Band 4.1 protein 2

Overview
NameBand 4.1 protein 2
Smed IDSMED30028738
Length (bp)3746
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Band 4.1 protein 2 (SMED30028738) t-SNE clustered cells

Violin plots show distribution of expression levels for Band 4.1 protein 2 (SMED30028738) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Band 4.1 protein 2 (SMED30028738) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Band 4.1 protein 2 (SMED30028738) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028738

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028738SMESG000019493.1 Contig4861newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028738SMESG000037231.1 Contig4861newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neuronSMED30028738SMESG000019493.1 dd_Smed_v4_1613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028738SMESG000019493.1 dd_Smed_v4_1613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30028738SMESG000019493.1 dd_Smed_v4_1613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Band 4.1 protein 2 vs. Ensembl Human
Match: EPB41L3 (erythrocyte membrane protein band 4.1 like 3 [Source:HGNC Symbol;Acc:HGNC:3380])

HSP 1 Score: 276.944 bits (707), Expect = 2.391e-80
Identity = 141/330 (42.73%), Postives = 205/330 (62.12%), Query Frame = 1
Query:  406 MECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            M+C VI+LDG+E    +++ S GQ LFD VC+HL L E++YFG++Y+D      WLD  K+I K V      F F VKFYPP+ + + ED+TRYYL LQ+R D+V G+LPCSF    +L SY +QSE GDYDP    G +YI     AP    T++  +KV+ LHK HRG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G    K+  +  + + T       DR PAP  +R
Sbjct:    1 MQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD-ECGSDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLG---SKFRYSGRTQAQTRRASALIDR-PAPYFER 323          
BLAST of Band 4.1 protein 2 vs. Ensembl Human
Match: EPB41L3 (erythrocyte membrane protein band 4.1 like 3 [Source:HGNC Symbol;Acc:HGNC:3380])

HSP 1 Score: 278.1 bits (710), Expect = 6.249e-79
Identity = 141/330 (42.73%), Postives = 205/330 (62.12%), Query Frame = 1
Query:  406 MECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            M+C VI+LDG+E    +++ S GQ LFD VC+HL L E++YFG++Y+D      WLD  K+I K V      F F VKFYPP+ + + ED+TRYYL LQ+R D+V G+LPCSF    +L SY +QSE GDYDP    G +YI     AP    T++  +KV+ LHK HRG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G    K+  +  + + T       DR PAP  +R
Sbjct:    1 MQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD-ECGSDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLG---SKFRYSGRTQAQTRRASALIDR-PAPYFER 323          
BLAST of Band 4.1 protein 2 vs. Ensembl Human
Match: EPB41L3 (erythrocyte membrane protein band 4.1 like 3 [Source:HGNC Symbol;Acc:HGNC:3380])

HSP 1 Score: 279.256 bits (713), Expect = 2.675e-78
Identity = 142/332 (42.77%), Postives = 206/332 (62.05%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+C VI+LDG+E    +++ S GQ LFD VC+HL L E++YFG++Y+D      WLD  K+I K V      F F VKFYPP+ + + ED+TRYYL LQ+R D+V G+LPCSF    +L SY +QSE GDYDP    G +YI     AP    T++  +KV+ LHK HRG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G    K+  +  + + T       DR PAP  +R
Sbjct:  108 KSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD-ECGSDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLG---SKFRYSGRTQAQTRRASALIDR-PAPYFER 432          
BLAST of Band 4.1 protein 2 vs. Ensembl Human
Match: EPB41L3 (erythrocyte membrane protein band 4.1 like 3 [Source:HGNC Symbol;Acc:HGNC:3380])

HSP 1 Score: 278.485 bits (711), Expect = 3.472e-78
Identity = 142/332 (42.77%), Postives = 206/332 (62.05%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+C VI+LDG+E    +++ S GQ LFD VC+HL L E++YFG++Y+D      WLD  K+I K V      F F VKFYPP+ + + ED+TRYYL LQ+R D+V G+LPCSF    +L SY +QSE GDYDP    G +YI     AP    T++  +KV+ LHK HRG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G    K+  +  + + T       DR PAP  +R
Sbjct:  108 KSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD-ECGSDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLG---SKFRYSGRTQAQTRRASALIDR-PAPYFER 432          
BLAST of Band 4.1 protein 2 vs. Ensembl Human
Match: EPB41L3 (erythrocyte membrane protein band 4.1 like 3 [Source:HGNC Symbol;Acc:HGNC:3380])

HSP 1 Score: 278.87 bits (712), Expect = 5.903e-78
Identity = 142/332 (42.77%), Postives = 206/332 (62.05%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+C VI+LDG+E    +++ S GQ LFD VC+HL L E++YFG++Y+D      WLD  K+I K V      F F VKFYPP+ + + ED+TRYYL LQ+R D+V G+LPCSF    +L SY +QSE GDYDP    G +YI     AP    T++  +KV+ LHK HRG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G    K+  +  + + T       DR PAP  +R
Sbjct:  108 KSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD-ECGSDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLG---SKFRYSGRTQAQTRRASALIDR-PAPYFER 432          
BLAST of Band 4.1 protein 2 vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 183.341 bits (464), Expect = 3.993e-48
Identity = 97/290 (33.45%), Postives = 163/290 (56.21%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCK-IMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIE-YIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHK-VKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIE 1260
            K+    V++ DG ++ F +++ S G+ LF  V   L + EREYF + + D+ +    WL   K I K +      F F+VKFYP   + +V+D  RYY+ LQ+R+DL+ G+LP +   +++L S+V Q E GD   +     E +I +  L P      +  +K+V LH+  RGQTP EA+  FLD+ + LALYG+ + K + + + + + +G+   GI +Y+ + +   FSW  +I++ Y++    I ++      N+K L FK  +    K+ +K  V+HH FFR+I+
Sbjct:   23 KMQLAKVLLPDGVQKEFEVNKNSEGEALFRQVTRDLSIEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAAGINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLYFKLPNHVAAKRTWKCAVEHHTFFRLIQ 312          
BLAST of Band 4.1 protein 2 vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 183.341 bits (464), Expect = 3.993e-48
Identity = 97/290 (33.45%), Postives = 163/290 (56.21%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCK-IMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIE-YIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHK-VKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIE 1260
            K+    V++ DG ++ F +++ S G+ LF  V   L + EREYF + + D+ +    WL   K I K +      F F+VKFYP   + +V+D  RYY+ LQ+R+DL+ G+LP +   +++L S+V Q E GD   +     E +I +  L P      +  +K+V LH+  RGQTP EA+  FLD+ + LALYG+ + K + + + + + +G+   GI +Y+ + +   FSW  +I++ Y++    I ++      N+K L FK  +    K+ +K  V+HH FFR+I+
Sbjct:   23 KMQLAKVLLPDGVQKEFEVNKNSEGEALFRQVTRDLSIEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAAGINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLYFKLPNHVAAKRTWKCAVEHHTFFRLIQ 312          
BLAST of Band 4.1 protein 2 vs. Ensembl Celegans
Match: frm-3 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EDC0])

HSP 1 Score: 182.956 bits (463), Expect = 1.758e-46
Identity = 104/296 (35.14%), Postives = 162/296 (54.73%), Query Frame = 1
Query:  397 GKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRL--VFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKK 1278
            G+L+   V MLD T  VF +   + GQ L D VC HL L E +YFG+S+ D      WLD  K I + + +      F F VKFY P    + E+ TRY  ++Q+++DL  G+L CS    ++L++Y++QSE GD+  + +    Y+      P   QT +F +KV+  H+   G TP E+D   L+ AR+   YG+ +H  K+ +G +  L V + GI ++RQ      FSWAR+ ++S+K+KKL++ +   +    K+ + F        K  +K  V+HH FFR ++   PKK
Sbjct:   22 GRLVCIKVRMLDDTVAVFHLGHKAIGQTLLDEVCRHLNLLECDYFGLSFIDINGNHCWLDREKTILRQITNGSTDAKFYFVVKFYTPNPIDLEEEYTRYLFTMQIKRDLALGELHCSDNTASLLSAYLVQSECGDFSSEDYPDATYLSHTRFVPN--QTLEFQKKVMDNHRNFIGMTPGESDLAMLEVARRCDFYGVKLHAAKDIDGNDAALSVMHLGIKVFRQLQLDTTFSWARIRKLSFKRKKLLVKLHPDSYQYLKETVEFSFETRDECKNFWKKCVEHHAFFRCVQAEEPKK 315          
BLAST of Band 4.1 protein 2 vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 183.726 bits (465), Expect = 2.949e-46
Identity = 97/291 (33.33%), Postives = 163/291 (56.01%), Query Frame = 1
Query:  397 GKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCK-IMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIE-YIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHK-VKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIE 1260
             K+    V++ DG ++ F +++ S G+ LF  V   L + EREYF + + D+ +    WL   K I K +      F F+VKFYP   + +V+D  RYY+ LQ+R+DL+ G+LP +   +++L S+V Q E GD   +     E +I +  L P      +  +K+V LH+  RGQTP EA+  FLD+ + LALYG+ + K + + + + + +G+   GI +Y+ + +   FSW  +I++ Y++    I ++      N+K L FK  +    K+ +K  V+HH FFR+I+
Sbjct:   22 SKMQLAKVLLPDGVQKEFEVNKNSEGEALFRQVTRDLSIEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAAGINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLYFKLPNHVAAKRTWKCAVEHHTFFRLIQ 312          
BLAST of Band 4.1 protein 2 vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 183.726 bits (465), Expect = 3.212e-46
Identity = 97/291 (33.33%), Postives = 163/291 (56.01%), Query Frame = 1
Query:  397 GKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCK-IMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIE-YIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHK-VKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIE 1260
             K+    V++ DG ++ F +++ S G+ LF  V   L + EREYF + + D+ +    WL   K I K +      F F+VKFYP   + +V+D  RYY+ LQ+R+DL+ G+LP +   +++L S+V Q E GD   +     E +I +  L P      +  +K+V LH+  RGQTP EA+  FLD+ + LALYG+ + K + + + + + +G+   GI +Y+ + +   FSW  +I++ Y++    I ++      N+K L FK  +    K+ +K  V+HH FFR+I+
Sbjct:   33 SKMQLAKVLLPDGVQKEFEVNKNSEGEALFRQVTRDLSIEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAAGINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLYFKLPNHVAAKRTWKCAVEHHTFFRLIQ 323          
BLAST of Band 4.1 protein 2 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0301279)

HSP 1 Score: 259.225 bits (661), Expect = 4.030e-73
Identity = 132/333 (39.64%), Postives = 202/333 (60.66%), Query Frame = 1
Query:  397 GKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            GK     V +LDG+    +IDR + G+ + +++C  L L E++YFG++Y+       WLD  K ++K    +     F VKFYPPE S + ED+TRY+L LQVR D++ G+LPC+F  + +L SY++QSE GDYD +      Y+K   +AP   QT +  +KV+ LHK H+GQ+P EA+ ++L+NA+KLA+YG+D+H  K+SEG +IMLGV   G+++YR K+R+ RF+W +++++SYK+    I +R       +  + FK  + +  KK +K+ V+HH FFR++      K  + P F +   YK  T A  T       DR P PK  R
Sbjct:   29 GKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPN--QTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGSTYRYKGRTQAEST---NTPVDRTP-PKFNR 355          
BLAST of Band 4.1 protein 2 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0086506)

HSP 1 Score: 258.84 bits (660), Expect = 5.490e-73
Identity = 132/333 (39.64%), Postives = 202/333 (60.66%), Query Frame = 1
Query:  397 GKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            GK     V +LDG+    +IDR + G+ + +++C  L L E++YFG++Y+       WLD  K ++K    +     F VKFYPPE S + ED+TRY+L LQVR D++ G+LPC+F  + +L SY++QSE GDYD +      Y+K   +AP   QT +  +KV+ LHK H+GQ+P EA+ ++L+NA+KLA+YG+D+H  K+SEG +IMLGV   G+++YR K+R+ RF+W +++++SYK+    I +R       +  + FK  + +  KK +K+ V+HH FFR++      K  + P F +   YK  T A  T       DR P PK  R
Sbjct:   29 GKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPN--QTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGSTYRYKGRTQAEST---NTPVDRTP-PKFNR 355          
BLAST of Band 4.1 protein 2 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0086508)

HSP 1 Score: 259.996 bits (663), Expect = 5.616e-72
Identity = 132/333 (39.64%), Postives = 202/333 (60.66%), Query Frame = 1
Query:  397 GKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            GK     V +LDG+    +IDR + G+ + +++C  L L E++YFG++Y+       WLD  K ++K    +     F VKFYPPE S + ED+TRY+L LQVR D++ G+LPC+F  + +L SY++QSE GDYD +      Y+K   +AP   QT +  +KV+ LHK H+GQ+P EA+ ++L+NA+KLA+YG+D+H  K+SEG +IMLGV   G+++YR K+R+ RF+W +++++SYK+    I +R       +  + FK  + +  KK +K+ V+HH FFR++      K  + P F +   YK  T A  T       DR P PK  R
Sbjct:   29 GKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPN--QTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGSTYRYKGRTQAEST---NTPVDRTP-PKFNR 355          
BLAST of Band 4.1 protein 2 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0340468)

HSP 1 Score: 260.381 bits (664), Expect = 2.379e-70
Identity = 132/333 (39.64%), Postives = 202/333 (60.66%), Query Frame = 1
Query:  397 GKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            GK     V +LDG+    +IDR + G+ + +++C  L L E++YFG++Y+       WLD  K ++K    +     F VKFYPPE S + ED+TRY+L LQVR D++ G+LPC+F  + +L SY++QSE GDYD +      Y+K   +AP   QT +  +KV+ LHK H+GQ+P EA+ ++L+NA+KLA+YG+D+H  K+SEG +IMLGV   G+++YR K+R+ RF+W +++++SYK+    I +R       +  + FK  + +  KK +K+ V+HH FFR++      K  + P F +   YK  T A  T       DR P PK  R
Sbjct:   29 GKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPN--QTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGSTYRYKGRTQAEST---NTPVDRTP-PKFNR 355          
BLAST of Band 4.1 protein 2 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0340469)

HSP 1 Score: 260.381 bits (664), Expect = 2.797e-70
Identity = 132/333 (39.64%), Postives = 202/333 (60.66%), Query Frame = 1
Query:  397 GKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            GK     V +LDG+    +IDR + G+ + +++C  L L E++YFG++Y+       WLD  K ++K    +     F VKFYPPE S + ED+TRY+L LQVR D++ G+LPC+F  + +L SY++QSE GDYD +      Y+K   +AP   QT +  +KV+ LHK H+GQ+P EA+ ++L+NA+KLA+YG+D+H  K+SEG +IMLGV   G+++YR K+R+ RF+W +++++SYK+    I +R       +  + FK  + +  KK +K+ V+HH FFR++      K  + P F +   YK  T A  T       DR P PK  R
Sbjct:   29 GKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPN--QTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGSTYRYKGRTQAEST---NTPVDRTP-PKFNR 355          
BLAST of Band 4.1 protein 2 vs. Ensembl Zebrafish
Match: EPB41L2 (si:ch73-18b11.1 [Source:ZFIN;Acc:ZDB-GENE-070912-332])

