (36.95%), Postives = 147/249 (59.04%), Query Frame = 2
Query: 2900 EDKKELILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSK---EINLGIFDEATYHCLKNLLPYWAGFQKNWKEPMENKFNPINKYQRLLERRMKIYNDIPIPKADVVSLPMVPKSTN--LTTLSYTMNDGAKWKSQEQAQDSNNNRQDGPGSESGKSVIIPYGKK---FTRKASRLSV 3622
            EDK E ++AL+     PLSLQ+LYF+ YL++    DK+ +L+++LFFYVE  K +E      DEE  K+KI  IS+ FLESV PP +QI + ND+ Q+ +R  Q+  + K   EI+  IFDEA +   K +LPYWAGF K W  P   ++ P+++ +R+LE R++ +     P  +   LP +P  +   +++L+ ++ DG KWK  E+ +D ++   +    E      +  GK+    TR+A++ +V
Sbjct: 1083 EDKVEFLVALEKNLSGPLSLQMLYFYRYLMQYAVQDKVPHLDKNLFFYVEAQKYKEFALGGCDEEFLKRKIHVISSIFLESVFPPPLQITVSNDVHQRTLRNAQKFYSPKFKEEISPTIFDEAQFAVFKEMLPYWAGFMKQWT-PTGKEYRPVSQQKRMLEERLQKFEKSDKPNVN-FKLPELPAHSGGPISSLTMSLMDGIKWK--ERFEDDDDKAVELSDGEQQLQRKVTAGKRAAVLTRQATKETV 1327          

HSP 3 Score: 127.102 bits (318), Expect = 1.505e-25
Identity = 60/114 (52.63%), Postives = 79/114 (69.30%), Query Frame = 1
Query:  139 GNITVENLQDLLIYDDTFLDYFNVFLKLPVFPQPLEYQRLTDSFTILDEGGDSVV--SGNSNPPFMASEAEHCKLLEWAQKYRLPLFLKTDLFRELKLSKLLIKPVETLCCSSR 474
            G   +ENL+D+LIYDD FLDYFN FL LP FPQ L+Y RLT +F I+D   DS+V  S +S P + A++ E   ++ WAQ  RLPLF KT+L+RE KL KLL++PV+     +R
Sbjct:    7 GRQALENLEDMLIYDDMFLDYFNAFLSLPAFPQVLQYHRLTGTFRIVDTADDSLVEWSNSSEPLYGATDDERETIMTWAQNERLPLFTKTELYREYKLCKLLLRPVDARKIGTR 120          
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Cavefish
Match: ENSAMXT00000050549.1 (pep primary_assembly:Astyanax_mexicanus-2.0:10:25567773:25583327:1 gene:ENSAMXG00000011935.2 transcript:ENSAMXT00000050549.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 8.968e-8
Identity = 32/95 (33.68%), Postives = 52/95 (54.74%), Query Frame = 2
Query: 3020 LERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSKEINLGIFDEATYHCLKNLLPYWAGF 3304
            LE DL F++EV + +++C +  DE   ++K+  I + F++   PPSVQI+IP + AQ+I+       T   +   +F EA       LL +W  F
Sbjct: 1472 LENDLLFWLEVQRYKDLCNSHSDEVTVQQKVSAIISCFIDCCFPPSVQIHIPPEQAQRILH------TRNSLGPYVFREAQMSVFSELLKHWPAF 1560          
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Cavefish
Match: ENSAMXT00000012272.2 (pep primary_assembly:Astyanax_mexicanus-2.0:10:25567068:25583327:1 gene:ENSAMXG00000011935.2 transcript:ENSAMXT00000012272.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 8.968e-8
Identity = 32/95 (33.68%), Postives = 52/95 (54.74%), Query Frame = 2
