Tubby-like protein

Overview
NameTubby-like protein
Smed IDSMED30028737
Length (bp)1712
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubby-like protein (SMED30028737) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubby-like protein (SMED30028737) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubby-like protein (SMED30028737) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubby-like protein (SMED30028737) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028737

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30028737h1SMcG0003527 SmedASXL_014618SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30028737h1SMcG0003527 Contig52992uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028737h1SMcG0003527 Contig52992newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30028737h1SMcG0003527 dd_Smed_v4_10462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30028737h1SMcG0003527 dd_Smed_v4_10462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028737h1SMcG0003527 dd_Smed_v4_10462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028737h1SMcG0003527 dd_Smed_v4_10462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028737h1SMcG0003527 dd_Smed_v4_10462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028737h1SMcG0003527 dd_Smed_v4_10462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30028737h1SMcG0003527 dd_Smed_v4_10462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30028737h1SMcG0003527 dd_Smed_v6_10462_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubby-like protein vs. Ensembl Human
Match: TUB (TUB bipartite transcription factor [Source:HGNC Symbol;Acc:HGNC:12406])

HSP 1 Score: 345.51 bits (885), Expect = 3.753e-112
Identity = 154/267 (57.68%), Postives = 203/267 (76.03%), Query Frame = 1
Query:  787 PEHILDSNLE-IESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSS---NKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            PE  +D  ++ +E F  +PAPQ   +KCRITRDK GMD+GMYPTY+LHL+R++ K +FLLA R+RK  KTSNYLIS D TD+ + G  Y+ KLR+N +GT+F++YDNG  P+  +SS   +  LR ELAA+ +ETNVLGFKGPRKM++I+PGM  +   +  +P+   + LL   + +  ++++EL NK PVWN+D+QSYVLNFHGRVTQASVKNFQI+H ND +YI+MQFGR ++  FTMD+ YPL A+QAF IALSSFD KLACE
Sbjct:  246 PEQPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 512          
BLAST of Tubby-like protein vs. Ensembl Human
Match: TUB (TUB bipartite transcription factor [Source:HGNC Symbol;Acc:HGNC:12406])

HSP 1 Score: 344.739 bits (883), Expect = 5.424e-112
Identity = 154/267 (57.68%), Postives = 203/267 (76.03%), Query Frame = 1
Query:  787 PEHILDSNLE-IESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSS---NKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            PE  +D  ++ +E F  +PAPQ   +KCRITRDK GMD+GMYPTY+LHL+R++ K +FLLA R+RK  KTSNYLIS D TD+ + G  Y+ KLR+N +GT+F++YDNG  P+  +SS   +  LR ELAA+ +ETNVLGFKGPRKM++I+PGM  +   +  +P+   + LL   + +  ++++EL NK PVWN+D+QSYVLNFHGRVTQASVKNFQI+H ND +YI+MQFGR ++  FTMD+ YPL A+QAF IALSSFD KLACE
Sbjct:  240 PEQPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 506          
BLAST of Tubby-like protein vs. Ensembl Human
Match: TUB (TUB bipartite transcription factor [Source:HGNC Symbol;Acc:HGNC:12406])

HSP 1 Score: 343.199 bits (879), Expect = 1.216e-110
Identity = 163/305 (53.44%), Postives = 216/305 (70.82%), Query Frame = 1
Query:  673 NVAVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLE-IESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSS---NKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            N    P +ATS++S      +  S P   A        PE  +D  ++ +E F  +PAPQ   +KCRITRDK GMD+GMYPTY+LHL+R++ K +FLLA R+RK  KTSNYLIS D TD+ + G  Y+ KLR+N +GT+F++YDNG  P+  +SS   +  LR ELAA+ +ETNVLGFKGPRKM++I+PGM  +   +  +P+   + LL   + +  ++++EL NK PVWN+D+QSYVLNFHGRVTQASVKNFQI+H ND +YI+MQFGR ++  FTMD+ YPL A+QAF IALSSFD KLACE
Sbjct:  269 NSNTRPSSATSRKS----VREAASAPSPTA--------PEQPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 561          
BLAST of Tubby-like protein vs. Ensembl Human
Match: TULP3 (TUB like protein 3 [Source:HGNC Symbol;Acc:HGNC:12425])