HSP 1 Score: 277.33 bits (708), Expect = 7.314e-79
Identity = 126/293 (43.00%), Postives = 194/293 (66.21%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKK 1278
            K++ C V +LDG++    +++ + GQ+LF  VC+HL L E++YF +S+KD  +   WLD TK+I + + +++  F F VKFYPP+ S + EDLTRY L LQ+RQD+  G+LPCSF  + +L SY +Q+E GD DP  HR ++YI     AP   QT++  EKV+ LHK HRG TP +AD  FL+NA+KL++YG+D+H  K+SEG +IMLGV   G+++Y+ ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR+     P K
Sbjct:    2 KMVVCHVTLLDGSQFSCEVEKRAKGQYLFFEVCEHLNLVEKDYFALSFKDNAEQRCWLDPTKEIKRQIRNSQWQFAFSVKFYPPDPSQLTEDLTRYLLCLQLRQDIASGRLPCSFVTHALLGSYALQAELGDQDPDEHR-LDYISDFQFAPN--QTKELEEKVMELHKSHRGMTPAQADAQFLENAKKLSMYGVDLHHAKDSEGVDIMLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKIRPGEAEQFESTVGFKLPNHRAAKRVWKVCVEHHTFFRLTSPEQPTK 291          
BLAST of Band 4.1 protein 2 vs. Ensembl Zebrafish
Match: si:dkey-178k16.1 (si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-61])

HSP 1 Score: 265.774 bits (678), Expect = 4.419e-77
Identity = 134/326 (41.10%), Postives = 205/326 (62.88%), Query Frame = 1
Query:  418 VIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            V++LDG+     +++   GQ L D VC+HL L E++YFG+S+ D      WLD +K+I K +      F F VKFYPP+ S ++ED+TRYYL LQ+R+D++ G+LPCSF  + +L SY IQ+E GDYDP+ H G +YI     AP   QT++  E+V+ LH+ +RG +P EA+ NFL+NA+KL++YG+D+H  K+SEG +IMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + + +K+ +K  ++HH FFR++    P K  L  G   R  Y   T A          DR PAP+ +R
Sbjct:   58 VLLLDGSAYESGVEKLCKGQVLLDMVCEHLNLLEKDYFGLSFSDTECQKNWLDPSKEIKKQIRVGPWHFSFAVKFYPPDPSQLIEDITRYYLCLQLREDILSGRLPCSFVTHALLGSYAIQAELGDYDPEEH-GPDYINEFRFAPN--QTRELEERVMELHRTYRGMSPAEAEINFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRASKRLWKVCIEHHTFFRLVSPEPPPKGFLVIGSKFR--YSGRTQAQSRQASALI-DR-PAPQFER 376          
BLAST of Band 4.1 protein 2 vs. Ensembl Zebrafish
Match: epb41l3a (erythrocyte membrane protein band 4.1-like 3a [Source:ZFIN;Acc:ZDB-GENE-040822-8])

HSP 1 Score: 268.47 bits (685), Expect = 3.415e-75
Identity = 125/294 (42.52%), Postives = 193/294 (65.65%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKP 1281
            K M+C + +LDG++    +++   GQ LFD VC+HL L E++YFGI+++D      WLD  K + K +      F F VKFYPPE +++ ED+TRYYL LQ+R D+  G+LPCSF  +T+L SY +QSE GD+DP+   G EY      APQ  QT++  EK++ LHK ++G TP EA+ +FL+N +KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++   +P+ P
Sbjct:   88 KNMQCKITLLDGSDYTCVVEKRDKGQVLFDKVCEHLNLLEKDYFGITFRDVENQKNWLDPAKDMKKQIRGVAWNFSFNVKFYPPEPALLSEDITRYYLCLQLRDDISSGRLPCSFATHTVLGSYTVQSELGDHDPE-ECGSEYTSEFRFAPQ--QTKEMEEKIIDLHKNYKGMTPAEAEMHFLENVKKLSMYGVDLHHAKDSEGVEIMLGVCSSGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLV---LPETP 375          
BLAST of Band 4.1 protein 2 vs. Ensembl Zebrafish
Match: epb41l3a (erythrocyte membrane protein band 4.1-like 3a [Source:ZFIN;Acc:ZDB-GENE-040822-8])

HSP 1 Score: 268.47 bits (685), Expect = 3.415e-75
Identity = 125/294 (42.52%), Postives = 193/294 (65.65%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKP 1281
            K M+C + +LDG++    +++   GQ LFD VC+HL L E++YFGI+++D      WLD  K + K +      F F VKFYPPE +++ ED+TRYYL LQ+R D+  G+LPCSF  +T+L SY +QSE GD+DP+   G EY      APQ  QT++  EK++ LHK ++G TP EA+ +FL+N +KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++   +P+ P
Sbjct:   88 KNMQCKITLLDGSDYTCVVEKRDKGQVLFDKVCEHLNLLEKDYFGITFRDVENQKNWLDPAKDMKKQIRGVAWNFSFNVKFYPPEPALLSEDITRYYLCLQLRDDISSGRLPCSFATHTVLGSYTVQSELGDHDPE-ECGSEYTSEFRFAPQ--QTKEMEEKIIDLHKNYKGMTPAEAEMHFLENVKKLSMYGVDLHHAKDSEGVEIMLGVCSSGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLV---LPETP 375          
BLAST of Band 4.1 protein 2 vs. Ensembl Zebrafish
Match: si:dkey-178k16.1 (si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-61])

HSP 1 Score: 266.159 bits (679), Expect = 3.764e-74
Identity = 135/332 (40.66%), Postives = 207/332 (62.35%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K +   V++LDG+     +++   GQ L D VC+HL L E++YFG+S+ D      WLD +K+I K +      F F VKFYPP+ S ++ED+TRYYL LQ+R+D++ G+LPCSF  + +L SY IQ+E GDYDP+ H G +YI     AP   QT++  E+V+ LH+ +RG +P EA+ NFL+NA+KL++YG+D+H  K+SEG +IMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + + +K+ +K  ++HH FFR++    P K  L  G   R  Y   T A          DR PAP+ +R
Sbjct:   52 KTVPVKVLLLDGSAYESGVEKLCKGQVLLDMVCEHLNLLEKDYFGLSFSDTECQKNWLDPSKEIKKQIRVGPWHFSFAVKFYPPDPSQLIEDITRYYLCLQLREDILSGRLPCSFVTHALLGSYAIQAELGDYDPEEH-GPDYINEFRFAPN--QTRELEERVMELHRTYRGMSPAEAEINFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRASKRLWKVCIEHHTFFRLVSPEPPPKGFLVIGSKFR--YSGRTQAQSRQASAL-IDR-PAPQFER 376          
BLAST of Band 4.1 protein 2 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 277.715 bits (709), Expect = 2.245e-78
Identity = 141/332 (42.47%), Postives = 208/332 (62.65%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+  V++LDG+E    +++ S GQ LFD VC+HL L E++YFG+ Y+D      WLD  K+I K   +    F F VKFYPP+ S + ED+TRYYL LQ+R D+VCG+LPCSF    +L SY +QSE GDYDP+ + G +Y+     AP   QT++  +KVV LHK +RG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G    K+  +  + + T       DR PAP  +R
Sbjct:  108 KNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQKNWLDPAKEIKKQTRNGAWHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY-GSDYVTEFRFAPN--QTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMPEAPPKKFLTLG---SKFRYSGRTQAQTRRASALIDR-PAPYFER 432          
BLAST of Band 4.1 protein 2 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 277.715 bits (709), Expect = 3.303e-78
Identity = 141/332 (42.47%), Postives = 208/332 (62.65%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+  V++LDG+E    +++ S GQ LFD VC+HL L E++YFG+ Y+D      WLD  K+I K   +    F F VKFYPP+ S + ED+TRYYL LQ+R D+VCG+LPCSF    +L SY +QSE GDYDP+ + G +Y+     AP   QT++  +KVV LHK +RG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G    K+  +  + + T       DR PAP  +R
Sbjct:  108 KNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQKNWLDPAKEIKKQTRNGAWHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY-GSDYVTEFRFAPN--QTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMPEAPPKKFLTLG---SKFRYSGRTQAQTRRASALIDR-PAPYFER 432          
BLAST of Band 4.1 protein 2 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 278.485 bits (711), Expect = 4.146e-78
Identity = 141/332 (42.47%), Postives = 208/332 (62.65%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+  V++LDG+E    +++ S GQ LFD VC+HL L E++YFG+ Y+D      WLD  K+I K   +    F F VKFYPP+ S + ED+TRYYL LQ+R D+VCG+LPCSF    +L SY +QSE GDYDP+ + G +Y+     AP   QT++  +KVV LHK +RG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G    K+  +  + + T       DR PAP  +R
Sbjct:  108 KNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQKNWLDPAKEIKKQTRNGAWHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY-GSDYVTEFRFAPN--QTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMPEAPPKKFLTLG---SKFRYSGRTQAQTRRASALIDR-PAPYFER 432          
BLAST of Band 4.1 protein 2 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 278.1 bits (710), Expect = 4.147e-78
Identity = 141/332 (42.47%), Postives = 208/332 (62.65%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+  V++LDG+E    +++ S GQ LFD VC+HL L E++YFG+ Y+D      WLD  K+I K   +    F F VKFYPP+ S + ED+TRYYL LQ+R D+VCG+LPCSF    +L SY +QSE GDYDP+ + G +Y+     AP   QT++  +KVV LHK +RG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G    K+  +  + + T       DR PAP  +R
Sbjct:  108 KNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQKNWLDPAKEIKKQTRNGAWHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY-GSDYVTEFRFAPN--QTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMPEAPPKKFLTLG---SKFRYSGRTQAQTRRASALIDR-PAPYFER 432          
BLAST of Band 4.1 protein 2 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 277.715 bits (709), Expect = 6.093e-77
Identity = 144/332 (43.37%), Postives = 207/332 (62.35%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+  V++LDG+E    +++ S GQ LFD VC+HL L E++YFG+ Y+D      WLD  K+I K   +    F F VKFYPP+ S + ED+TRYYL LQ+R D+VCG+LPCSF    +L SY +QSE GDYDP+ + G +Y+     AP   QT++  +KVV LHK +RG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G   R  Y   T A  T       DR PAP  +R
Sbjct:  108 KNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQKNWLDPAKEIKKQTRNGAWHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY-GSDYVTEFRFAPN--QTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMPEAPPKKFLTLGSKFR--YSGRTQAQ-TRRASALIDR-PAPYFER 432          
BLAST of Band 4.1 protein 2 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 276.944 bits (707), Expect = 4.065e-78
Identity = 144/332 (43.37%), Postives = 204/332 (61.45%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+C V +LDG+E    +D+ S GQ LFD VC+HL L E++YFG++Y+D      WLD  K+I K +      F F VKFYPP+ + + ED+TRYYL LQ+R D+V G+LPCSF    +L SY +QSE GDYDP    G +YI     AP    T++  +KV+ LHK HRG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G   R  Y   T A  T       DR PAP  +R
Sbjct:  112 KSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD-ECGNDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFR--YSGRTQAQ-TRRASALIDR-PAPYFER 436          
BLAST of Band 4.1 protein 2 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 276.559 bits (706), Expect = 4.878e-78
Identity = 144/332 (43.37%), Postives = 204/332 (61.45%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+C V +LDG+E    +D+ S GQ LFD VC+HL L E++YFG++Y+D      WLD  K+I K +      F F VKFYPP+ + + ED+TRYYL LQ+R D+V G+LPCSF    +L SY +QSE GDYDP    G +YI     AP    T++  +KV+ LHK HRG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G   R  Y   T A  T       DR PAP  +R
Sbjct:  116 KSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD-ECGNDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFR--YSGRTQAQ-TRRASALIDR-PAPYFER 440          
BLAST of Band 4.1 protein 2 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 276.944 bits (707), Expect = 1.095e-77
Identity = 144/332 (43.37%), Postives = 204/332 (61.45%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+C V +LDG+E    +D+ S GQ LFD VC+HL L E++YFG++Y+D      WLD  K+I K +      F F VKFYPP+ + + ED+TRYYL LQ+R D+V G+LPCSF    +L SY +QSE GDYDP    G +YI     AP    T++  +KV+ LHK HRG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G   R  Y   T A  T       DR PAP  +R
Sbjct:  116 KSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD-ECGNDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFR--YSGRTQAQ-TRRASALIDR-PAPYFER 440          
BLAST of Band 4.1 protein 2 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 277.33 bits (708), Expect = 1.433e-77
Identity = 144/332 (43.37%), Postives = 204/332 (61.45%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+C V +LDG+E    +D+ S GQ LFD VC+HL L E++YFG++Y+D      WLD  K+I K +      F F VKFYPP+ + + ED+TRYYL LQ+R D+V G+LPCSF    +L SY +QSE GDYDP    G +YI     AP    T++  +KV+ LHK HRG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G   R  Y   T A  T       DR PAP  +R
Sbjct:  116 KSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD-ECGNDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFR--YSGRTQAQ-TRRASALIDR-PAPYFER 440          
BLAST of Band 4.1 protein 2 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 277.33 bits (708), Expect = 1.717e-77
Identity = 144/332 (43.37%), Postives = 204/332 (61.45%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+C V +LDG+E    +D+ S GQ LFD VC+HL L E++YFG++Y+D      WLD  K+I K +      F F VKFYPP+ + + ED+TRYYL LQ+R D+V G+LPCSF    +L SY +QSE GDYDP    G +YI     AP    T++  +KV+ LHK HRG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G   R  Y   T A  T       DR PAP  +R
Sbjct:  116 KSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD-ECGNDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFR--YSGRTQAQ-TRRASALIDR-PAPYFER 440          
BLAST of Band 4.1 protein 2 vs. UniProt/SwissProt
Match: sp|Q9WV92|E41L3_MOUSE (Band 4.1-like protein 3 OS=Mus musculus OX=10090 GN=Epb41l3 PE=1 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.201e-76
Identity = 144/332 (43.37%), Postives = 204/332 (61.45%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+C V +LDG+E    +D+ S GQ LFD VC+HL L E++YFG++Y+D      WLD  K+I K +      F F VKFYPP+ + + ED+TRYYL LQ+R D+V G+LPCSF    +L SY +QSE GDYDP    G +YI     AP    T++  +KV+ LHK HRG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G   R  Y   T A  T       DR PAP  +R
Sbjct:  116 KSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD-ECGNDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFR--YSGRTQAQ-TRRASALIDR-PAPYFER 440          
BLAST of Band 4.1 protein 2 vs. UniProt/SwissProt
Match: sp|Q9Y2J2|E41L3_HUMAN (Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=2)