Query: 3020 LERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSKEINLGIFDEATYHCLKNLLPYWAGF 3304
            LE DL F++EV + +++C +  DE   ++K+  I + F++   PPSVQI+IP + AQ+I+       T   +   +F EA       LL +W  F
Sbjct: 1472 LENDLLFWLEVQRYKDLCNSHSDEVTVQQKVSAIISCFIDCCFPPSVQIHIPPEQAQRILH------TRNSLGPYVFREAQMSVFSELLKHWPAF 1560          
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Nematostella
Match: EDO49216 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHF1])

HSP 1 Score: 57.3806 bits (137), Expect = 4.338e-8
Identity = 35/104 (33.65%), Postives = 53/104 (50.96%), Query Frame = 2
Query: 3029 DLFFYVEVLKLQEICRTTV-----------DEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSKEINLGIFDEATYHCLKNLLPYWAGFQ 3307
            D++F+ EVLK +EI                DE    +K + +   F++S  PP VQINIPNDMA+ I+  +Q  +    I  G+F +A      +L+ YW  F+
Sbjct:  900 DMYFWREVLKFKEIADNATECAKSGNYSRDDERQVTEKARTMVKVFIDSAFPPRVQINIPNDMAENIVELVQNGI----IYRGLFHDAAMSVFTSLIHYWKKFE 999          
BLAST of Regulator of G-protein signaling 22 vs. Planmine SMEST
Match: SMESG000069110.1 (SMESG000069110.1)

HSP 1 Score: 1912.89 bits (4954), Expect = 0.000e+0
Identity = 1033/1064 (97.09%), Postives = 1043/1064 (98.03%), Query Frame = 2
Query:  473 EKHLHGYSKQTNCSSFTTRTPXXXXXXXXXXXXXXXXXXXXXXXXXXRHRIEEDSEEDFTDDIKDAIPYDIYLRPGSRAISLPIQIKMENEKPSQKIIRNQMKSENTSAKPIRNISNLSEEFINVKAPRQKSMKIDEWDEDNIFYRIQSAPLNFDAINFKLXXXXXXXXXXXXXXXIEGRQKISLQRLKEMIIGTHEGMNEFGKFLMSTVGKSLCEFWLDCEQLKDLSYFRTEEENIDLRNNLMRNLKDKYKLSLTKAAKDQLNEAMKNSEKLHSIFLQAQYDTLRRLRSYWLPRYIIHQETLMRQYTITDLQFLRFPSFHSDTTSIQSGVFPKILLQKTLPYSTDKTKLEKMNWTEIMCMSNRSVIEPTKTDSTSRETSGNSNGIFRRSAFQNRLRFALGFDAAAGGPFKNYLNSQNQIQQIRHVEFFQEVLKFKSIFSRNSDRLLRISHAWSIVNKFLLPVESNFLEIPIEDSKEIILMIQKYKSSIKSTIFDEIVEISVKKVQQQWLIYLKEEVKRFMESSLTHFDNETPPNXXXXXXXXXXXXXXXXRRKLNIKGTEEKQSTWNKLSKKEKRNRREAALRLKEITENERQKVLKAVKKRIQEEIKRSQXXXXXXXXXXXX-------------NAIVSGEEMEIKVEEKIPEAKNVLRSKTMLSLFKKYATDHADKIGKDATNSVMLLNDLATYFSFGGIDKAVISTKDSKASFIYKNYFDKTAKRLVPLSGKIRNKLSNEQERPKTPTLKDVQNHVYNMLTEAFNEFWKFEITELGVKSEVLAKMNEKELLLIAENQLLEIXXXXXXXXXXXXXXXXEDKKELILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSKEINLGIFDEATYHCLKNLLPYWAGFQKNWKEPMENKFNPINKYQRLLERRMKIYNDIPIPKADVVSLPMVPKSTNLTTLSYTMNDGAKWKSQEQAQDSNNNRQDGPGSESGKSVIIPYGKKFTRKASRLSVT 3625