HSP 1 Score: 331.643 bits (849), Expect = 1.067e-107
Identity = 154/258 (59.69%), Postives = 194/258 (75.19%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEP----VNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E FV  PAPQ   V+CRI RDK GMD+G++PTYY++LE++  + +FLLAAR+RK  KT+NYLIS D  D+ + G  Y+ KLR+N +GT+F++YD G  P      V +++   R ELAAI +ETNVLGFKGPRKM++IIPGMT     I +QP+   D LL   + R ++NL+ELHNK PVWN D+QSYVLNF GRVTQASVKNFQIVH ND +YI+MQFGR +D  FT+D+ YPL AVQAFGI LSSFD KLACE
Sbjct:  187 DLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHT--RQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFDSKLACE 442          
BLAST of Tubby-like protein vs. Ensembl Human
Match: TULP1 (TUB like protein 1 [Source:HGNC Symbol;Acc:HGNC:12423])

HSP 1 Score: 325.094 bits (832), Expect = 1.215e-104
Identity = 147/255 (57.65%), Postives = 195/255 (76.47%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSN-KPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            E   FV +PAPQ   V+CR+TRDK GMD+GMYP+Y+LHL+    K +FLLA R+RK  KT+NYLIS D T++ + G  ++ KLR+N +G +F+++DNGQ P+   S+N   LR ELAA+I+ETNVLGF+GPR+MT+IIPGM+     +  +P+   D LL   + + L++L+ELHNK PVWN+DS SY LNF GRVTQASVKNFQIVH +D +YI++QFGR ++ +FT+D+ YPL A+QAF IALSSFDGKLACE
Sbjct:  237 EPREFVLRPAPQGRTVRCRLTRDKKGMDRGMYPSYFLHLD--TEKKVFLLAGRKRKRSKTANYLISIDPTNLSRGGENFIGKLRSNLLGNRFTVFDNGQNPQRGYSTNVASLRQELAAVIYETNVLGFRGPRRMTVIIPGMSAENERVPIRPRNASDGLLVRWQNKTLESLIELHNKPPVWNDDSGSYTLNFQGRVTQASVKNFQIVHADDPDYIVLQFGRVAEDAFTLDYRYPLCALQAFAIALSSFDGKLACE 489          
BLAST of Tubby-like protein vs. Ensembl Celegans
Match: tub-1 (Tubby protein homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09306])

HSP 1 Score: 319.316 bits (817), Expect = 1.380e-103
Identity = 164/309 (53.07%), Postives = 216/309 (69.90%), Query Frame = 1
Query:  679 AVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNA---KPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTP-------MKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            A SP+N     +DV +    D IP ++  + NF       + +NL    FV  PA + C+ KC ITR KSG+DKGM+PTY+LHLE  +    + +FLLAAR+RK   T+NYL+S D T++ + G GY AK+R+N +GTQF++YD+GQ P+   +++  +R ELAA+I+ETNVLGFKGPRKMTI++PG+ P       ++ P+  +P   +  LLE  R   LD+L  L NK P WN+++QSYVLNFHGRVTQASVKNFQI+H +  EYI+MQFGR SD  FTMDF YPLSAVQAFGIA++SF GKLACE
Sbjct:  139 ADSPWN-----TDVVA----DRIPSEVLPDYNF-------IKNNLA--KFVEDPAVEHCLYKCSITRQKSGVDKGMFPTYFLHLEEFDTDKRQKIFLLAARKRKKSTTANYLLSTDPTNLSREGEGYCAKVRSNALGTQFTVYDSGQNPKKT-TNHAAIRQELAAVIYETNVLGFKGPRKMTIVMPGIEPPTENRPAVRCPV--RPIQDKHTLLERYRLNDLDSLKILSNKSPQWNDETQSYVLNFHGRVTQASVKNFQIIHQSSPEYIVMQFGRISDDEFTMDFRYPLSAVQAFGIAMTSFHGKLACE 426          
BLAST of Tubby-like protein vs. Ensembl Celegans
Match: tub-2 (TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53])