HSP 1 Score: 279.256 bits (713), Expect = 1.780e-76
Identity = 145/332 (43.67%), Postives = 205/332 (61.75%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKR 1395
            K M+C VI+LDG+E    +++ S GQ LFD VC+HL L E++YFG++Y+D      WLD  K+I K V      F F VKFYPP+ + + ED+TRYYL LQ+R D+V G+LPCSF    +L SY +QSE GDYDP    G +YI     AP    T++  +KV+ LHK HRG TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G   R  Y   T A  T       DR PAP  +R
Sbjct:  108 KSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD-ECGSDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFR--YSGRTQAQ-TRRASALIDR-PAPYFER 432          
BLAST of Band 4.1 protein 2 vs. UniProt/SwissProt
Match: sp|Q9N179|41_BOVIN (Protein 4.1 OS=Bos taurus OX=9913 GN=EPB41 PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 2.109e-75
Identity = 144/343 (41.98%), Postives = 203/343 (59.18%), Query Frame = 1
Query:  406 MECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFG-IPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDG 1431
            M C V +LD T     +++ + GQ L   VC+HL L E +YFG++  D      WLD  K+I K V      F F VKFYPP+ + + ED+TRYYL LQ+RQD+V G+LPCSF    +L SY IQSE GDYDP+ H G +Y+    LAP   QT++  EKV+ LHK +R  TP +AD  FL+NA+KL++YG+D+HK K+ EG +I+LGV   G+++Y++K+R+ RF W +++++SYK+    I +R   +   +  + FK    +  KK +K  V+HH FFR+     IPK   L  G   R  Y   T A  T       DR PAP  +R    R  ++ DG
Sbjct:    1 MHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVSGRLPCSFATLALLGSYTIQSELGDYDPELH-GADYVSDFKLAPN--QTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKEKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFR--YSGRTQAQ-TRQASALIDR-PAPHFERTASKRASRSLDG 336          
BLAST of Band 4.1 protein 2 vs. UniProt/SwissProt
Match: sp|P11171|41_HUMAN (Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=4)

HSP 1 Score: 268.855 bits (686), Expect = 3.329e-74
Identity = 145/351 (41.31%), Postives = 206/351 (58.69%), Query Frame = 1
Query:  406 MECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFG-IPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDGWYTLPSKN 1455
            M C V +LD T     +++ + GQ L   VC+HL L E +YFG++  D      WLD  K+I K V      F F VKFYPP+ + + ED+TRYYL LQ+RQD+V G+LPCSF    +L SY IQSE GDYDP+ H G++Y+    LAP   QT++  EKV+ LHK +R  TP +AD  FL+NA+KL++YG+D+HK K+ EG +I+LGV   G+++Y+ K+R+ RF W +++++SYK+    I +R   +   +  + FK    +  KK +K  V+HH FFR+     IPK   L  G   R  Y   T A  T       DR PAP  +R    R  ++ DG   + S +
Sbjct:  210 MHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELH-GVDYVSDFKLAPN--QTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFR--YSGRTQAQ-TRQASALIDR-PAPHFERTASKRASRSLDGAAAVDSAD 553          
BLAST of Band 4.1 protein 2 vs. UniProt/SwissProt
Match: sp|P48193|41_MOUSE (Protein 4.1 OS=Mus musculus OX=10090 GN=Epb41 PE=1 SV=2)

HSP 1 Score: 268.085 bits (684), Expect = 6.467e-74
Identity = 144/343 (41.98%), Postives = 203/343 (59.18%), Query Frame = 1
Query:  406 MECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFG-IPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDG 1431
            M C V +LD T     +++ + GQ L   VC+HL L E +YFG++  D      WLD  K+I K V      F F VKFYPP+ + + ED+TRYYL LQ+RQD+V G+LPCSF    +L SY IQSE GDYDP+ H G++Y+    LAP   QT++  EKV+ LHK +R  TP +AD  FL+NA+KL++YG+D+HK K+ EG +I+LGV   G+++Y+ K+R+ RF W +++++SYK+    I +R   +   +  + FK    +  KK +K  V+HH FFR+     IPK   L  G   R  Y   T A  T       DR PAP  +R    R  ++ DG
Sbjct:  211 MHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLALWDSATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELH-GMDYVSDFKLAPN--QTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEHYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFR--YSGRTQAQ-TRQASALIDR-PAPHFERTASKRASRSLDG 546          
BLAST of Band 4.1 protein 2 vs. TrEMBL
Match: A0A4V6RH18 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004533 PE=4 SV=1)

HSP 1 Score: 876.7 bits (2264), Expect = 0.000e+0
Identity = 452/956 (47.28%), Postives = 597/956 (62.45%), Query Frame = 1
Query:  118 NSYNSDADTTHGSINFHTESTSQVNRLEDGTIEITDTLPKKDYYMSLRKSDN---RLGGSMSRIG------------GGSNAGFGTMTGTLRS-GYNAKSQS---ILDFKPSGKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDGWYTLPSKNGTAYKKGVVLXXXXXXXXX--------------------XXXTQLNIQKPNQNKISKTPLTDTE-----------RPTLPNLHWRMSPADCTLSLGMDDKGLDVASQPGTGWQGCRSNKGVKTPGEYFYEARVLEDGLVRLGWSTNDASLKVGSDENGYGYGADEVGRGWGENVKGCTMHDSKIKDYGSGLFMGDYVGCRVNLNNGDVVWYKNGESMGVGYKIPEQLRKEPMFPTLSVKDGRIEFNFGDSPFVYPPSDSETWIPVCQANEITEVPNKHIGWKLNAYDATKLIDISAEGLMAQSQMNAEWQGSRCNKGVKGRGKYYYEVSPLESGGLARVGWSTEAGSLDLGTDKCGFGYGADPDGFGLSGNQGKKMFNNDIENYGKSFNKGDVIGCFLDLDEGKVQWSLNGEIYAPAYDIPLEL--RNGPSAFFPAVSLKNNTAEFNLGEKAFKFYPGNEWTPLTYTPEQFLKESRRKGPERKVKGWSYLN 2829
            + Y S+ D T   IN       Q N+L+DGT+E+ D  PKK+YY+SLR+  N    L G+  R G            GG++A F   TG   S G      S   + +FKPSGK M+C V+MLDGT   F IDRA++GQ LF+AVC HL L+E EYFG++Y D     FWL+  KKI K +P N    EFQV+FYP +I  + EDLTRYYL LQVRQDLV G+LPCSF VY +L +Y+IQSEAGD+DP  H GI+YI+  P AP   QT + +E++V LHKLHRG+TP+EAD+ FL NAR LALYG+D+HKVKNS+G+++ LGVY+GG +LYR ++R++  SW  +I+ SY+ +  +IT+R  + + +   L+FKC      K+ +    DHH FFR+     PKKP+  P F TRKY+  P+S   T   + + +    P+  +  P      +  W+TL       +  GVV +    +                        H+ Q  +Q+   +  +   +   E           RP     HWR+SPAD T  LG+D  GLDVA+Q G GWQGCR+NKGVK PG Y++EA  LEDGLVR+GWSTN+ASL++G+D  G+G+GAD VG   G N  G  MH +   DYG  +  GD +GC ++LN G V W  NGE    G+ IP+QLR E   P  S+KD RI FNFGD    Y P     +IPV Q ++ +EVPN++ GW++N YDA+  +DIS +G  AQ+     WQG R N+G++G G++Y+EV+PLE  GL R GWSTE  SL+LGTD+ GFGYGAD DGFGL+G QGK+M  ++IENYG++F K DVIGCFLD  E  V+WS NG  +  AY IP EL      +AFFP VSL N+T EFN G+K F+FYPG +WTP+  TP  +LK +RRKGPERKVKGWSY++
Sbjct:   11 SGYLSNGDNTPEFINLTQLEGRQWNQLDDGTVEVVDRAPKKEYYLSLRRPINPTMTLMGTGQRKGSFSGSSGLLPTNGGASASFAAPTGRSPSPGATLTRNSNPPVTNFKPSGKTMDCTVVMLDGTPREFRIDRAAYGQQLFEAVCAHLALSEVEYFGLTYYDSSNTWFWLNMRKKIAKQLPKNEWRCEFQVRFYPYDIDGIKEDLTRYYLCLQVRQDLVSGQLPCSFMVYCLLGAYIIQSEAGDHDPAQHVGIKYIQDHPFAPHVLQTPEMLERMVQLHKLHRGKTPQEADRLFLQNARCLALYGVDLHKVKNSQGKDVHLGVYHGGFLLYRNRIRLMHISWPHIIKFSYRDRTFMITLRRPDTDPSDTTLSFKCQGETFAKRLFDVCADHHAFFRLRGSARPKKPSFLPTFATRKYH-FPSSLVFTPPSQPSMNGAQRPQ-SQFRPVHMHPQNPNWFTLARPGEPGHPNGVVASQYQYQPAMFDGDVGTMNPVYLDGQYVTNGHTGQQGVQRHLPHGAATPGVGAGEHHHPGTAVVISRPVFVAEHWRISPADRTPGLGIDPHGLDVAAQRGAGWQGCRANKGVKAPGAYYFEAVCLEDGLVRVGWSTNEASLELGTDNCGFGFGADAVGAS-GANGTGRAMHRNTGHDYGVSVKQGDVIGCWLDLNKGSVAWSCNGEVFQRGFTIPDQLRGEAFLPAASLKDSRILFNFGDQALEYQPQGP--FIPVAQVSDDSEVPNRNTGWRMNPYDASAALDISPDGSKAQAHWAHGWQGCRSNQGIRGPGRFYFEVTPLEDTGLCRFGWSTEDASLNLGTDRFGFGYGADNDGFGLNGQQGKRMHCDEIENYGEAFTKDDVIGCFLDTIEHTVKWSKNGIDFGDAYHIPPELFQSTTAAAFFPTVSLLNSTVEFNFGDKRFQFYPGPDWTPVCCTPANYLKRTRRKGPERKVKGWSYID 961          
BLAST of Band 4.1 protein 2 vs. TrEMBL
Match: A0A4S2LVR1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004533 PE=4 SV=1)

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 450/956 (47.07%), Postives = 598/956 (62.55%), Query Frame = 1
Query:  118 NSYNSDADTTHGSINFHTESTSQVNRLEDGTIEITDTLPKKDYYMSLRKSDN---RLGGSMSRIG------------GGSNAGFGTMTGTLRSGYNAKSQS----ILDFKPSGKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDGWYTLPSKNGTAYKKGVVLXXXXXXXXX--------------------XXXTQLNIQKPNQNKISKTPLTDTE-----------RPTLPNLHWRMSPADCTLSLGMDDKGLDVASQPGTGWQGCRSNKGVKTPGEYFYEARVLEDGLVRLGWSTNDASLKVGSDENGYGYGADEVGRGWGENVKGCTMHDSKIKDYGSGLFMGDYVGCRVNLNNGDVVWYKNGESMGVGYKIPEQLRKEPMFPTLSVKDGRIEFNFGDSPFVYPPSDSETWIPVCQANEITEVPNKHIGWKLNAYDATKLIDISAEGLMAQSQMNAEWQGSRCNKGVKGRGKYYYEVSPLESGGLARVGWSTEAGSLDLGTDKCGFGYGADPDGFGLSGNQGKKMFNNDIENYGKSFNKGDVIGCFLDLDEGKVQWSLNGEIYAPAYDIPLEL--RNGPSAFFPAVSLKNNTAEFNLGEKAFKFYPGNEWTPLTYTPEQFLKESRRKGPERKVKGWSYLN 2829
            + Y S+ D T   IN       Q N+L+DGT+E+ D  PKK+YY+SLR+  N    L G+  R G            GG++A F   TG   S     +++    + +FKPSGK M+C V+MLDGT   F IDRA++GQ LF+AVC HL L+E EYFG++Y D     FWL+  KKI K +P N    EFQV+FYP +I  + EDLTRYYL LQVRQDLV G+LPCSF VY +L +Y+IQSEAGD+DP  H GI+YI+  P AP   QT + +E++V LHKLHRG+TP+EAD+ FL NAR LALYG+D+HKVKNS+G+++ LGVY+GG +LYR ++R++  SW  +I+ SY+ +  +IT+R  + + +   L+FKC      K+ +    DHH FFR+     PKKP+  P F TRKY+  P+S   T   + + +    P+  +  P      +  W+TL       +  GVV +    +                        H+ Q  +Q+   +  +   +   E           RP     HWR+SPAD T  LG+D  GLDVA+Q G GWQGCR+NKGVK PG Y++EA  LEDGLVR+GWSTN+ASL++G+D  G+G+GAD VG   G N  G  MH +   DYG  +  GD +GC ++LN G V W  NGE    G+ IP+QLR E   P  S+KD RI FNFGD    Y P     +IPV Q ++ +EVPN++ GW++N YDA+  +DIS +G  AQ+     WQG R N+G++G G++Y+EV+PLE  GL R GWSTE  SL+LGTD+ GFGYGAD DGFGL+G QGK+M  ++IENYG++F K DVIGCFLD  E  V+WS NG  +  AY IP EL      +AFFP VSL N+T EFN G+K F+FYPG +WTP+  TP  +LK +RRKGPERKVKGWSY++
Sbjct:   11 SGYLSNGDNTPEFINLTQLEGRQWNQLDDGTVEVVDRAPKKEYYLSLRRPINPTMTLMGTGQRKGSFSGSSGLLPTNGGASASFAAPTGRSPSPGATLTRNSNPPVTNFKPSGKTMDCTVVMLDGTPREFRIDRAAYGQQLFEAVCAHLALSEVEYFGLTYYDSSNTWFWLNMRKKIAKQLPKNEWRCEFQVRFYPYDIDGIKEDLTRYYLCLQVRQDLVSGQLPCSFMVYCLLGAYIIQSEAGDHDPAQHVGIKYIQDHPFAPHVLQTPEMLERMVQLHKLHRGKTPQEADRLFLQNARCLALYGVDLHKVKNSQGKDVHLGVYHGGFLLYRNRIRLMHISWPHIIKFSYRDRTFMITLRRPDTDPSDTTLSFKCQGETFAKRLFDVCADHHAFFRLRGSARPKKPSFLPTFATRKYH-FPSSLVFTPPSQPSMNGAQRPQ-SQFRPVHMHPQNPNWFTLARPGEPGHPNGVVASQYQYQPAMFDGDVGTMNPVYLDGQYVTNGHTGQQGVQRHLPHGAATPGVGAGEHHHPGTAVVISRPVFVAEHWRISPADRTPGLGIDPHGLDVAAQRGAGWQGCRANKGVKAPGAYYFEAVCLEDGLVRVGWSTNEASLELGTDNCGFGFGADAVGAS-GANGTGRAMHRNTGHDYGVSVKQGDVIGCWLDLNKGSVAWSCNGEVFQRGFTIPDQLRGEAFLPAASLKDSRILFNFGDQALEYQPQGP--FIPVAQVSDDSEVPNRNTGWRMNPYDASAALDISPDGSKAQAHWAHGWQGCRSNQGIRGPGRFYFEVTPLEDTGLCRFGWSTEDASLNLGTDRFGFGYGADNDGFGLNGQQGKRMHCDEIENYGEAFTKDDVIGCFLDTIEHTVKWSKNGIDFGDAYHIPPELFQSTTAAAFFPTVSLLNSTVEFNFGDKRFQFYPGPDWTPVCCTPANYLKRTRRKGPERKVKGWSYID 961          
BLAST of Band 4.1 protein 2 vs. TrEMBL
Match: A0A074ZAF2 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_14822 PE=4 SV=1)