            E ++HGYSKQTNCSSFTTRTPSKYSDLSSKSNSILKSSESTNSSSYKRHRIEEDSEEDFTDDIKDAIPYDIYLRPGSRAISLPIQIKMENEKPSQKIIRNQMKSENTSAKPIRNISNLSEEFINVK PRQKSMKIDEWDEDNIFYRIQSAPLNFDAINFK VNEEVEESLIDELENIEGRQKISLQRLKEMIIGTHEGMNEFGKFLMSTVGKSLCEFWLDCEQLKDLSYFRTEEENIDLRNNLMRNLKDKYKLSLTKAAKDQLNEAMKNSEKLHSIFLQAQYDTLRRLRSYWLPRYIIHQETLMRQYTITDLQFLRFPSFHSDTTSIQSGVFPKILLQKTLPYSTDKTKLEKMNWTEIMCMSNRSVIEPTKTDSTSRETSGNSNGIFRRSAFQNRLRFALGFDAAAGGPFKNYLNSQNQIQQIRHVEFFQEVLKFKSIFSRNSDRLLR+SHAWSIVNKFLLPVESNFLEIPIEDSKEIILMIQKYKSSIKSTIFDEIVEISVKKVQQQWLIYLKEEVKRFMESSLTHFDNETPPNDLDEVEVIIEDEKIVVRRKLNIKGTEEKQSTWNKLSKKEKRNRREAALRLKEITENERQKVLKAVKKRIQEEIKRSQ  + V+ ++ ++             NAIVSGEEMEIKVEEKIPEAKNVLRSKTMLSLFKKYATDHADK+GKDATNSVMLLNDLATYFSFGGIDKAVISTKDSKASFIYKNYFDKTAKRLVPLSGKIRNKLSNEQERPKTPTLKDVQNHVYNMLTEAFNEFWKFEITELGVKSEVLAKMNEKELLLIAENQLLEISKSTASKANSTAAHTKEDKKELILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAQQIIRRIQRQMTSKEINLGIFDEATYHCLKNLLPYWAGFQKNWKEPMENKFNPINKYQRLLERRMKIYNDIPIPKADVVSLPMVPKSTNLTTLSYTMNDGAKWKSQEQAQDSNNNRQDGPGSESGKSVIIPYGKKFTRKASRLSVT
Sbjct:  124 ETYIHGYSKQTNCSSFTTRTPSKYSDLSSKSNSILKSSESTNSSSYKRHRIEEDSEEDFTDDIKDAIPYDIYLRPGSRAISLPIQIKMENEKPSQKIIRNQMKSENTSAKPIRNISNLSEEFINVKTPRQKSMKIDEWDEDNIFYRIQSAPLNFDAINFKPVNEEVEESLIDELENIEGRQKISLQRLKEMIIGTHEGMNEFGKFLMSTVGKSLCEFWLDCEQLKDLSYFRTEEENIDLRNNLMRNLKDKYKLSLTKAAKDQLNEAMKNSEKLHSIFLQAQYDTLRRLRSYWLPRYIIHQETLMRQYTITDLQFLRFPSFHSDTTSIQSGVFPKILLQKTLPYSTDKTKLEKMNWTEIMCMSNRSVIEPTKTDSTSRETSGNSNGIFRRSAFQNRLRFALGFDAAAGGPFKNYLNSQNQIQQIRHVEFFQEVLKFKSIFSRNSDRLLRVSHAWSIVNKFLLPVESNFLEIPIEDSKEIILMIQKYKSSIKSTIFDEIVEISVKKVQQQWLIYLKEEVKRFMESSLTHFDNETPPNDLDEVEVIIEDEKIVVRRKLNIKGTEEKQSTWNKLSKKEKRNRREAALRLKEITENERQKVLKAVKKRIQEEIKRSQTVSYVKFKQTTKIEEAEVEPEEISENAIVSGEEMEIKVEEKIPEAKNVLRSKTMLSLFKKYATDHADKLGKDATNSVMLLNDLATYFSFGGIDKAVISTKDSKASFIYKNYFDKTAKRLVPLSGKIRNKLSNEQERPKTPTLKDVQNHVYNMLTEAFNEFWKFEITELGVKSEVLAKMNEKELLLIAENQLLEISKSTASKANSTAAHTKEDKKELILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAQQIIRRIQRQMTSKEINLGIFDEATYHCLKNLLPYWAGFQKNWKEPMENKFNPINKYQRLLERRMKIYNDIPIPKADVVSLPMVPKSTNLTTLSYTMNDGAKWKSQEQAQDSNNNRQDGPGSESGKSVIIPYGKKFTRKASRLSVT 1187          

HSP 2 Score: 266.929 bits (681), Expect = 4.339e-73
Identity = 125/126 (99.21%), Postives = 126/126 (100.00%), Query Frame = 1
Query:  106 MNAETDSCVNGGNITVENLQDLLIYDDTFLDYFNVFLKLPVFPQPLEYQRLTDSFTILDEGGDSVVSGNSNPPFMASEAEHCKLLEWAQKYRLPLFLKTDLFRELKLSKLLIKPVETLCCSSRETF 483
            MNAETDSCVNGGNITVENLQDLLIYDDTFLDYFNVFLKLPVFPQPLEYQRLTDSFTILDEGGDSVVSGNSNPPFMASEAEHCKLLEWAQKYRLPLFLKTDLFRELKLSKLLIKPVETLCCSSRET+
Sbjct:    1 MNAETDSCVNGGNITVENLQDLLIYDDTFLDYFNVFLKLPVFPQPLEYQRLTDSFTILDEGGDSVVSGNSNPPFMASEAEHCKLLEWAQKYRLPLFLKTDLFRELKLSKLLIKPVETLCCSSRETY 126          