HSP 1 Score: 70.4774 bits (171), Expect = 6.168e-13
Identity = 33/63 (52.38%), Postives = 41/63 (65.08%), Query Frame = 1
Query: 1330 LHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLS 1518
            + NK P WNE +Q Y L+F GRVTQ S KNFQI  D+     ++QFGR    S+T+DF YP S
Sbjct:  253 MTNKTPFWNEQNQVYQLDFGGRVTQESAKNFQIELDSKQ---VLQFGRIEGGSYTLDFRYPFS 312          
BLAST of Tubby-like protein vs. Ensembl Celegans
Match: tub-2 (TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53])

HSP 1 Score: 69.3218 bits (168), Expect = 4.787e-12
Identity = 33/63 (52.38%), Postives = 41/63 (65.08%), Query Frame = 1
Query: 1330 LHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLS 1518
            + NK P WNE +Q Y L+F GRVTQ S KNFQI  D+     ++QFGR    S+T+DF YP S
Sbjct:  793 MTNKTPFWNEQNQVYQLDFGGRVTQESAKNFQIELDSKQ---VLQFGRIEGGSYTLDFRYPFS 852          
BLAST of Tubby-like protein vs. Ensembl Fly
Match: ktub (gene:FBgn0015721 transcript:FBtr0089600)

HSP 1 Score: 329.331 bits (843), Expect = 7.018e-107
Identity = 150/256 (58.59%), Postives = 194/256 (75.78%), Query Frame = 1
Query:  817 IESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQ---PKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            I+ FV +PAPQ  + KCRITRD+ GMD+G++P YYLHLER   K +FLL  R+RK  KTSNY++SCD TD+ +N  G+  KLR+N  GT F+++DNG K     S+  P R +LA II++TN+LGFKGPR MT+I+PGMT     +      PK  +  +L+  + + +DN++ELHNK PVWN+++QSYVLNFHGRVTQASVKNFQ+VHD+D EYI+MQFGRTS+  FTMD+ YPL A+QAF IALSSFDGK+ACE
Sbjct:  212 IDQFVMQPAPQGVLYKCRITRDRKGMDRGLFPIYYLHLERDYGKKIFLLGGRKRKKSKTSNYIVSCDPTDLSRNADGFCGKLRSNVFGTSFTVFDNGNK----ESTESP-RLDLAVIIYDTNILGFKGPRNMTVILPGMTEDDQRVKISSADPK--QQGILDLWKMKNMDNIVELHNKTPVWNDETQSYVLNFHGRVTQASVKNFQLVHDSDPEYIVMQFGRTSEDVFTMDYRYPLCAMQAFAIALSSFDGKIACE 460          
BLAST of Tubby-like protein vs. Ensembl Fly
Match: ktub (gene:FBgn0015721 transcript:FBtr0342842)

HSP 1 Score: 328.946 bits (842), Expect = 1.374e-106
Identity = 150/256 (58.59%), Postives = 194/256 (75.78%), Query Frame = 1
Query:  817 IESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQ---PKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            I+ FV +PAPQ  + KCRITRD+ GMD+G++P YYLHLER   K +FLL  R+RK  KTSNY++SCD TD+ +N  G+  KLR+N  GT F+++DNG K     S+  P R +LA II++TN+LGFKGPR MT+I+PGMT     +      PK  +  +L+  + + +DN++ELHNK PVWN+++QSYVLNFHGRVTQASVKNFQ+VHD+D EYI+MQFGRTS+  FTMD+ YPL A+QAF IALSSFDGK+ACE
Sbjct:  221 IDQFVMQPAPQGVLYKCRITRDRKGMDRGLFPIYYLHLERDYGKKIFLLGGRKRKKSKTSNYIVSCDPTDLSRNADGFCGKLRSNVFGTSFTVFDNGNK----ESTESP-RLDLAVIIYDTNILGFKGPRNMTVILPGMTEDDQRVKISSADPK--QQGILDLWKMKNMDNIVELHNKTPVWNDETQSYVLNFHGRVTQASVKNFQLVHDSDPEYIVMQFGRTSEDVFTMDYRYPLCAMQAFAIALSSFDGKIACE 469          
BLAST of Tubby-like protein vs. Ensembl Fly
Match: Tusp (gene:FBgn0039530 transcript:FBtr0335245)