HSP 1 Score: 868.226 bits (2242), Expect = 0.000e+0
Identity = 453/977 (46.37%), Postives = 597/977 (61.11%), Query Frame = 1
Query:  118 NSYNSDADTTHGSINFHTESTSQVNRLEDGTIEITDTLPKKDYYMSLRKSDN---RLGGSMSR------------IGGGSNAGFGTMTGTLRS-GYNAKSQS---ILDFKPSGKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSA--SPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDGWYTLPSKNGTAYKKGVVLXXXXXXXXXX--------------------XXTQLNIQKPNQNKISKTPLTDTE-----------RPTLPNLHWRMSPADCTLSLGMDDKGLDVASQPGTGWQGCRSNKGVKTPGEYFYEARVLEDGLVRLGWSTNDASLKVGSDENGYGYGADEVGRGWGENVKGCTMHDSKIKDYGSGLFMGDYVGCRVNLNNGDVVWYKNGESMGVGYKIPEQLRKEPMFPTL-------------------SVKDGRIEFNFGDSPFVYPPSDSETWIPVCQANEITEVPNKHIGWKLNAYDATKLIDISAEGLMAQSQMNAEWQGSRCNKGVKGRGKYYYEVSPLESGGLARVGWSTEAGSLDLGTDKCGFGYGADPDGFGLSGNQGKKMFNNDIENYGKSFNKGDVIGCFLDLDEGKVQWSLNGEIYAPAYDIPLELRNG--PSAFFPAVSLKNNTAEFNLGEKAFKFYPGNEWTPLTYTPEQFLKESRRKGPERKVKGWSYLN 2829
            + Y S+ D T   IN       Q N+L+DGT+E+ D  PKK+YY+SLR+  N    L G+  R              GG++A F   TG   S G      S   + +FKPSGK M+C V+MLDGT   F IDRA++GQ LF+AVC HL L+E EYFG++Y D     FWL+  KKI K +P N    EFQV+FYP +I  + EDLTRYYL LQVRQDLV G+LPCSF VY +L +Y+IQSEAGD+DP  H GI+YI+  P AP   QT + +E++V LHKLHRG+TP+EAD+ FL NAR LALYG+D+HKVKNS+G+++ LGVY+GG +LYR ++R++  SW  +I+ SY+ +  +IT+R  + + +   L+FKC      K+ +    DHH FFR+     PKKP+  P F TRKY+  P+S   SP +       + P  + +   P      +  W+TL       +  GVV +    +                        H+ Q  +Q+   +  +   +   E           RP     HWR+SPAD T  LG+D  GLDVA+Q G GWQGCR+NKGVK PG Y++EA  LEDGLVR+GWSTN+ASL++G+D  G+G+GAD VG   G N  G  MH +   DYG  +  GD +GC ++LN G V W  NGE    G+ IP+QLR E   P L                   S+KD RI FNFGD    YPP     +IPV Q ++ +EVPN+  GW++N YDA+  +DIS +G  AQ+     WQG R N+G++G G++Y+E +PLE  GL R+GWSTE  SL+LGTD+ GFGYGAD DGFGL+G QGK+M  ++IENYG++F K DVIGCFLD  E  V+WS NG  +  AY IP EL      +AFFP VSL N+T EFN G+K F+FYPG +WTP+  TP  +LK +RRKGPERKVKGWSY++
Sbjct:   11 SGYLSNGDNTPEFINLTQLEGRQWNQLDDGTVEVVDRAPKKEYYLSLRRPINPNMTLMGTGQRKGSFSGSSGLGPTNGGASASFAAPTGRSPSPGATLTRNSNPPVTNFKPSGKTMDCTVVMLDGTPREFRIDRAAYGQQLFEAVCAHLALSEVEYFGLTYYDSSNTWFWLNMRKKIAKQLPKNEWRCEFQVRFYPYDIDGIKEDLTRYYLCLQVRQDLVSGQLPCSFMVYCLLGAYIIQSEAGDHDPAQHVGIKYIQDHPFAPHVLQTPEMLERMVQLHKLHRGKTPQEADRLFLQNARCLALYGVDLHKVKNSQGKDVHLGVYHGGFLLYRNRIRLMHISWPHIIKFSYRDRTFMITLRRPDTDPSDTTLSFKCQGETFAKRLFDVCADHHAFFRLRGSARPKKPSFLPTFATRKYH-FPSSLVFSPPSQPSMNGAQRPQSQFR---PVHMHPQNPNWFTLARPGEPGHPNGVVASQYQYQPAMFDGDVGTMNPVYLDGQYVTNGHTGQQGVQRHLPHGAATPGVGAVEYHHSGAAVVISRPVFVAEHWRISPADRTPGLGIDPHGLDVAAQRGAGWQGCRANKGVKAPGAYYFEAVCLEDGLVRVGWSTNEASLELGTDNCGFGFGADAVGAS-GANGAGRAMHRNTGHDYGVSVKQGDVIGCWLDLNKGSVAWSCNGEVFQRGFTIPDQLRGEAFLPDLMCTDRANAKVSFHTRCLAASLKDSRIMFNFGDQALEYPPQGP--FIPVAQVSDDSEVPNRITGWRMNPYDASAALDISPDGSKAQAHWAHGWQGCRSNQGIRGPGRFYFEATPLEDTGLCRIGWSTEDASLNLGTDRFGFGYGADNDGFGLNGQQGKRMHCDEIENYGEAFTKDDVIGCFLDTIEHTVKWSKNGIDFGEAYHIPPELFQSATAAAFFPTVSLLNSTVEFNFGDKRFQFYPGPDWTPVCCTPANYLKRTRRKGPERKVKGWSYID 980          
BLAST of Band 4.1 protein 2 vs. TrEMBL
Match: A0A4E0RQ54 (Band 4.1 protein 2 OS=Fasciola hepatica OX=6192 GN=D915_001297 PE=4 SV=1)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 441/965 (45.70%), Postives = 595/965 (61.66%), Query Frame = 1
Query:  124 YNSDADTTHGSINFHTESTSQVNRLEDGTIEITDTLPKKDYYMSLRKSDNRLGGSMS----RIG--------GGSNAGFG-------------------TMTGTLRSGYNAKSQSILDFKPSGKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKY-YKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDGWYTLPSKNGTAYKKGVVLXXXXXXXXXXXXTQLNIQKP----NQNKISKTPLTDTE-------------------------RPTLPNLHWRMSPADCTLSLGMDDKGLDVASQPGTGWQGCRSNKGVKTPGEYFYEARVLEDGLVRLGWSTNDASLKVGSDENGYGYGADEVGRGWGENVKGCTMHDSKIKDYGSGLFMGDYVGCRVNLNNGDVVWYKNGESMGVGYKIPEQLRKEPMFPTLSVKDGRIEFNFGDSPFVYPPSDSETWIPVCQANEITEVPNKHIGWKLNAYDATKLIDISAEGLMAQSQMNAEWQGSRCNKGVKGRGKYYYEVSPLESGGLARVGWSTEAGSLDLGTDKCGFGYGADPDGFGLSGNQGKKMFNNDIENYGKSFNKGDVIGCFLDLDEGKVQWSLNGEIYAPAYDIPLELRNGPS--AFFPAVSLKNNTAEFNLGEKAFKFYPGNEWTPLTYTPEQFLKESRRKGPERKVKGWSYLN 2829
            Y SD DTT  SIN       Q N+L+DGTIE+TD LPKK+YYMSLR+ ++++ GS +    R+G        G SN   G                   + +GT+R   N    S+ DFKPSGK ++C V+MLDGT   F +D+A++GQ LFD+VC HL L E E+FGI+Y D     +WL   +KI K +  N   FEFQV+FYP +I  + EDLTRYYL LQVRQD+V G+LPCSF  Y +L +Y++QSEAGD+DP  H GI+YI+  P AP   QT + +E++V LHKLHRG+TPEEAD+ FL+NAR LALYG+D+HKVKNS+ E+I LGVY+ GI+ YR ++R++R SW R+I +S+K +  +I +R  +     + +TFKC++    K+ Y   V+HH FFR+     PKKP+L P F +RKY Y +    SPT    +      A  + +  P      D  W+TL ++          + +           +LN   P     Q  ++   +  T+                         RP      WR+SPAD T  LG+D +GLDVA+Q G GWQGCRSNKGVK PG Y++EA  LEDGLVR+GWSTN+ASL++G+D  G+G+GAD +         G  MH +   DYG  +  GD VGC ++L+ G V W  NG+     + IP+QLR E   P  S+KD R+ FNFGD    + P    T  PV  A+E ++V N++ GW+LN YD +  +D++ +G MAQ+Q N  WQG R N+G++G G++Y+EV PLE  GL RVGWSTE  SLDLG+D+ GFGYGAD  GFGL+G QGK++  ++I+NYG++F K DVIGCFLD  E  ++WS NG  +  AY IP E  N  S  AFFP+VSL N+T E N G+K F+FYPG +WTP+   P  ++K +RRKGPERKVKGWSY++
Sbjct:   13 YLSDGDTTAESINLAHLEGHQWNQLQDGTIEVTDRLPKKEYYMSLRRFNSQMPGSATGTAQRLGSISSGSILGPSNGTVGLVNTSLPTGGTTVQPTSPRSTSGTMRGRTN---NSMNDFKPSGKTVDCTVVMLDGTTREFRLDKAAYGQQLFDSVCTHLGLLEVEFFGITYYDATNNWYWLQLDQKIAKQLGKNEWQFEFQVRFYPYDIDSIKEDLTRYYLCLQVRQDIVSGQLPCSFMTYCLLGAYIVQSEAGDHDPTQHEGIKYIQDHPFAPHMLQTPEMLERIVQLHKLHRGKTPEEADRLFLNNARLLALYGVDLHKVKNSQDEDINLGVYHDGILQYRNRIRLMRISWPRIISLSHKGRNFVIALRPGDNEPFGRNMTFKCSNTAFAKRLYTVCVEHHAFFRLRGSARPKKPSLFPSFASRKYHYPSNVLHSPTL---YPAGNGAARTLSKFRPIPAHPNDTSWFTLAARTDGDLHMNEAMASQYQYQPSMMPGELNTLSPMYMDGQQLMNGHSMPGTQGAQRALPPGVAAGTGATVVGGVPHSRPCFEPESWRISPADRTSGLGIDARGLDVAAQRGAGWQGCRSNKGVKAPGAYYFEAACLEDGLVRVGWSTNEASLELGTDNCGFGFGAD-MTGSSTGGGAGRAMHRNNGHDYGVMVQQGDVVGCLLDLDKGSVAWSVNGKVFQRAFTIPDQLRGESFLPAASLKDSRLLFNFGDQTLEFHPGGPFT--PVAVASEDSQVANRNTGWRLNPYDTSAGMDVAPDGSMAQAQFNQGWQGCRANQGIRGPGRFYFEVVPLEDCGLCRVGWSTEEASLDLGSDRFGFGYGADSQGFGLNGQQGKRIHADEIDNYGEAFTKNDVIGCFLDTIEHTLKWSKNGIDFGDAYRIPAEFSNPTSLVAFFPSVSLLNSTVEINFGDKPFQFYPGPDWTPVCCAPMDYVKRTRRKGPERKVKGWSYID 968          
BLAST of Band 4.1 protein 2 vs. TrEMBL
Match: A0A5K4F8W6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 451/963 (46.83%), Postives = 607/963 (63.03%), Query Frame = 1
Query:  118 NSYNSDADTTHGSINF-HTESTSQVNRLEDGTIEITDTLPKKDYYMSLRKSD---------NRLG----GSMSRIGGGSNAGFGTMT-------GTLRSGYNAKSQSILDFKPSGKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPT-----SASPTAG-GEFTYDRNPAPKIKRLPPPRKEQTDDGWYTLPSKNGTAYKKGVV-----------LXXXXXXXXXXXXTQLNIQKPNQ------------------NKISKTPLTDTERPTLPNLHWRMSPADCTLSLGMDDKGLDVASQPGTGWQGCRSNKGVKTPGEYFYEARVLEDGLVRLGWSTNDASLKVGSDENGYGYGADEVGRGWGENVKGCTMHDSKIKDYGSGLFMGDYVGCRVNLNNGDVVWYKNGESMGVGYKIPEQLRKEPMFPTLSVKDGRIEFNFGDS-PFVYPPSDSETWIPVCQANEITEVPNKHIGWKLNAYDATKLIDISAEGLMAQSQMNAEWQGSRCNKGVKGRGKYYYEVSPLESGGLARVGWSTEAGSLDLGTDKCGFGYGADPDGFGLSGNQGKKMFNNDIENYGKSFNKGDVIGCFLDLDEGKVQWSLNGEIYAPAYDIPLELRNGP--SAFFPAVSLKNNTAEFNLGEKAFKFYPGNEWTPLTYTPEQFLKESRRKGPERKVKGWSYLN 2829
            +++ SD +T   S N  H E  S  N+L+DGTIEITD LPKK+YYMSLR+ +         +RLG    GS + +  GS+   G  +       GTLR    +   S++DFKPSGKL++C V+MLDGT   F +D+A++GQ LFDAVC HL L E E+FGI+Y D     FWL   +KI K +  N   FEFQVKFYP +I  + ED+TRYYL LQVRQD+V G+LPCSF  Y ILASY++QSEAGD+DP  H GI+YI+  P AP   QT + + ++V LHKLHRG+TPEEAD+ FL+NARKLALYG+D+HKVK S+G++I LGVYYGGI+LYR ++R++R SW R+I +S++ +  II  R    +   + +TFKC    L K+ Y   VDHH FFR+      KKP+L P F TRKY+   T     S   T G GE         K + +P    E  +     + S+    Y+  +V             + SI +     T   +Q+  Q                  N I+   +  T  P  P  HWR++ ADCT  LG+D +GLDVAS  G GWQGCR+NKGVK PG Y+YEA  LE+GL+R+GWSTNDA L++G+D  G+GYG+D VG   G N  G  +H +   DYG  +  GD +GC ++L+ G + W  NG+     + IP+QLR E   P  S+KD RI FNFG+  P  +PP     +IPV Q+ + ++V N++ GW++N YDAT  +D++ +G   QS  N  WQG R N G++G G++Y+EV+P+ES GL RVGWST+ G+L +GTD+ GFGYGAD +GFGL+G QGK++  ++IENYG++F++GDVIGCFLD  E  ++WS NG  +  AY IP EL +    +A +P VSL N+T E N G+K FK+YPG +WTP+   P +  K SRRKGPERKVKGWSY++
Sbjct:   11 STFLSDNETAGESTNLLHLEGHSW-NQLQDGTIEITDRLPKKEYYMSLRRFNGAGPNFGIAHRLGSISSGSAAGLVNGSSGLLGGNSPSPCPGGGTLRG---SSHPSVIDFKPSGKLVDCTVVMLDGTTREFRLDKAAYGQQLFDAVCTHLGLLEVEFFGITYYDSTNNWFWLQIDQKIAKQIGKNEWQFEFQVKFYPCDIDSIKEDITRYYLCLQVRQDIVSGQLPCSFVTYCILASYIVQSEAGDHDPSQHIGIKYIQDHPFAPHMLQTPEMLGRIVELHKLHRGKTPEEADRLFLNNARKLALYGVDLHKVKTSQGQDITLGVYYGGILLYRNRIRLMRISWPRIISLSHRGRNFIIARR-PGDDSLDRNMTFKCISPILAKRLYNVCVDHHNFFRLRGSSRQKKPSLFPSFATRKYHYPGTTMNLSSIDATVGVGEHNQTSRSLSKFRPMPAHPSETVNHMNGAVASQ--YQYQPAMVSGDPACMNPAYFCSQSIINGLPIPTAQGVQRYYQSSSNDVTGLMNDHYSSKNNHINNMTVMITRIPFEPE-HWRITGADCTPGLGIDARGLDVASTRGAGWQGCRANKGVKAPGAYYYEAVCLEEGLIRVGWSTNDADLELGADNYGFGYGSDAVGSA-GINGTGRVIHRNIGYDYGIMVHQGDVIGCLLDLDKGSISWSCNGKIFQRAFTIPDQLRGEAFLPAASLKDSRILFNFGEERPLEFPPDGP--FIPVAQSADDSQVSNRNPGWRMNQYDATNALDVAPDGSQVQSHFNQGWQGCRSNHGIRGLGRFYFEVTPIESTGLWRVGWSTDDGNLIVGTDQYGFGYGADNEGFGLNGQQGKRIHCDEIENYGEAFSEGDVIGCFLDTIEHTIKWSRNGLEFGDAYQIPSELLDSKKLTALYPTVSLLNSTVELNFGDKPFKYYPGPDWTPVCCAPPECTKRSRRKGPERKVKGWSYID 962          
BLAST of Band 4.1 protein 2 vs. Ensembl Cavefish
Match: epb41a (erythrocyte membrane protein band 4.1a [Source:ZFIN;Acc:ZDB-GENE-070705-81])