BLAST of Regulator of G-protein signaling 22 vs. Planmine SMEST
Match: SMESG000069110.1 (SMESG000069110.1)

HSP 1 Score: 1906.72 bits (4938), Expect = 0.000e+0
Identity = 1033/1072 (96.36%), Postives = 1043/1072 (97.29%), Query Frame = 2
Query:  473 EKHLHGYSKQTNCSSFTTRTPXXXXXXXXXXXXXXXXXXXXXXXXXXRHRIEEDSEEDFTDDIKDAIPYDIYLRPGSRAISLPIQIKMENEKPSQKIIRNQMKSENTSAKPIRNISNLSEEFINVKAPRQKSMKIDEWDEDNIFYRIQSAPLNFDAINFKLXXXXXXXXXXXXXXXIEGRQKISLQRLKEMIIGTHEGMNEFGKFLMSTVGKSLCEFWLDCEQLKDLSYFRTEEENIDLRNNLMRNLKDKYKLSLTKAAKDQLNEAMKNSEKLHSIFLQAQYDTLRRLRSYWLPRYIIHQETLMRQYTITDLQFLRFPSFHSDTTSIQSGVFPKILLQKTLPYSTDKTKLEKMNWTEIMCMSNRSVIEPTKTDSTSRETSGNSNGIFRRSAFQNRLRFALGFDAAAGGPFKNYLNSQNQIQQIRHVEFFQEVLKFKSIFSRNSDRLLRISHAWSIVNKFLLPVESNFLEIPIEDSKEIILMIQKYKSSIKSTIFDEIVEISVKKVQQQWLIYLKEEVKRFMESSLTHFDNETPPNXXXXXXXXXXXXXXXXRRKLNIKGTEEKQSTWNKLSKKEKRNRREAALRLKEITENERQKVLKAVKKRIQEEIKRSQXXXXXXXXXXXX---------------NAIVSGEEMEIKVEEKIPEAKNVLRSKTMLSLFKKYATDHADKIGKDATNSVMLLNDLATYFSFGGIDKAVISTKDSKASFIYKNYFDKTAKRLVPLSGKIRNKLSNEQERPKTPTLKDVQNHVYNMLTEAFNEFWKFEITELGVKSEVLAKMNEKELLLIAENQLLEIXXXXXXXXXXXXXXXXEDKKELILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAXXXXXXXXXXMTSKEINLGIFDEATYHCLKNLLPYWAGFQKNWKEPMENKFNPINKYQRLLERRMKIYNDIPIPKADVVSLPMVPKSTNLTTLSYTMNDGAKWK------SQEQAQDSNNNRQDGPGSESGKSVIIPYGKKFTRKASRLSVT 3625
            E ++HGYSKQTNCSSFTTRTPSKYSDLSSKSNSILKSSESTNSSSYKRHRIEEDSEEDFTDDIKDAIPYDIYLRPGSRAISLPIQIKMENEKPSQKIIRNQMKSENTSAKPIRNISNLSEEFINVK PRQKSMKIDEWDEDNIFYRIQSAPLNFDAINFK VNEEVEESLIDELENIEGRQKISLQRLKEMIIGTHEGMNEFGKFLMSTVGKSLCEFWLDCEQLKDLSYFRTEEENIDLRNNLMRNLKDKYKLSLTKAAKDQLNEAMKNSEKLHSIFLQAQYDTLRRLRSYWLPRYIIHQETLMRQYTITDLQFLRFPSFHSDTTSIQSGVFPKILLQKTLPYSTDKTKLEKMNWTEIMCMSNRSVIEPTKTDSTSRETSGNSNGIFRRSAFQNRLRFALGFDAAAGGPFKNYLNSQNQIQQIRHVEFFQEVLKFKSIFSRNSDRLLR+SHAWSIVNKFLLPVESNFLEIPIEDSKEIILMIQKYKSSIKSTIFDEIVEISVKKVQQQWLIYLKEEVKRFMESSLTHFDNETPPNDLDEVEVIIEDEKIVVRRKLNIKGTEEKQSTWNKLSKKEKRNRREAALRLKEITENERQKVLKAVKKRIQEEIKRSQ  + V+ ++ ++               NAIVSGEEMEIKVEEKIPEAKNVLRSKTMLSLFKKYATDHADK+GKDATNSVMLLNDLATYFSFGGIDKAVISTKDSKASFIYKNYFDKTAKRLVPLSGKIRNKLSNEQERPKTPTLKDVQNHVYNMLTEAFNEFWKFEITELGVKSEVLAKMNEKELLLIAENQLLEISKSTASKANSTAAHTKEDKKELILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAQQIIRRIQRQMTSKEINLGIFDEATYHCLKNLLPYWAGFQKNWKEPMENKFNPINKYQRLLERRMKIYNDIPIPKADVVSLPMVPKSTNLTTLSYTMNDGAKWK      SQEQAQDSNNNRQDGPGSESGKSVIIPYGKKFTRKASRLSVT