HSP 1 Score: 87.8113 bits (216), Expect = 1.241e-17
Identity = 41/79 (51.90%), Postives = 54/79 (68.35%), Query Frame = 1
Query: 1330 LHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKL 1566
            +HNK P+WNE SQ Y L+F GRVTQ S KNFQI         +MQFGR   +++T+DF YP SA+QAF +AL++   +L
Sbjct: 1357 MHNKAPMWNEMSQVYQLDFGGRVTQESAKNFQIEFRGKQ---VMQFGRIDGNAYTLDFQYPFSALQAFAVALANVTQRL 1432          
BLAST of Tubby-like protein vs. Ensembl Fly
Match: Tusp (gene:FBgn0039530 transcript:FBtr0302589)

HSP 1 Score: 87.8113 bits (216), Expect = 1.252e-17
Identity = 41/79 (51.90%), Postives = 54/79 (68.35%), Query Frame = 1
Query: 1330 LHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKL 1566
            +HNK P+WNE SQ Y L+F GRVTQ S KNFQI         +MQFGR   +++T+DF YP SA+QAF +AL++   +L
Sbjct: 1356 MHNKAPMWNEMSQVYQLDFGGRVTQESAKNFQIEFRGKQ---VMQFGRIDGNAYTLDFQYPFSALQAFAVALANVTQRL 1431          
BLAST of Tubby-like protein vs. Ensembl Fly
Match: Tusp (gene:FBgn0039530 transcript:FBtr0302590)