HSP 1 Score: 267.7 bits (683), Expect = 1.563e-75
Identity = 136/344 (39.53%), Postives = 206/344 (59.88%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDG 1431
            K+M+C V +LD T     +++ + GQ LF  VCDHL L E++Y+G++  +   +  WLDFTK+I + V      F F VKFYPP+ + + ED+TRYYL LQ+R+D++ G+LPCSF    +L SY +QSE G+YDP+ H G EY K   L P   QT++  +KV+ LH+ +R  +P +AD  FL+NA+KL++YG+D+H  K+ +G +IMLGV   G+++Y+ K+R+ RF W ++++VSYK+    I +R       +  + FK  + K +KK +K  V+HH FFR+        P       ++  Y   T A  T       DR PAP  +R    R  ++ DG
Sbjct:  175 KIMQCKVTLLDDTLFECELEKHAKGQELFAKVCDHLNLLEKDYYGLAIWETPAVKTWLDFTKEIRRQVQGTTYEFTFNVKFYPPDPAQLSEDITRYYLCLQLRKDILSGRLPCSFVTLALLGSYALQSELGEYDPEVH-GTEYAKDLKLIPN--QTKELEDKVMELHRTYRSMSPAQADMMFLENAKKLSMYGVDLHHAKDLDGVDIMLGVCSSGLMVYKDKLRINRFPWPKVLKVSYKRSSFFIKIRPSELEHYESAIGFKLPNYKASKKLWKVCVEHHTFFRLTSTEAATTPRKFLALGSKFRYSGRTQAQ-TRQASSMIDR-PAPHFQRSASKRASRSLDG 513          
BLAST of Band 4.1 protein 2 vs. Ensembl Cavefish
Match: epb41l3a (protein 4.1 [Source:NCBI gene;Acc:103040375])

HSP 1 Score: 265.774 bits (678), Expect = 1.308e-74
Identity = 126/303 (41.58%), Postives = 194/303 (64.03%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTR 1308
            K M+C V +LDG++    +++   GQ L D VC+HL L ER+YFGI+++D      WLD +K + K +      F F VKFYPP+ + + ED+TRYYL LQ+R D++ G+LPCSF  +T+L SY +QSE GD+DP  + G +Y+     AP   QT++  EKV+ LHK ++G TP +A+ +FL+N +KL++YG+D+H  K+SEG EIMLGV   G+++YR ++R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P K  L  G   R
Sbjct:   92 KNMQCKVTLLDGSDYTCVVEKRDKGQVLLDKVCEHLNLLERDYFGITFRDAENQKNWLDPSKDMKKQIRGVAWNFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDVLSGRLPCSFATHTVLGSYTVQSELGDFDPDEY-GTDYVSEFRFAPH--QTKELEEKVMDLHKNYKGMTPADAEMHFLENVKKLSMYGVDLHHAKDSEGVEIMLGVCSSGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPETPPKKFLTLGSKFR 391          
BLAST of Band 4.1 protein 2 vs. Ensembl Cavefish
Match: epb41a (erythrocyte membrane protein band 4.1a [Source:ZFIN;Acc:ZDB-GENE-070705-81])

HSP 1 Score: 267.7 bits (683), Expect = 1.403e-74
Identity = 136/344 (39.53%), Postives = 206/344 (59.88%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDG 1431
            K+M+C V +LD T     +++ + GQ LF  VCDHL L E++Y+G++  +   +  WLDFTK+I + V      F F VKFYPP+ + + ED+TRYYL LQ+R+D++ G+LPCSF    +L SY +QSE G+YDP+ H G EY K   L P   QT++  +KV+ LH+ +R  +P +AD  FL+NA+KL++YG+D+H  K+ +G +IMLGV   G+++Y+ K+R+ RF W ++++VSYK+    I +R       +  + FK  + K +KK +K  V+HH FFR+        P       ++  Y   T A  T       DR PAP  +R    R  ++ DG
Sbjct:  285 KIMQCKVTLLDDTLFECELEKHAKGQELFAKVCDHLNLLEKDYYGLAIWETPAVKTWLDFTKEIRRQVQGTTYEFTFNVKFYPPDPAQLSEDITRYYLCLQLRKDILSGRLPCSFVTLALLGSYALQSELGEYDPEVH-GTEYAKDLKLIPN--QTKELEDKVMELHRTYRSMSPAQADMMFLENAKKLSMYGVDLHHAKDLDGVDIMLGVCSSGLMVYKDKLRINRFPWPKVLKVSYKRSSFFIKIRPSELEHYESAIGFKLPNYKASKKLWKVCVEHHTFFRLTSTEAATTPRKFLALGSKFRYSGRTQAQ-TRQASSMIDR-PAPHFQRSASKRASRSLDG 623          
BLAST of Band 4.1 protein 2 vs. Ensembl Cavefish
Match: epb41a (erythrocyte membrane protein band 4.1a [Source:ZFIN;Acc:ZDB-GENE-070705-81])

HSP 1 Score: 268.085 bits (684), Expect = 1.552e-74
Identity = 136/344 (39.53%), Postives = 206/344 (59.88%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDG 1431
            K+M+C V +LD T     +++ + GQ LF  VCDHL L E++Y+G++  +   +  WLDFTK+I + V      F F VKFYPP+ + + ED+TRYYL LQ+R+D++ G+LPCSF    +L SY +QSE G+YDP+ H G EY K   L P   QT++  +KV+ LH+ +R  +P +AD  FL+NA+KL++YG+D+H  K+ +G +IMLGV   G+++Y+ K+R+ RF W ++++VSYK+    I +R       +  + FK  + K +KK +K  V+HH FFR+        P       ++  Y   T A  T       DR PAP  +R    R  ++ DG
Sbjct:  292 KIMQCKVTLLDDTLFECELEKHAKGQELFAKVCDHLNLLEKDYYGLAIWETPAVKTWLDFTKEIRRQVQGTTYEFTFNVKFYPPDPAQLSEDITRYYLCLQLRKDILSGRLPCSFVTLALLGSYALQSELGEYDPEVH-GTEYAKDLKLIPN--QTKELEDKVMELHRTYRSMSPAQADMMFLENAKKLSMYGVDLHHAKDLDGVDIMLGVCSSGLMVYKDKLRINRFPWPKVLKVSYKRSSFFIKIRPSELEHYESAIGFKLPNYKASKKLWKVCVEHHTFFRLTSTEAATTPRKFLALGSKFRYSGRTQAQ-TRQASSMIDR-PAPHFQRSASKRASRSLDG 630          
BLAST of Band 4.1 protein 2 vs. Ensembl Cavefish
Match: epb41a (erythrocyte membrane protein band 4.1a [Source:ZFIN;Acc:ZDB-GENE-070705-81])

HSP 1 Score: 268.085 bits (684), Expect = 1.944e-74
Identity = 136/344 (39.53%), Postives = 206/344 (59.88%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDG 1431
            K+M+C V +LD T     +++ + GQ LF  VCDHL L E++Y+G++  +   +  WLDFTK+I + V      F F VKFYPP+ + + ED+TRYYL LQ+R+D++ G+LPCSF    +L SY +QSE G+YDP+ H G EY K   L P   QT++  +KV+ LH+ +R  +P +AD  FL+NA+KL++YG+D+H  K+ +G +IMLGV   G+++Y+ K+R+ RF W ++++VSYK+    I +R       +  + FK  + K +KK +K  V+HH FFR+        P       ++  Y   T A  T       DR PAP  +R    R  ++ DG
Sbjct:  292 KIMQCKVTLLDDTLFECELEKHAKGQELFAKVCDHLNLLEKDYYGLAIWETPAVKTWLDFTKEIRRQVQGTTYEFTFNVKFYPPDPAQLSEDITRYYLCLQLRKDILSGRLPCSFVTLALLGSYALQSELGEYDPEVH-GTEYAKDLKLIPN--QTKELEDKVMELHRTYRSMSPAQADMMFLENAKKLSMYGVDLHHAKDLDGVDIMLGVCSSGLMVYKDKLRINRFPWPKVLKVSYKRSSFFIKIRPSELEHYESAIGFKLPNYKASKKLWKVCVEHHTFFRLTSTEAATTPRKFLALGSKFRYSGRTQAQ-TRQASSMIDR-PAPHFQRSASKRASRSLDG 630          
BLAST of Band 4.1 protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001599.1 (pep scaffold:Pmarinus_7.0:GL478896:2253:11647:-1 gene:ENSPMAG00000001443.1 transcript:ENSPMAT00000001599.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.66 bits (483), Expect = 2.867e-55
Identity = 91/199 (45.73%), Postives = 130/199 (65.33%), Query Frame = 1
Query:  412 CLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSE 1008
            C V +LDG+     +D+ + GQ LFD VC+HL L E++YFG++Y+D  +   WLD  K+I + V      F F  KFYPP+ + + ED+TRYY+ LQ+R+D+  G+LPCSF  + +L SY +Q+E GD++P  H G  Y      AP   QT +  +KVV LHK HR  TP EAD +FL+NA+KL++YG+D+H  + SE
Sbjct:   28 CSVSLLDGSVFPCDVDKQAKGQVLFDLVCEHLNLLEKDYFGLNYRDNTEQKNWLDPNKEIKRQVRAGAWTFIFNTKFYPPDPAQLTEDITRYYICLQLREDVASGRLPCSFVTHAVLGSYALQAELGDHEPDEH-GPGYASEFRFAPN--QTPELEDKVVELHKTHRNMTPAEADLHFLENAKKLSMYGVDLHHARVSE 223          
BLAST of Band 4.1 protein 2 vs. Ensembl Sea Lamprey
Match: EPB41L2 (erythrocyte membrane protein band 4.1 like 2 [Source:HGNC Symbol;Acc:HGNC:3379])