Sbjct:  124 ETYIHGYSKQTNCSSFTTRTPSKYSDLSSKSNSILKSSESTNSSSYKRHRIEEDSEEDFTDDIKDAIPYDIYLRPGSRAISLPIQIKMENEKPSQKIIRNQMKSENTSAKPIRNISNLSEEFINVKTPRQKSMKIDEWDEDNIFYRIQSAPLNFDAINFKPVNEEVEESLIDELENIEGRQKISLQRLKEMIIGTHEGMNEFGKFLMSTVGKSLCEFWLDCEQLKDLSYFRTEEENIDLRNNLMRNLKDKYKLSLTKAAKDQLNEAMKNSEKLHSIFLQAQYDTLRRLRSYWLPRYIIHQETLMRQYTITDLQFLRFPSFHSDTTSIQSGVFPKILLQKTLPYSTDKTKLEKMNWTEIMCMSNRSVIEPTKTDSTSRETSGNSNGIFRRSAFQNRLRFALGFDAAAGGPFKNYLNSQNQIQQIRHVEFFQEVLKFKSIFSRNSDRLLRVSHAWSIVNKFLLPVESNFLEIPIEDSKEIILMIQKYKSSIKSTIFDEIVEISVKKVQQQWLIYLKEEVKRFMESSLTHFDNETPPNDLDEVEVIIEDEKIVVRRKLNIKGTEEKQSTWNKLSKKEKRNRREAALRLKEITENERQKVLKAVKKRIQEEIKRSQTVSYVKFKQTTKILKEEAEVEPEEISENAIVSGEEMEIKVEEKIPEAKNVLRSKTMLSLFKKYATDHADKLGKDATNSVMLLNDLATYFSFGGIDKAVISTKDSKASFIYKNYFDKTAKRLVPLSGKIRNKLSNEQERPKTPTLKDVQNHVYNMLTEAFNEFWKFEITELGVKSEVLAKMNEKELLLIAENQLLEISKSTASKANSTAAHTKEDKKELILALQDASFKPLSLQILYFFNYLIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAFLESVHPPSVQINIPNDMAQQIIRRIQRQMTSKEINLGIFDEATYHCLKNLLPYWAGFQKNWKEPMENKFNPINKYQRLLERRMKIYNDIPIPKADVVSLPMVPKSTNLTTLSYTMNDGAKWKAKKFELSQEQAQDSNNNRQDGPGSESGKSVIIPYGKKFTRKASRLSVT 1195          

HSP 2 Score: 266.929 bits (681), Expect = 4.291e-73
Identity = 125/126 (99.21%), Postives = 126/126 (100.00%), Query Frame = 1
Query:  106 MNAETDSCVNGGNITVENLQDLLIYDDTFLDYFNVFLKLPVFPQPLEYQRLTDSFTILDEGGDSVVSGNSNPPFMASEAEHCKLLEWAQKYRLPLFLKTDLFRELKLSKLLIKPVETLCCSSRETF 483
            MNAETDSCVNGGNITVENLQDLLIYDDTFLDYFNVFLKLPVFPQPLEYQRLTDSFTILDEGGDSVVSGNSNPPFMASEAEHCKLLEWAQKYRLPLFLKTDLFRELKLSKLLIKPVETLCCSSRET+
Sbjct:    1 MNAETDSCVNGGNITVENLQDLLIYDDTFLDYFNVFLKLPVFPQPLEYQRLTDSFTILDEGGDSVVSGNSNPPFMASEAEHCKLLEWAQKYRLPLFLKTDLFRELKLSKLLIKPVETLCCSSRETY 126          
The following BLAST results are available for this feature:
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RGS221.054e-732.56regulator of G protein signaling 22 [Source:HGNC S... [more]
RGS221.088e-732.56regulator of G protein signaling 22 [Source:HGNC S... [more]
RGS221.111e-732.56regulator of G protein signaling 22 [Source:HGNC S... [more]
RGS221.177e-732.56regulator of G protein signaling 22 [Source:HGNC S... [more]
back to top
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000018771.11.805e-627.82pep primary_assembly:Xenopus_tropicalis_v9.1:6:113... [more]
back to top
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G-protein signaling 22 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8NE09|RGS22_HUMAN5.337e-732.56Regulator of G-protein signaling 22 OS=Homo sapien... [more]