HSP 1 Score: 87.8113 bits (216), Expect = 1.252e-17
Identity = 41/79 (51.90%), Postives = 54/79 (68.35%), Query Frame = 1
Query: 1330 LHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKL 1566
            +HNK P+WNE SQ Y L+F GRVTQ S KNFQI         +MQFGR   +++T+DF YP SA+QAF +AL++   +L
Sbjct: 1356 MHNKAPMWNEMSQVYQLDFGGRVTQESAKNFQIEFRGKQ---VMQFGRIDGNAYTLDFQYPFSALQAFAVALANVTQRL 1431          
BLAST of Tubby-like protein vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 343.969 bits (881), Expect = 1.477e-113
Identity = 155/256 (60.55%), Postives = 197/256 (76.95%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKP--LRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E F  +PAPQ   VKCRITRDK GMD+GMYPTYYLHLER++ K +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YD+G  P    SS +   LR ELAAI +ETNVLGFKGPRKM++IIPGM      +  +P+   + LL   + +  ++++ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQI+HDND +YI+MQFGR ++  FTMD+ YP+ A+QAF IALSSFD KLACE
Sbjct:  128 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 383          
BLAST of Tubby-like protein vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 345.51 bits (885), Expect = 1.615e-113
Identity = 168/303 (55.45%), Postives = 216/303 (71.29%), Query Frame = 1
Query:  673 NVAVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKP--LRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            N    P +ATSK+S    S +  S    +A+E      P   +D   ++E F  +PAPQ   VKCRITRDK GMD+GMYPTYYLHLER++ K +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YD+G  P    SS +   LR ELAAI +ETNVLGFKGPRKM++IIPGM      +  +P+   + LL   + +  ++++ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQI+HDND +YI+MQFGR ++  FTMD+ YP+ A+QAF IALSSFD KLACE
Sbjct:  143 NSNTRPGSATSKKS----SKEATSASTPLANE------PSIDVD---DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 432          
BLAST of Tubby-like protein vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 342.813 bits (878), Expect = 1.643e-113
Identity = 155/256 (60.55%), Postives = 197/256 (76.95%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKP--LRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E F  +PAPQ   VKCRITRDK GMD+GMYPTYYLHLER++ K +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YD+G  P    SS +   LR ELAAI +ETNVLGFKGPRKM++IIPGM      +  +P+   + LL   + +  ++++ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQI+HDND +YI+MQFGR ++  FTMD+ YP+ A+QAF IALSSFD KLACE
Sbjct:  103 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 358          
BLAST of Tubby-like protein vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 347.051 bits (889), Expect = 2.196e-113
Identity = 168/303 (55.45%), Postives = 216/303 (71.29%), Query Frame = 1
Query:  673 NVAVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKP--LRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            N    P +ATSK+S    S +  S    +A+E      P   +D   ++E F  +PAPQ   VKCRITRDK GMD+GMYPTYYLHLER++ K +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YD+G  P    SS +   LR ELAAI +ETNVLGFKGPRKM++IIPGM      +  +P+   + LL   + +  ++++ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQI+HDND +YI+MQFGR ++  FTMD+ YP+ A+QAF IALSSFD KLACE
Sbjct:  188 NSNTRPGSATSKKS----SKEATSASTPLANE------PSIDVD---DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 477          
BLAST of Tubby-like protein vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 347.436 bits (890), Expect = 2.959e-113
Identity = 168/303 (55.45%), Postives = 216/303 (71.29%), Query Frame = 1
Query:  673 NVAVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKP--LRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            N    P +ATSK+S    S +  S    +A+E      P   +D   ++E F  +PAPQ   VKCRITRDK GMD+GMYPTYYLHLER++ K +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YD+G  P    SS +   LR ELAAI +ETNVLGFKGPRKM++IIPGM      +  +P+   + LL   + +  ++++ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQI+HDND +YI+MQFGR ++  FTMD+ YP+ A+QAF IALSSFD KLACE
Sbjct:  214 NSNTRPGSATSKKS----SKEATSASTPLANE------PSIDVD---DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 503          
BLAST of Tubby-like protein vs. Ensembl Xenopus
Match: tulp1 (TUB like protein 1 [Source:NCBI gene;Acc:549236])

HSP 1 Score: 347.051 bits (889), Expect = 7.634e-113
Identity = 152/253 (60.08%), Postives = 198/253 (78.26%), Query Frame = 1
Query:  817 IESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            +E FV +PAPQ   +KC++TRDK GMD+G+YPTYY+HL+  N K +FLLA R+RK  KTSNYLIS DATD+ + G  ++ KLR+N +GT+F+++DNG  P+  NS    +R ELAAI++ETNVLGFKGPRKMT++IPGM      +  +P+   D LL+  + + ++NL++LHNK PVWN+++QSYVLNFHGRVT  SVKNFQIVH +D +YIIMQFGR +D +FTMD+ YP+ AVQAF IALSSFDGKLACE
Sbjct:  262 LEEFVLRPAPQGVTIKCKVTRDKKGMDRGLYPTYYVHLD--NDKKVFLLAGRKRKKSKTSNYLISIDATDLSRGGENFIGKLRSNLMGTKFTVFDNGASPDKANSDWSNVRQELAAIVYETNVLGFKGPRKMTVLIPGMDEDCERVPVRPRNDNDGLLQRWQNKNMENLIQLHNKSPVWNDETQSYVLNFHGRVTHPSVKNFQIVHADDLDYIIMQFGRVADDAFTMDYKYPMCAVQAFAIALSSFDGKLACE 512          
BLAST of Tubby-like protein vs. Ensembl Xenopus
Match: tulp3 (TUB like protein 3 [Source:NCBI gene;Acc:100144732])