HSP 1 Score: 190.274 bits (482), Expect = 3.505e-51
Identity = 102/277 (36.82%), Postives = 154/277 (55.60%), Query Frame = 1
Query:  460 RASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNAR-----KLALYGLDMHKVK-------NSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRM 1254
            R + G  LF  VC+HL L ER+YF ++YKD      WLD  K+I K +  +  +  F VKFYPP+ S ++ED++RYYL LQ+R+D+  G+LPC   V+ +L SY +Q+E GDYD   H G  Y     LAP   QT +  +++  LH  HR  +P +A     +++R      L   G   H          +SEG +I LGV   G+++YR  +R+ RF+W +++++SY++    I VR       +  + FK    +  K+ +K  V+HH FFRM
Sbjct:    7 RHAKGHELFHRVCEHLNLLERDYFSLTYKDASDQKNWLDPIKEIKKQLMHSPWLVSFNVKFYPPDPSHLLEDISRYYLCLQLREDVARGRLPCLPVVHALLGSYALQAELGDYDAAEH-GAGYADRFQLAPN--QTHELQDRMAELHAAHRCVSPRKASSRSGEDSRDAFRVSLEPTGAFAHNAAFSPQCHPDSEGVDIKLGVCANGLLVYRDHLRINRFAWPKILKISYRRSNFFIKVRPGEFEKCESNVGFKLPSHRAAKRLWKTCVEHHTFFRM 280          
BLAST of Band 4.1 protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001312.1 (pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 gene:ENSPMAG00000001156.1 transcript:ENSPMAT00000001312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.193 bits (474), Expect = 1.099e-48
Identity = 98/289 (33.91%), Postives = 159/289 (55.02%), Query Frame = 1
Query:  412 CLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKD-RCKIMFWLDFTKKITKHVP-DNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIP 1272
            C + +LD T      +++  G+ L DAV  HL+L E +YFG+ + D   +   WLD TK + K +   +  +F F+VKF+  + S + E+ TRY+  LQ+R D++  +LPC      +LASY++QSE GDY    H    Y+      P+  Q  DF ++V  LHK H G TP +A+ N+L+ A+ +  YG+++H  ++    EIM+GV  GG+ +Y   VR+  F W +++++ +K K   + +R       +  + F   + +  K  +KA V+HH FFRM     P
Sbjct:   31 CHINLLDNTAITLRANKSEAGKALLDAVFAHLDLAETDYFGLQFADDSTETPRWLDPTKPLRKQIKRSSPYIFNFRVKFFVTDPSKLQEEYTRYHYFLQLRNDILEARLPCPHNTAALLASYIVQSELGDYSETEHLP-GYLSDLRFLPR--QGLDFEKEVAKLHKQHVGMTPADAEFNYLNVAKNVEFYGVELHYARDQSNVEIMVGVTAGGVNVYNNGVRISNFPWIKIVKIFFKLKHFFVQLRKEQNETRENIIGFNLGNYRACKTLWKACVEHHTFFRMARPASP 316          
BLAST of Band 4.1 protein 2 vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 173.711 bits (439), Expect = 1.321e-47
Identity = 103/293 (35.15%), Postives = 157/293 (53.58%), Query Frame = 1
Query:  460 RASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNR-LVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRG-----IEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKE----LTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTR 1308
            + + GQ LFD V  HL++ E +YFG+ + D  ++  WLD TK I K V       F  +VKFY  E + + E+LTRY   LQ++QD++ GKL C F     LA+Y +Q+E GD DP  H         +I SQ        +++  E ++   K  RGQTP +A+ N+L+ A+ L +YG+DMH VK  +G E  LG+   G++++  + ++  F W ++ ++ +K+ KL + V  V  +D  KE      F+    K  K  +K  V+HH FFR+     P K N  P    R
Sbjct:    1 KKAVGQDLFDQVMYHLDILEVDYFGLQFMDSAQVSHWLDHTKNIRKQVKIGPPYCFHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCDPVEHNPALVSEFRFIPSQ--------SEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVV--VEDDDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRL---RGPSKTNADPSSFIR 280          
BLAST of Band 4.1 protein 2 vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 172.94 bits (437), Expect = 2.889e-47
Identity = 102/288 (35.42%), Postives = 156/288 (54.17%), Query Frame = 1
Query:  460 RASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNR-LVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKE----LTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTR 1308
            + + GQ LFD V  HL++ E +YFG+ + D  ++  WLD TK I K V       F  +VKFY  E + + E+LTRY   LQ++QD++ GKL C F     LA+Y +Q+E GD DP  H     +      P   Q+++  E ++   K  RGQTP +A+ N+L+ A+ L +YG+DMH VK  +G E  LG+   G++++  + ++  F W ++ ++ +K+ KL + V  V  +D  KE      F+    K  K  +K  V+HH FFR+     P K N  P    R
Sbjct:    1 KKAVGQDLFDQVMYHLDILEVDYFGLQFMDSAQVSHWLDHTKNIRKQVKIGPPYCFHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCDPVEHNPA-LVSEFRFIPS--QSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVV--VEDDDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRL---RGPSKTNADPSSFIR 280          
BLAST of Band 4.1 protein 2 vs. Ensembl Nematostella
Match: EDO36130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ3])

HSP 1 Score: 222.246 bits (565), Expect = 8.638e-65
Identity = 108/267 (40.45%), Postives = 165/267 (61.80%), Query Frame = 1
Query:  454 IDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRM 1254
            + + + G  L  AV +HL L+E+EYFG+ Y  + +  +WLD  K+I K +  N   FE  VKFY P  S +  D+TRY + LQVR D++C +LPCSF    +L SYV+QSE GDYDP  H+G  Y+     +P   Q+ + +E++  LHK HRG TPEEAD  +L+ ARKL +YG+D H  ++  G+E+++GV Y G+++++  +R  +F W +++ +SYK +   +  R     +    +TFK    K  K+ YK+ V+HH FFR+
Sbjct:    1 LQKTAKGIDLMVAVAEHLNLDEKEYFGLLYDHKGE-KYWLDPQKEIKKQLKGNLPHFELAVKFYEPYPSKLKHDMTRYMMVLQVRDDIICERLPCSFGAQALLGSYVVQSEFGDYDPHEHKG-NYLAGLVFSPN--QSHELVERIKELHKEHRGLTPEEADTQYLEAARKLTMYGVDAHPARDGNGDEVLVGVSYAGVLVFKDDLRQNKFPWPKVVYLSYKGRDFSVKSRPGELEELTTTMTFKLPTEKAAKRLYKSCVEHHTFFRL 263          
BLAST of Band 4.1 protein 2 vs. Ensembl Nematostella
Match: EDO30224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1E3])

HSP 1 Score: 209.149 bits (531), Expect = 4.708e-59
Identity = 107/282 (37.94%), Postives = 167/282 (59.22%), Query Frame = 1
Query:  454 IDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMF-WLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELT--FKCTDLKLTKKAYKAVVDHHYFFRMIE-FGIPKKPNL 1287
            ID+ + G HLFD VCDH+ L E+EYFG+ Y D     F WL+  + I + +    L F F VKFYP   + + ED+TRY   LQ+R+DL+ G++ CS  ++ +LASYV+Q+E GD  P+ H  + Y+      P+  Q  +  +K+ A H+ H G TP +A+  +LDN RKL LYG DM++    EG+ + + +   G+ +++   ++ RF W ++I + +K KK  +T+R  +++D  K  T  FKC   +  K+ +K  V+HH FFR+ E   +PK  N 
Sbjct:   24 IDKTTKGDHLFDQVCDHIGLAEKEYFGLRYIDEKDGQFNWLEGDRSIKRQMGKAPLHFYFAVKFYPENPTTLREDITRYQFVLQLREDLLKGRIQCSNPIHALLASYVMQAELGDLHPEEHE-VAYLSDLKFFPK--QPPELRQKIEAFHRKHVGMTPSDAEFQYLDNVRKLPLYGRDMYQAWGDEGQAVTIAISAWGVEVFQNNRQMHRFVWPKIISIGFKSKKFSLTLRAPSEDDYYKSTTIYFKCGSQRAAKRVWKVCVEHHAFFRLKEPVPLPKNTNF 302          
BLAST of Band 4.1 protein 2 vs. Ensembl Nematostella
Match: EDO34391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH7])

HSP 1 Score: 177.563 bits (449), Expect = 1.240e-49
Identity = 97/280 (34.64%), Postives = 158/280 (56.43%), Query Frame = 1
Query:  418 VIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFE--FQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFR 1251
            + +LD TE      R + GQ +FD VC  L+L E++YFG+ Y D  K   WLD +K + K +   +  F+  F+VKFY  +  ++ E++TRY   LQ+++D++ G+L CS+     L +Y++Q+E GDYDP+      Y+    + P+  Q++    K+  +H+   GQ P  A+KNFLD  + L +YG+D H  K+ +  ++ LG+   GI + R   +V  F WA++I+ SY+ K   +    V+K+D K    F+  D    K  +K  V+HH F+R
Sbjct:   18 ISLLDDTELTCEFRRDAKGQTVFDTVCKALDLVEKDYFGLRYVDDSKQRHWLDLSKSVIKQMKSLKPPFKLFFRVKFYALDPGLIHEEITRYQCFLQIKRDILHGRLLCSYNELAELGAYIVQAELGDYDPEDQED-NYVSEFRIVPK--QSEKLENKIADIHRSLSGQVPSVAEKNFLDKVKSLDMYGVDPHPCKDQDNVQLYLGLTPTGIAIIRDGKKVSGFEWAQIIKCSYEGKVFYVQ---VHKDDRKANYGFRLPDPLACKHLWKCAVEHHAFYR 291          
BLAST of Band 4.1 protein 2 vs. Ensembl Nematostella
Match: EDO44823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUW8])

HSP 1 Score: 186.422 bits (472), Expect = 3.104e-48
Identity = 117/350 (33.43%), Postives = 184/350 (52.57%), Query Frame = 1
Query:  406 MECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISY-KDRCKIMF------WLDFTKKITKHVPDNR-LVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDG 1431
            + C+V +LD +E +  +D+ + G  L + V  HL++ E+ YFG+ Y  D    M       WL   K I K        +F F V+F+  + S +VEDLTRYY  LQ+++D++ G+LPC +     L+SY++Q+E GDYDP+ H    Y+      P   QT DF E+    HK H GQTP +A+ NFL+ A+ L LYG+D+H  K+ +G ++ LGV   G+ +Y  K ++  F W+++++V +K+K+  I +R          + F+    +  K  +K  V++H F+R       +K  L+ G   R   KT   A   +    T+ R P PKI R    R  +  D 
Sbjct:   35 IRCVVELLDDSEFIIDVDKNAKGTVLLNEVFRHLDIQEKHYFGLQYVSDSPDNMVGGAKEQWLQDDKIIRKQKKGTPPYIFYFCVRFFVSDPSKLVEDLTRYYFYLQIKRDILTGRLPCLYDTAAELSSYILQAELGDYDPKLHLD-GYVSEFRFIPD--QTDDFEERAAEFHKHHIGQTPADAEFNFLEVAKTLDLYGVDLHCAKDHDGTDLFLGVSALGLTVYHNKCKINFFPWSKIVKVCFKRKRFFIQIRPDWNEWTDNIIGFQMLTYRSCKNLWKVCVEYHSFYRTHYPKATEKRVLRMGSKYRYKGKTEYQAIEESR---THAR-PEPKIVRTLSRRYSKRSDS 377          
BLAST of Band 4.1 protein 2 vs. Ensembl Nematostella
Match: EDO33626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN5])

HSP 1 Score: 175.637 bits (444), Expect = 2.128e-44
Identity = 103/298 (34.56%), Postives = 163/298 (54.70%), Query Frame = 1
Query:  418 VIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPD-NRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTR 1308
            V MLD +   F I+    G  L+  V ++L L+EREYFG+SY D+   +FWLD  K I K V +  +++F F VKFY  + +M+ E+ TRY  +LQV++DLV G L CS     +LASYV+Q E GD+D  + R   Y+      P+  QT D   ++   HK HR  +P + D N LD AR+L +YG+ ++  K+ +  ++ L     GI++++   ++   SWA++ ++S+K+K+ +I +        K  + F+       K  +K  +  H FFR  E   P  P  +P   +R
Sbjct:   27 VCMLDDSVVKFDIEPKVKGDILYKQVYEYLNLDEREYFGLSYYDKSDNLFWLDQLKPIKKQVKEIGKVLFRFCVKFYTADPAMLQEEYTRYLFALQVKKDLVNGGLKCSESTAALLASYVVQGELGDFDTLSCRP-GYLADFQFFPE--QTVDSEARISDFHKQHRSLSPTDCDYNLLDVARRLEMYGVILYPAKDKDNVDLELAAANMGIIVFQSGSKINTLSWAKIRKLSFKRKRFLIKLHPEIFGHYKDVVEFQMASRNACKSFWKVAISTHAFFRQSESQSP--PRHRPRVFSR 319          
BLAST of Band 4.1 protein 2 vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 281.567 bits (719), Expect = 7.566e-81
Identity = 131/303 (43.23%), Postives = 200/303 (66.01%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTR 1308
            K+M+C V +LDG++    +++ + GQ LF  +C+HL L E++YFGI+Y+D      WLD +K++ K + +    F F VKFYPP+ S + ED+TRYYL LQ+R D+V G+LPCSF  +T+L SY +QSE GDYDP+     +Y+    LAP   QT++  EKV+ LHK ++G TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR K+R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P+K  L  G   R
Sbjct:   80 KIMQCKVALLDGSDYTVDVEKRAKGQILFSKICEHLNLLEKDYFGITYRDIENQKNWLDPSKELKKQIRNGPWNFAFNVKFYPPDPSQLSEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPE-EMASDYVSELRLAPN--QTKELEEKVMELHKTYKGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKFLSLGSKFR 379          
BLAST of Band 4.1 protein 2 vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 281.567 bits (719), Expect = 7.827e-81
Identity = 131/303 (43.23%), Postives = 200/303 (66.01%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTR 1308
            K+M+C V +LDG++    +++ + GQ LF  +C+HL L E++YFGI+Y+D      WLD +K++ K + +    F F VKFYPP+ S + ED+TRYYL LQ+R D+V G+LPCSF  +T+L SY +QSE GDYDP+     +Y+    LAP   QT++  EKV+ LHK ++G TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR K+R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P+K  L  G   R
Sbjct:   80 KIMQCKVALLDGSDYTVDVEKRAKGQILFSKICEHLNLLEKDYFGITYRDIENQKNWLDPSKELKKQIRNGPWNFAFNVKFYPPDPSQLSEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPE-EMASDYVSELRLAPN--QTKELEEKVMELHKTYKGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKFLSLGSKFR 379          
BLAST of Band 4.1 protein 2 vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 280.796 bits (717), Expect = 8.908e-81
Identity = 131/303 (43.23%), Postives = 200/303 (66.01%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTR 1308
            K+M+C V +LDG++    +++ + GQ LF  +C+HL L E++YFGI+Y+D      WLD +K++ K + +    F F VKFYPP+ S + ED+TRYYL LQ+R D+V G+LPCSF  +T+L SY +QSE GDYDP+     +Y+    LAP   QT++  EKV+ LHK ++G TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR K+R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P+K  L  G   R
Sbjct:   80 KIMQCKVALLDGSDYTVDVEKRAKGQILFSKICEHLNLLEKDYFGITYRDIENQKNWLDPSKELKKQIRNGPWNFAFNVKFYPPDPSQLSEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPE-EMASDYVSELRLAPN--QTKELEEKVMELHKTYKGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKFLSLGSKFR 379          
BLAST of Band 4.1 protein 2 vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 281.952 bits (720), Expect = 1.254e-80
Identity = 130/299 (43.48%), Postives = 199/299 (66.56%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPG 1296
            K+M+C V +LDG++    +++ + GQ LF  +C+HL L E++YFGI+Y+D      WLD +K++ K + +    F F VKFYPP+ S + ED+TRYYL LQ+R D+V G+LPCSF  +T+L SY +QSE GDYDP+     +Y+    LAP   QT++  EKV+ LHK ++G TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR K+R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P+K  L  G
Sbjct:   80 KIMQCKVALLDGSDYTVDVEKRAKGQILFSKICEHLNLLEKDYFGITYRDIENQKNWLDPSKELKKQIRNGPWNFAFNVKFYPPDPSQLSEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPE-EMASDYVSELRLAPN--QTKELEEKVMELHKTYKGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKFLSLG 375          
BLAST of Band 4.1 protein 2 vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 281.182 bits (718), Expect = 1.615e-80
Identity = 131/303 (43.23%), Postives = 200/303 (66.01%), Query Frame = 1
Query:  400 KLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTR 1308
            K+M+C V +LDG++    +++ + GQ LF  +C+HL L E++YFGI+Y+D      WLD +K++ K + +    F F VKFYPP+ S + ED+TRYYL LQ+R D+V G+LPCSF  +T+L SY +QSE GDYDP+     +Y+    LAP   QT++  EKV+ LHK ++G TP EA+ +FL+NA+KL++YG+D+H  K+SEG EIMLGV   G+++YR K+R+ RF+W +++++SYK+    I +R       +  + FK  + +  K+ +K  V+HH FFR++    P+K  L  G   R
Sbjct:   80 KIMQCKVALLDGSDYTVDVEKRAKGQILFSKICEHLNLLEKDYFGITYRDIENQKNWLDPSKELKKQIRNGPWNFAFNVKFYPPDPSQLSEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPE-EMASDYVSELRLAPN--QTKELEEKVMELHKTYKGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKFLSLGSKFR 379          
BLAST of Band 4.1 protein 2 vs. Planmine SMEST
Match: SMESG000019493.1 (SMESG000019493.1)