back to top
BLAST of Regulator of G-protein signaling 22 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DJF91.351e-13433.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H2P42.052e-13333.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DKL72.105e-11532.83RGS domain-containing protein OS=Macrostomum ligna... [more]
A0A210QCF54.139e-10028.68Regulator of G-protein signaling 22 OS=Mizuhopecte... [more]
A0A1I8GF584.415e-8733.76Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000050549.18.968e-833.68pep primary_assembly:Astyanax_mexicanus-2.0:10:255... [more]
ENSAMXT00000012272.28.968e-833.68pep primary_assembly:Astyanax_mexicanus-2.0:10:255... [more]
back to top
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO492164.338e-833.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulator of G-protein signaling 22 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G-protein signaling 22 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000069110.14.339e-7397.09SMESG000069110.1[more]
SMESG000069110.14.291e-7396.36SMESG000069110.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028743 ID=SMED30028743|Name=Regulator of G-protein signaling 22|organism=Schmidtea mediterranea sexual|type=transcript|length=3727bp
AGAAATTTGAAATTAGAAAAATTTTATACGAATTCATTCCATTATATAAC
TGGTTCTTGTTTAAATTTGTGCTTCTATGAGTGTTTTCATTGGCAAAATT
ACAAAATGAATGCCGAAACTGATAGCTGTGTAAATGGTGGAAATATTACT
GTGGAAAACCTTCAAGATTTACTAATTTATGATGACACATTTCTAGATTA
TTTCAATGTTTTCCTTAAACTTCCAGTTTTCCCTCAGCCATTGGAATATC
AGCGATTGACAGATTCTTTTACTATTCTCGATGAAGGTGGAGACTCAGTT
GTTTCTGGTAACTCCAATCCTCCTTTTATGGCCAGTGAGGCTGAGCATTG
TAAACTATTAGAATGGGCACAGAAATATAGATTACCACTATTTTTAAAGA
CGGATTTATTTCGTGAATTAAAACTTAGCAAGTTACTTATTAAGCCCGTA
GAAACCCTTTGTTGTTCTTCTCGAGAAACATTTACATGGATACAGCAAAC
AGACGAACTGTTCATCTTTTACAACAAGAACACCTTCAAAATACTCAGAT
CTTAGTTCCAAATCAAACAGTATTTTAAAATCAAGCGAGTCTACTAACTC
ATCCAGTTATAAAAGACATAGAATTGAAGAAGATTCGGAAGAAGATTTTA
CGGATGATATTAAAGATGCTATTCCATATGATATATATTTGCGACCAGGT
TCACGAGCTATTAGTCTCCCTATTCAAATAAAAATGGAAAATGAAAAGCC
GAGCCAAAAAATTATTAGAAATCAAATGAAATCAGAAAATACTTCAGCAA
AGCCGATTAGAAATATTTCAAATTTATCAGAAGAATTTATTAACGTCAAG
GCCCCCAGACAAAAATCCATGAAAATTGATGAATGGGATGAAGATAACAT
TTTCTACAGAATTCAGAGCGCACCGTTAAATTTTGATGCGATCAATTTCA
AACTTGTTAATGAAGAAGTAGAAGAATCTTTGATAGATGAACTAGAAAAT
ATCGAAGGTCGTCAAAAGATTTCACTCCAAAGATTAAAAGAAATGATTAT