HSP 1 Score: 2190.23 bits (5674), Expect = 0.000e+0
Identity = 1098/1100 (99.82%), Postives = 1098/1100 (99.82%), Query Frame = 1
Query:   97 MYQDDYHNSYNSDADTTHGSINFHTESTSQVNRLEDGTIEITDTLPKKDYYMSLRKSDNRLGGSMSRIGGGSNAGFGTMTGTLRSGYNAKSQSILDFKPSGKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDGWYTLPSKNGTAYKKGVVLXXXXXXXXXXXXTQLNIQKPNQNKISKTPLTDTERPTLPNLHWRMSPADCTLSLGMDDKGLDVASQPGTGWQGCRSNKGVKTPGEYFYEARVLEDGLVRLGWSTNDASLKVGSDENGYGYGADEVGRGWGENVKGCTMHDSKIKDYGSGLFMGDYVGCRVNLNNGDVVWYKNGESMGVGYKIPEQLRKEPMFPTLSVKDGRIEFNFGDSPFVYPPSDSETWIPVCQANEITEVPNKHIGWKLNAYDATKLIDISAEGLMAQSQMNAEWQGSRCNKGVKGRGKYYYEVSPLESGGLARVGWSTEAGSLDLGTDKCGFGYGADPDGFGLSGNQGKKMFNNDIENYGKSFNKGDVIGCFLDLDEGKVQWSLNGEIYAPAYDIPLELRNGPSAFFPAVSLKNNTAEFNLGEKAFKFYPGNEWTPLTYTPEQFLKESRRKGPERKVKGWSYLNTDENEIVKISVSSPHDTINENSVHSVTXXXXXXXXXXXXRLSRITNDKEPELSYEPGYINKTGTRTVTNGEVTEILTGEPNIETESYIDEHGNLVXXXXXXXXXXXXXXXXMSELVTERSENDVETTRTGKLSRISQNDFEDMDDEMLRKAILDVISMDSNASVLNIYVGPLEFVAKESSPPQVLESEI 3396
            MYQDDYHNSYNSDADTTHGSINFHTESTSQVNRLEDGTIEITDTLPKKDYYMSLRKSDNRLGGSMSRIGGGSNAGFGTMTGTLRSGYNAKSQSILDFKPSGKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDGWYTLPSKNGTA KKGVVLNNSSIESNENHSTQLNIQKPNQNKISKTPLTDTERPTLPNLHWRMSPADCTLSLGMDDKGLDVASQPGTGWQGCRSNKGVKTPGEYFYEARVLEDGLVRLGWSTNDASLKVGSDENGYGYGADEVGRGWGENVKGCTMHDSKIKDYGSGLFMGDYVGCRVNLNNGDVVWYKNGESMGVGYKIPEQLRKEPMFPTLSVKDGRIEFNFGDSPFVYPPSDSETWIPVCQANEITEVPNKHIGWKLNAYDATKLIDISAEGLMAQSQMNAEWQGSRCNKGVKGRGKYYYEVSPLESGGLARVGWSTEAGSLDLGTDKCGFGYGADPDGFGLSGNQGKKMFNNDIENYGKSFNKGDVIGCFLDLDEGKVQWSLNGEIYAPAYDIPLELRNGPSAFFPAVSLKNNTAEFN GEKAFKFYPGNEWTPLTYTPEQFLKESRRKGPERKVKGWSYLNTDENEIVKISVSSPHDTINENSVHSVTNANNPIENNPNPRLSRITNDKEPELSYEPGYINKTGTRTVTNGEVTEILTGEPNIETESYIDEHGNLVKKTITRTKKTTKTVKTMSELVTERSENDVETTRTGKLSRISQNDFEDMDDEMLRKAILDVISMDSNASVLNIYVGPLEFVAKESSPPQVLESEI
Sbjct:    1 MYQDDYHNSYNSDADTTHGSINFHTESTSQVNRLEDGTIEITDTLPKKDYYMSLRKSDNRLGGSMSRIGGGSNAGFGTMTGTLRSGYNAKSQSILDFKPSGKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDGWYTLPSKNGTASKKGVVLNNSSIESNENHSTQLNIQKPNQNKISKTPLTDTERPTLPNLHWRMSPADCTLSLGMDDKGLDVASQPGTGWQGCRSNKGVKTPGEYFYEARVLEDGLVRLGWSTNDASLKVGSDENGYGYGADEVGRGWGENVKGCTMHDSKIKDYGSGLFMGDYVGCRVNLNNGDVVWYKNGESMGVGYKIPEQLRKEPMFPTLSVKDGRIEFNFGDSPFVYPPSDSETWIPVCQANEITEVPNKHIGWKLNAYDATKLIDISAEGLMAQSQMNAEWQGSRCNKGVKGRGKYYYEVSPLESGGLARVGWSTEAGSLDLGTDKCGFGYGADPDGFGLSGNQGKKMFNNDIENYGKSFNKGDVIGCFLDLDEGKVQWSLNGEIYAPAYDIPLELRNGPSAFFPAVSLKNNTAEFNFGEKAFKFYPGNEWTPLTYTPEQFLKESRRKGPERKVKGWSYLNTDENEIVKISVSSPHDTINENSVHSVTNANNPIENNPNPRLSRITNDKEPELSYEPGYINKTGTRTVTNGEVTEILTGEPNIETESYIDEHGNLVKKTITRTKKTTKTVKTMSELVTERSENDVETTRTGKLSRISQNDFEDMDDEMLRKAILDVISMDSNASVLNIYVGPLEFVAKESSPPQVLESEI 1100          
BLAST of Band 4.1 protein 2 vs. Planmine SMEST
Match: SMESG000062476.1 (SMESG000062476.1)

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 467/1108 (42.15%), Postives = 645/1108 (58.21%), Query Frame = 1
Query:  154 SINFHTESTSQVNRLEDGTIEITDTLPKKDYYMSLRKSDNRLGGSMSRIGGGSNAGFGTMTGTLRSGYNA-KSQSILD--FKPSGKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRC-KIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPT-------AGGEFTYDRNPAPKIKRLPPPRKEQTDDGWYTLPSKNGTAYKKGVVLXXXXXXXXXXXXTQLNIQKPNQNKISKTPLTDTERPTLPNLHWRMSPADCTLSLGMDDKGLDVASQPGTGWQGCRSNKGVKTPGEYFYEARVLEDGLVRLGWSTNDASLKVGSDENGYGYGADEVGRGWGENVKGCTMHDSKIKDYGSGLFMGDYVGCRVNLNNGDVVWYKNGESMGVGYKIPEQLRKEPMFPTLSVKDGRIEFNFGDSPFVYPPSDSETWIPVCQANEITEVPNKHIGWKLNAYDATKLIDISAEGLMAQSQMNAEWQGSRCNKGVKGRGKYYYEVSPLESGGLARVGWSTEAGSLDLGTDKCGFGYGADPDGFGLSGNQGKKMFNNDIENYGKSFNKGDVIGCFLDLDEGKVQWSLNGEIYAPAYDIP---LELRNGPSAFFPAVSLKNNTAEFNLGEKAFKFYPGNEWTPLTYTPEQFLKESRRKGPERKVKGWSYLNTDENEIVKISVS--SPHDTI-NENSVHSVTXXXXXXXXXXXXR----------------------------LSRITNDKEPELSYEPGYINKTGTRTVTNGEVTE----ILTGEPNIETESYIDEHGNLVXXXXXXXXXXXXXXXXMSELVTERSENDVETTRTGKLSRISQNDF--EDMDDEMLRKAILDVISMDSNASVL 3324
            S N   +   Q   L++G IE    +PK +YY SLR     +G + S +    N        TL + Y   K ++ L+  +KPSGK+  C V MLDGTEE + ID ASFGQHLFD +CD L+LNER+YFGI Y D+  +I FWL   KKI+  +  N+ VF+FQVKFYPP +    EDLT+Y+  LQVRQD+V G LP SF ++ +L ++ +QSEAGD+DP  H+GIEY++  P AP+  QT + + ++  LHK    QTPEEAD+ FL NA KL +YG+DMHKVKN + EE+ +GVY+ GI++YR ++R+IR SW ++++++YK K   + +R    N  +++L FKC   KL K+ +KA V+HH FFRM++   P+KP L PGF TRKY   P+S SP+       +       R P PK++R+   RKE+      T  S +G A                N+    ++++   N I        ERP L   +W+MS  D T  +G+D  GLDVA   G+GWQG R+NKGVK PG+Y+YE +V+EDGL+RLGW+TNDASL +GSD+ G+GYG  + G   G   + C    +K   YG  +  GD +GC ++ +NG++ W KNG +    +KIP++L+ E  FP  S+KDGR+ FNFGD P  + P     W+PV QANE   VPNK+IGW++N +DAT   D+S  G   QS++N EW G R NKGV   GKYYYEV PLE G LARVGW+T+ GSL+LG+D  GFGYGAD DGFGL GNQGKKM + +I+NYG  F KGDVIGCFLDLD   V+WS NG++Y   Y +P   +ELR    AF+P  SL NNT +FN G K F+FYPG+EW PL Y      ++++++ P    K ++    D  EI + +      +D +  E  ++S+       +     R                            L  +   ++ E+        +    T    E  E    +  G+P I TE+Y+DE G  V  T T  K   KT   ++    ER+E+++ T++  KL  I    +  +D DDE L KAIL V   + N  VL
Sbjct:    3 SNNLTLDKKVQRRELDNGQIEEIHVIPKSEYYASLR-----MGSTTSALRNSGNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSGILIYRGRIRIIRHSWPKIVKLTYKHKSFYLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYL-YPSSPSPSLFNNNNQSAPNIILGR-PQPKVRRMQTQRKEKE-----TPLSPSGIA-------------PCANNDEIFSLEESLDNAI--------ERPELLEEYWQMSIDDSTPEMGIDPLGLDVAGNKGSGWQGSRANKGVKGPGKYYYEGKVVEDGLIRLGWATNDASLDLGSDKEGFGYGDSQAGDKNGGFKRNC----NKENGYGQPIKEGDLIGCFLDFDNGNIQWSKNGATFEPAFKIPDELKDEAFFPASSIKDGRVIFNFGDEPLSFLPK--RDWLPVSQANENNVVPNKNIGWRMNPFDATTGTDVSGNGYTLQSKLNGEWNGCRANKGVFDCGKYYYEVIPLEDG-LARVGWATDDGSLNLGSDGSGFGYGADNDGFGLKGNQGKKMNSGEIDNYGDPFMKGDVIGCFLDLDNKYVKWSKNGQVYKEGYVLPDDLVELR----AFYPTASLINNTLDFNFGNKPFEFYPGSEWNPLCYAAHGNTEKTKKRDPSLYSKPFTDREEDVLEIRRQAREKFKRNDQLEEERKLNSIKEKERIEKQEKERRILLQKERDEEERRRKELEREEYERRQKELEELERQRQREIEIRQNEERQRLLNTKEKQETEESYQIVEKGDPEITTETYVDELGRTV--TRTVKKTKIKTTTNLNRNTIERTEDEINTSKVAKLRGIGIVSYYEDDDDDEELIKAILSVTKFNQNVRVL 1064          
BLAST of Band 4.1 protein 2 vs. Planmine SMEST
Match: SMESG000029732.1 (SMESG000029732.1)

HSP 1 Score: 247.669 bits (631), Expect = 3.540e-67
Identity = 121/319 (37.93%), Postives = 196/319 (61.44%), Query Frame = 1
Query:  313 NAGFGTMTGTLRSGYNAKSQSILDFKPSGKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISY-KDRCKIMFWLDFTKKITKHVPD-NRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHR-GIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIE 1260
            N  + +   TL     +KS   L         +  +I+LDG E  F +D+   G++LFD VC +L+L E+++FG++Y   + +  FWL+  KKI+K +   +   F FQVKFYPPE  ++ ED+TRY LSLQVRQD+  GKLPCS+    +L S+++QSE GD+D   H  GI+Y++         Q+   +EK+  LHK H G +P++AD  +L+ A++L  YG+D+H  ++++  EI++GV Y G+++YR ++R+ RF+W +++++SYKK    + +R    +D+   + FK  +  L K+ +K  V+ H FFRM E
Sbjct:  236 NPAYDSQPATLERKKISKSAKHLSSN------KAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLN--QSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKE 546          
BLAST of Band 4.1 protein 2 vs. Planmine SMEST
Match: SMESG000038155.1 (SMESG000038155.1)

HSP 1 Score: 176.022 bits (445), Expect = 3.734e-44
Identity = 88/279 (31.54%), Postives = 156/279 (55.91%), Query Frame = 1
Query:  418 VIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNR-LVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFR 1251
            V +LD + + F +   + GQHL++ V   L+L E +YF + Y ++  +  WLD  K++ K     +  +F+F +KFY P  +M+ ++ TRY  +LQ+++D+  G L C+     +L +++ QSE GD+    +    Y+ S  L  Q    ++F+ KV+  H+   GQ+P EAD N LD ARK+  YG+ +H  ++ E   + L V + GIV+++ ++++  FSWA++ ++S+K+K+  I +        K  + F        K  +K  ++HH FFR
Sbjct:   21 VTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQA--NEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFR 297          
BLAST of Band 4.1 protein 2 vs. Planmine SMEST
Match: SMESG000038155.1 (SMESG000038155.1)