TGGAACACATGAAGGAATGAATGAATTTGGAAAGTTCTTGATGTCGACTG
TCGGAAAATCTCTCTGTGAATTTTGGTTGGATTGTGAACAGTTAAAAGAT
TTATCATATTTTCGAACTGAAGAAGAAAACATCGATCTAAGAAATAATCT
CATGCGAAATCTGAAAGATAAATACAAACTTAGTCTCACAAAAGCTGCAA
AAGATCAATTAAATGAAGCAATGAAAAATTCAGAAAAGCTTCATTCTATT
TTCCTTCAAGCCCAATATGATACCCTTCGTCGGTTGAGAAGTTACTGGCT
TCCAAGATATATTATACATCAAGAAACGCTAATGAGGCAGTATACAATAA
CTGACTTGCAGTTTTTAAGATTTCCATCCTTTCACTCTGACACGACTTCA
ATTCAGTCTGGGGTTTTTCCGAAGATTCTCTTACAAAAAACTTTACCCTA
TTCAACAGATAAAACAAAACTTGAGAAAATGAATTGGACAGAAATCATGT
GTATGTCAAACAGATCAGTGATTGAACCAACTAAAACTGATAGTACGAGT
AGAGAAACATCCGGTAATTCCAATGGGATATTCCGAAGATCTGCATTTCA
GAATCGTTTGAGATTTGCCCTTGGATTTGATGCAGCTGCTGGTGGTCCAT
TCAAAAATTACTTGAACAGTCAAAATCAAATTCAACAGATCAGACATGTA
GAATTCTTTCAAGAGGTCCTGAAGTTTAAATCTATATTTTCACGTAATTC
CGACCGTTTGCTGAGAATTTCTCATGCTTGGTCTATTGTTAATAAATTTC
TTCTCCCAGTCGAATCTAACTTTCTAGAAATACCAATTGAAGATAGTAAA
GAAATCATCTTAATGATTCAAAAATATAAAAGCTCTATTAAAAGTACAAT
CTTTGATGAAATAGTTGAAATATCAGTTAAAAAGGTTCAACAACAATGGC
TGATATATTTGAAAGAGGAGGTTAAAAGATTTATGGAGTCATCACTTACT
CATTTTGACAATGAAACCCCTCCAAATGATTTGGATGAAGTCGAAGTAAT
TATCGAAGATGAGAAAATAGTTGTGAGAAGAAAACTAAATATAAAAGGAA
CTGAAGAAAAGCAATCGACATGGAACAAATTATCTAAAAAGGAAAAACGA
AATCGCCGTGAAGCCGCTTTGCGATTGAAAGAAATTACAGAAAATGAAAG
ACAAAAAGTGTTAAAAGCAGTAAAAAAAAGGATACAGGAAGAAATTAAAC
GTTCTCAAGAGGAAGCAGAGGTCGAACCAGAAGAAATAAGCGAAAATGCA
ATAGTCTCTGGAGAGGAAATGGAAATCAAAGTCGAAGAAAAAATCCCAGA
AGCCAAAAACGTTTTGCGTAGTAAAACAATGCTCAGTTTATTCAAAAAGT
ATGCGACAGATCATGCGGACAAAATAGGAAAGGATGCGACAAATTCCGTC
ATGCTGCTGAACGATTTGGCAACTTATTTCAGTTTTGGAGGAATTGATAA
AGCTGTAATATCCACAAAGGATTCCAAGGCTTCATTTATTTACAAGAACT
ATTTCGATAAAACTGCCAAGAGATTAGTGCCACTTTCTGGTAAAATTCGC
AATAAATTATCAAATGAACAAGAAAGACCGAAAACACCAACATTGAAGGA
CGTACAAAATCATGTTTATAACATGCTAACTGAAGCTTTCAATGAATTTT
GGAAATTTGAAATTACTGAATTGGGTGTGAAATCGGAAGTTCTTGCAAAA
ATGAATGAAAAGGAATTACTGCTTATTGCAGAAAATCAACTACTAGAAAT
TTCAAAATCCACAGCCTCTAAAGCAAATAGTACAGCAGCTCACACAAAAG
AGGATAAAAAAGAGTTAATATTAGCTCTGCAGGACGCTAGCTTTAAGCCA
CTTTCATTGCAAATTCTTTATTTTTTTAATTATCTTATTGAGAAAGGACC
AGGAGATAAAATGAACAATTTAGAAAGAGATTTATTTTTTTATGTTGAAG
TTTTAAAATTACAAGAAATATGTCGGACAACAGTTGATGAAGAAATTGCA
AAAAAGAAAATTCAATGCATATCCAATGCATTTCTAGAATCAGTGCATCC
TCCTTCAGTTCAAATTAACATTCCAAATGATATGGCTCAGCAAATTATAC
GAAGAATTCAAAGACAGATGACAAGTAAAGAGATCAATTTAGGCATTTTT
GATGAAGCCACTTATCACTGTTTGAAAAACCTTCTGCCGTATTGGGCTGG
ATTTCAGAAAAACTGGAAGGAACCCATGGAAAACAAGTTTAATCCAATAA
ACAAATATCAAAGATTATTAGAGAGAAGAATGAAAATTTATAACGATATT
CCAATTCCAAAAGCGGATGTAGTTTCTCTACCAATGGTTCCAAAGAGCAC
AAATTTAACGACATTATCCTATACAATGAATGATGGAGCAAAATGGAAAT
CCCAAGAACAGGCCCAAGATTCAAACAACAATCGTCAAGATGGTCCCGGA
TCTGAATCCGGAAAATCTGTAATAATTCCCTATGGAAAGAAATTTACGAG
AAAAGCATCCCGATTATCTGTTACATGAATTTTATTTTACAAAAAATAAA
AACCAATTTTTTTTATTTTGAATGAATTTTACTATGTATTTTTCTATTTA
TCTGGTTTTAGTCGTTATAAAGGTTTG
back to top

protein sequence of SMED30028743-orf-1

>SMED30028743-orf-1 ID=SMED30028743-orf-1|Name=SMED30028743-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=185bp
RNLKLEKFYTNSFHYITGSCLNLCFYECFHWQNYKMNAETDSCVNGGNIT
VENLQDLLIYDDTFLDYFNVFLKLPVFPQPLEYQRLTDSFTILDEGGDSV
VSGNSNPPFMASEAEHCKLLEWAQKYRLPLFLKTDLFRELKLSKLLIKPV
ETLCCSSRETFTWIQQTDELFIFYNKNTFKILRS*
back to top

protein sequence of SMED30028743-orf-2

>SMED30028743-orf-2 ID=SMED30028743-orf-2|Name=SMED30028743-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=965bp
MENEKPSQKIIRNQMKSENTSAKPIRNISNLSEEFINVKAPRQKSMKIDE
WDEDNIFYRIQSAPLNFDAINFKLVNEEVEESLIDELENIEGRQKISLQR
LKEMIIGTHEGMNEFGKFLMSTVGKSLCEFWLDCEQLKDLSYFRTEEENI
DLRNNLMRNLKDKYKLSLTKAAKDQLNEAMKNSEKLHSIFLQAQYDTLRR
LRSYWLPRYIIHQETLMRQYTITDLQFLRFPSFHSDTTSIQSGVFPKILL
QKTLPYSTDKTKLEKMNWTEIMCMSNRSVIEPTKTDSTSRETSGNSNGIF
RRSAFQNRLRFALGFDAAAGGPFKNYLNSQNQIQQIRHVEFFQEVLKFKS
IFSRNSDRLLRISHAWSIVNKFLLPVESNFLEIPIEDSKEIILMIQKYKS
SIKSTIFDEIVEISVKKVQQQWLIYLKEEVKRFMESSLTHFDNETPPNDL
DEVEVIIEDEKIVVRRKLNIKGTEEKQSTWNKLSKKEKRNRREAALRLKE
ITENERQKVLKAVKKRIQEEIKRSQEEAEVEPEEISENAIVSGEEMEIKV
EEKIPEAKNVLRSKTMLSLFKKYATDHADKIGKDATNSVMLLNDLATYFS
FGGIDKAVISTKDSKASFIYKNYFDKTAKRLVPLSGKIRNKLSNEQERPK
TPTLKDVQNHVYNMLTEAFNEFWKFEITELGVKSEVLAKMNEKELLLIAE
NQLLEISKSTASKANSTAAHTKEDKKELILALQDASFKPLSLQILYFFNY
LIEKGPGDKMNNLERDLFFYVEVLKLQEICRTTVDEEIAKKKIQCISNAF
LESVHPPSVQINIPNDMAQQIIRRIQRQMTSKEINLGIFDEATYHCLKNL
LPYWAGFQKNWKEPMENKFNPINKYQRLLERRMKIYNDIPIPKADVVSLP
MVPKSTNLTTLSYTMNDGAKWKSQEQAQDSNNNRQDGPGSESGKSVIIPY
GKKFTRKASRLSVT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0001965G-protein alpha-subunit binding
GO:0005096GTPase activator activity
Vocabulary: biological process
TermDefinition
GO:0009966regulation of signal transduction
GO:0009968negative regulation of signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR042651Rgs22
IPR016137RGS
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005886plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR042651Regulator of G-protein signaling 22PANTHERPTHR46583FAMILY NOT NAMEDcoord: 48..94