HSP 1 Score: 175.637 bits (444), Expect = 4.871e-44
Identity = 88/279 (31.54%), Postives = 156/279 (55.91%), Query Frame = 1
Query:  418 VIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNR-LVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFR 1251
            V +LD + + F +   + GQHL++ V   L+L E +YF + Y ++  +  WLD  K++ K     +  +F+F +KFY P  +M+ ++ TRY  +LQ+++D+  G L C+     +L +++ QSE GD+    +    Y+ S  L  Q    ++F+ KV+  H+   GQ+P EAD N LD ARK+  YG+ +H  ++ E   + L V + GIV+++ ++++  FSWA++ ++S+K+K+  I +        K  + F        K  +K  ++HH FFR
Sbjct:   21 VTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQA--NEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFR 297          
The following BLAST results are available for this feature:
BLAST of Band 4.1 protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPB41L32.391e-8042.73erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
EPB41L36.249e-7942.73erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
EPB41L32.675e-7842.77erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
EPB41L33.472e-7842.77erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
EPB41L35.903e-7842.77erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frm-13.993e-4833.45FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-13.993e-4833.45FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-31.758e-4635.14FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-12.949e-4633.33FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-13.212e-4633.33FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cora4.030e-7339.64gene:FBgn0010434 transcript:FBtr0301279[more]
cora5.490e-7339.64gene:FBgn0010434 transcript:FBtr0086506[more]
cora5.616e-7239.64gene:FBgn0010434 transcript:FBtr0086508[more]
cora2.379e-7039.64gene:FBgn0010434 transcript:FBtr0340468[more]
cora2.797e-7039.64gene:FBgn0010434 transcript:FBtr0340469[more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPB41L27.314e-7943.00si:ch73-18b11.1 [Source:ZFIN;Acc:ZDB-GENE-070912-3... [more]
si:dkey-178k16.14.419e-7741.10si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
epb41l3a3.415e-7542.52erythrocyte membrane protein band 4.1-like 3a [Sou... [more]
epb41l3a3.415e-7542.52erythrocyte membrane protein band 4.1-like 3a [Sou... [more]
si:dkey-178k16.13.764e-7440.66si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcx2.245e-7842.47doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
dcx3.303e-7842.47doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
dcx4.146e-7842.47doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
dcx4.147e-7842.47doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
dcx6.093e-7743.37doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Epb41l34.065e-7843.37erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
Epb41l34.878e-7843.37erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
Epb41l31.095e-7743.37erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
Epb41l31.433e-7743.37erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
Epb41l31.717e-7743.37erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
back to top
BLAST of Band 4.1 protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WV92|E41L3_MOUSE1.201e-7643.37Band 4.1-like protein 3 OS=Mus musculus OX=10090 G... [more]
sp|Q9Y2J2|E41L3_HUMAN1.780e-7643.67Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9N179|41_BOVIN2.109e-7541.98Protein 4.1 OS=Bos taurus OX=9913 GN=EPB41 PE=2 SV... [more]
sp|P11171|41_HUMAN3.329e-7441.31Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 ... [more]
sp|P48193|41_MOUSE6.467e-7441.98Protein 4.1 OS=Mus musculus OX=10090 GN=Epb41 PE=1... [more]
back to top
BLAST of Band 4.1 protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V6RH180.000e+047.28Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LVR10.000e+047.07Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZAF20.000e+046.37Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A4E0RQ540.000e+045.70Band 4.1 protein 2 OS=Fasciola hepatica OX=6192 GN... [more]
A0A5K4F8W60.000e+046.83Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41a1.563e-7539.53erythrocyte membrane protein band 4.1a [Source:ZFI... [more]
epb41l3a1.308e-7441.58protein 4.1 [Source:NCBI gene;Acc:103040375][more]
epb41a1.403e-7439.53erythrocyte membrane protein band 4.1a [Source:ZFI... [more]
epb41a1.552e-7439.53erythrocyte membrane protein band 4.1a [Source:ZFI... [more]
epb41a1.944e-7439.53erythrocyte membrane protein band 4.1a [Source:ZFI... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001599.12.867e-5545.73pep scaffold:Pmarinus_7.0:GL478896:2253:11647:-1 g... [more]
EPB41L23.505e-5136.82erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
ENSPMAT00000001312.11.099e-4833.91pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 ... [more]
epb41l51.321e-4735.15erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l52.889e-4735.42erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO361308.638e-6540.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302244.708e-5937.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343911.240e-4934.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448233.104e-4833.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336262.128e-4434.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l3b7.566e-8143.23erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
epb41l3b7.827e-8143.23erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
epb41l3b8.908e-8143.23erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
epb41l3b1.254e-8043.48erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
epb41l3b1.615e-8043.23erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019493.10.000e+099.82SMESG000019493.1[more]
SMESG000062476.10.000e+042.15SMESG000062476.1[more]
SMESG000029732.13.540e-6737.93SMESG000029732.1[more]
SMESG000038155.13.734e-4431.54SMESG000038155.1[more]
SMESG000038155.14.871e-4431.54SMESG000038155.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028738 ID=SMED30028738|Name=Band 4.1 protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3746bp
GTTATTTCATTGGTTGCTGTCGTAGAGCCTCAATTTTTTCATTCCTAACA
TTTTAACGATTTATTCAGTTTTGAGCACAATTCTTTAAGGATTATAATGT
ATCAAGACGATTATCATAATTCATACAACTCTGATGCAGATACCACTCAT
GGTTCGATAAATTTTCATACAGAATCAACTAGCCAAGTTAATAGATTGGA
AGATGGTACAATCGAAATCACAGACACTTTGCCAAAAAAGGACTATTACA
TGAGTTTAAGAAAAAGCGATAACAGGTTAGGTGGAAGTATGAGTAGAATT
GGTGGTGGTTCAAATGCTGGTTTTGGTACAATGACAGGGACATTAAGATC
TGGATATAATGCAAAATCTCAGAGCATTTTGGATTTTAAACCTTCAGGAA
AATTAATGGAATGTTTAGTTATCATGCTTGATGGAACAGAAGAAGTGTTT
ACTATAGACAGAGCGTCTTTTGGACAACATTTGTTTGACGCTGTTTGTGA
TCACTTAGAATTAAATGAACGCGAATATTTTGGAATTTCTTATAAAGATA
GATGTAAAATTATGTTTTGGTTGGATTTCACTAAGAAAATCACAAAACAT
GTGCCAGACAATCGATTAGTATTTGAATTCCAGGTGAAATTCTACCCACC
GGAAATCTCAATGGTAGTGGAAGATCTCACGAGATATTATCTCAGTTTAC
AAGTCAGGCAAGATCTAGTATGTGGAAAATTACCATGTTCATTTTACGTT
TACACTATTTTGGCATCATATGTAATACAATCTGAAGCCGGAGATTACGA
CCCACAAGCCCATCGTGGAATTGAATACATTAAATCTCAACCGTTAGCTC
CTCAGAAATTTCAAACCCAAGATTTCATGGAGAAAGTCGTGGCCTTACAT
AAATTACACAGAGGACAAACTCCTGAAGAAGCCGATAAAAACTTCTTGGA
TAATGCAAGAAAATTGGCACTTTACGGATTGGATATGCATAAAGTTAAAA
ATTCGGAAGGAGAAGAAATCATGTTGGGAGTCTATTATGGCGGTATTGTT
CTTTACAGACAAAAAGTTCGAGTCATTCGATTTTCATGGGCTCGTTTAAT
TCAAGTTAGTTATAAGAAGAAGAAATTAATTATTACGGTTCGAGGAGTCA
ATAAAAATGACAACAAAAAGGAATTAACATTCAAATGTACAGATTTAAAA
TTGACGAAAAAAGCATATAAAGCTGTGGTTGACCATCACTACTTTTTCCG
GATGATAGAATTCGGAATTCCTAAAAAGCCAAATCTTCAACCTGGTTTCC
ACACTAGAAAATATTACAAGACACCAACCTCTGCTTCTCCAACTGCTGGC
GGAGAATTTACTTACGATCGTAACCCTGCTCCAAAAATCAAACGGCTTCC
ACCACCTAGAAAAGAACAAACAGATGATGGTTGGTACACATTGCCTTCTA
AAAACGGTACCGCTTATAAAAAAGGAGTAGTTCTTAATAATTCTTCAATC
GAAAGTAATGAAAATCACTCTACCCAATTGAATATTCAAAAACCTAATCA
AAATAAAATTTCAAAGACTCCACTTACTGATACTGAACGTCCTACGCTAC
CGAATCTTCATTGGCGGATGTCACCTGCTGATTGTACACTAAGTCTAGGA
ATGGATGACAAAGGATTAGATGTGGCTTCTCAGCCAGGAACTGGTTGGCA
GGGATGCCGATCAAATAAAGGTGTAAAAACACCAGGTGAATACTTTTATG
AAGCAAGGGTACTGGAAGATGGTCTTGTTAGGCTTGGTTGGTCAACTAAT
GATGCAAGTTTGAAAGTTGGTTCCGATGAAAATGGATATGGCTATGGAGC
TGATGAAGTTGGTAGAGGTTGGGGTGAAAATGTTAAAGGTTGCACAATGC
ACGATAGTAAGATCAAAGACTACGGATCTGGACTTTTTATGGGTGACTAT
GTCGGATGCCGTGTGAATTTGAATAATGGTGATGTTGTTTGGTATAAAAA
CGGCGAATCAATGGGTGTTGGTTACAAAATACCTGAACAATTAAGAAAGG
AGCCAATGTTTCCTACTCTAAGTGTTAAAGATGGTCGTATTGAATTTAAT
TTTGGCGATTCTCCATTTGTTTACCCGCCATCAGATTCTGAAACATGGAT
TCCAGTTTGTCAGGCCAACGAGATAACTGAAGTTCCCAATAAACATATTG
GCTGGAAATTAAATGCTTATGATGCAACGAAATTGATAGATATTTCTGCC
GAAGGGTTAATGGCTCAATCTCAAATGAATGCTGAATGGCAAGGATCAAG
ATGCAATAAAGGTGTTAAAGGCCGTGGAAAATATTATTACGAAGTAAGTC
CATTGGAGTCTGGCGGATTAGCTAGAGTCGGTTGGTCAACTGAAGCTGGC
AGTTTAGATTTGGGCACTGATAAATGTGGTTTCGGATACGGAGCTGATCC
CGATGGTTTTGGTTTGAGTGGAAATCAAGGGAAGAAAATGTTTAATAACG
ACATAGAAAATTACGGAAAGTCTTTCAATAAGGGAGATGTTATTGGTTGT
TTCCTTGATTTGGATGAAGGCAAAGTACAGTGGTCATTAAATGGTGAGAT
TTATGCTCCGGCTTATGATATTCCTTTGGAATTACGAAATGGGCCGTCAG
CATTTTTTCCAGCAGTCTCGTTGAAAAATAACACTGCAGAATTCAATTTG
GGGGAAAAGGCTTTCAAATTCTATCCAGGGAACGAATGGACACCCCTTAC
ATACACTCCAGAACAATTTCTGAAGGAATCTCGACGCAAGGGACCAGAAA
GAAAGGTTAAAGGATGGTCTTATTTAAATACCGATGAAAATGAAATTGTC
AAAATTTCTGTTTCATCGCCGCATGATACAATCAATGAGAACTCTGTACA
CAGTGTTACTAATGCTAATAATCCAATCGAAAACAATCCTAATCCACGAT
TATCACGCATTACCAATGATAAAGAACCCGAACTGTCATATGAACCCGGC
TATATCAATAAAACTGGCACACGTACTGTTACAAATGGAGAAGTGACGGA
AATTCTGACTGGTGAACCAAATATTGAAACGGAGTCGTATATAGACGAGC
ATGGTAATCTAGTTAAAAAAACAATTACTCGCACAAAGAAAACTACAAAA
ACCGTTAAAACAATGAGTGAACTTGTGACAGAAAGATCAGAAAATGATGT
CGAAACAACAAGAACCGGAAAATTATCTCGAATTAGTCAAAATGATTTTG
AAGATATGGATGATGAAATGCTGAGAAAAGCAATTCTCGATGTTATTAGT
ATGGACAGCAATGCATCAGTTCTCAATATATATGTCGGTCCTCTCGAATT
TGTTGCTAAAGAAAGCAGTCCACCACAAGTGTTAGAAAGCGAGATCTAGA
AACACGTCTTGTCAGTCAAAACCGGTTTATTATTTATCTAAGTCTCCAGA
GACAAATCTATTTCTTGCATTGAATTTTGAAAACATTGTTTTGTTGTGGT
TTACATTTGATCTATTTTCTCACAAATTAATTGAAATTTTGCAATTATTT
AGTTATTACTAATAATAATTATATTATGTGGTTGTCATTTTTGACTTTTT
GTTCGAGGATTGTTTTAATTCTTCATTGATTTGTTTGAGTTCGACTTCTT
TACATAACAAATTGATTGTGATTGATTCTTGATTGTAATTAATATTGAGA
TTATGTAGATATATTACGGTGAATGTCAAGTGGAAATTGATTCGAT
back to top

protein sequence of SMED30028738-orf-1

>SMED30028738-orf-1 ID=SMED30028738-orf-1|Name=SMED30028738-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1101bp
MYQDDYHNSYNSDADTTHGSINFHTESTSQVNRLEDGTIEITDTLPKKDY
YMSLRKSDNRLGGSMSRIGGGSNAGFGTMTGTLRSGYNAKSQSILDFKPS
GKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYK
DRCKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLS
LQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPL
APQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKV
KNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRG
VNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPG
FHTRKYYKTPTSASPTAGGEFTYDRNPAPKIKRLPPPRKEQTDDGWYTLP
SKNGTAYKKGVVLNNSSIESNENHSTQLNIQKPNQNKISKTPLTDTERPT
LPNLHWRMSPADCTLSLGMDDKGLDVASQPGTGWQGCRSNKGVKTPGEYF
YEARVLEDGLVRLGWSTNDASLKVGSDENGYGYGADEVGRGWGENVKGCT
MHDSKIKDYGSGLFMGDYVGCRVNLNNGDVVWYKNGESMGVGYKIPEQLR
KEPMFPTLSVKDGRIEFNFGDSPFVYPPSDSETWIPVCQANEITEVPNKH
IGWKLNAYDATKLIDISAEGLMAQSQMNAEWQGSRCNKGVKGRGKYYYEV
SPLESGGLARVGWSTEAGSLDLGTDKCGFGYGADPDGFGLSGNQGKKMFN
NDIENYGKSFNKGDVIGCFLDLDEGKVQWSLNGEIYAPAYDIPLELRNGP
SAFFPAVSLKNNTAEFNLGEKAFKFYPGNEWTPLTYTPEQFLKESRRKGP
ERKVKGWSYLNTDENEIVKISVSSPHDTINENSVHSVTNANNPIENNPNP
RLSRITNDKEPELSYEPGYINKTGTRTVTNGEVTEILTGEPNIETESYID
EHGNLVKKTITRTKKTTKTVKTMSELVTERSENDVETTRTGKLSRISQND
FEDMDDEMLRKAILDVISMDSNASVLNIYVGPLEFVAKESSPPQVLESEI
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001870B30.2/SPRY
IPR000299FERM_domain
IPR013320ConA-like_dom_sf
IPR029071Ubiquitin-like_domsf
IPR019749Band_41_domain
IPR000798Ez/rad/moesin-like
IPR018980FERM_PH-like_C
IPR003877SPRY_dom
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR019748FERM_central
IPR018979FERM_N
IPR011993PH-like_dom_sf
IPR019747FERM_CS
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0019898extrinsic component of membrane
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0008092cytoskeletal protein binding
GO:0005515protein binding