HSP 1 Score: 342.428 bits (877), Expect = 3.317e-112
Identity = 161/303 (53.14%), Postives = 216/303 (71.29%), Query Frame = 1
Query:  673 NVAVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNS--SNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            N +  P +A+SK+S +  +G  +++P D          P   +    +++ F  +PAP+  V+K RI+RDK GMD+G+YPTYY+HLER N + +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YDNG+ P  V    SN   R E+AA+ +ETNVLGFKGPRKMT++IPGM      I FQP+   + LL     +  +N++ELHNK PVWN+D+QSYVLNFHGRVT ASVKNFQIVHDND +YI+MQFGR ++  FT+D++YPL A+QAF +ALSSFD KLACE
Sbjct:  132 NASTRPASASSKKS-LTETGTAEAVPPD----------PSGDIGEIGDLKEFALRPAPRGVVIKTRISRDKKGMDRGLYPTYYMHLERDNNRKVFLLAGRKRKRSKTSNYLISIDPTDLSREGGNFIGKLRSNLMGTKFTIYDNGESPAKVQGQMSNPTTRQEMAAVCYETNVLGFKGPRKMTVLIPGMNLNHERIPFQPQNDSESLLSRWGNKCQENIIELHNKAPVWNDDTQSYVLNFHGRVTHASVKNFQIVHDNDPDYIVMQFGRVAEDFFTLDYSYPLCALQAFSVALSSFDSKLACE 423          
BLAST of Tubby-like protein vs. Ensembl Xenopus
Match: tulp3 (TUB like protein 3 [Source:NCBI gene;Acc:100144732])

HSP 1 Score: 344.354 bits (882), Expect = 6.283e-112
Identity = 161/303 (53.14%), Postives = 216/303 (71.29%), Query Frame = 1
Query:  673 NVAVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNS--SNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            N +  P +A+SK+S +  +G  +++P D          P   +    +++ F  +PAP+  V+K RI+RDK GMD+G+YPTYY+HLER N + +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YDNG+ P  V    SN   R E+AA+ +ETNVLGFKGPRKMT++IPGM      I FQP+   + LL     +  +N++ELHNK PVWN+D+QSYVLNFHGRVT ASVKNFQIVHDND +YI+MQFGR ++  FT+D++YPL A+QAF +ALSSFD KLACE
Sbjct:  211 NASTRPASASSKKS-LTETGTAEAVPPD----------PSGDIGEIGDLKEFALRPAPRGVVIKTRISRDKKGMDRGLYPTYYMHLERDNNRKVFLLAGRKRKRSKTSNYLISIDPTDLSREGGNFIGKLRSNLMGTKFTIYDNGESPAKVQGQMSNPTTRQEMAAVCYETNVLGFKGPRKMTVLIPGMNLNHERIPFQPQNDSESLLSRWGNKCQENIIELHNKAPVWNDDTQSYVLNFHGRVTHASVKNFQIVHDNDPDYIVMQFGRVAEDFFTLDYSYPLCALQAFSVALSSFDSKLACE 502          
BLAST of Tubby-like protein vs. Ensembl Xenopus
Match: tulp3 (TUB like protein 3 [Source:NCBI gene;Acc:100144732])

HSP 1 Score: 344.739 bits (883), Expect = 6.600e-112
Identity = 161/303 (53.14%), Postives = 216/303 (71.29%), Query Frame = 1
Query:  673 NVAVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNS--SNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            N +  P +A+SK+S +  +G  +++P D          P   +    +++ F  +PAP+  V+K RI+RDK GMD+G+YPTYY+HLER N + +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YDNG+ P  V    SN   R E+AA+ +ETNVLGFKGPRKMT++IPGM      I FQP+   + LL     +  +N++ELHNK PVWN+D+QSYVLNFHGRVT ASVKNFQIVHDND +YI+MQFGR ++  FT+D++YPL A+QAF +ALSSFD KLACE
Sbjct:  218 NASTRPASASSKKS-LTETGTAEAVPPD----------PSGDIGEIGDLKEFALRPAPRGVVIKTRISRDKKGMDRGLYPTYYMHLERDNNRKVFLLAGRKRKRSKTSNYLISIDPTDLSREGGNFIGKLRSNLMGTKFTIYDNGESPAKVQGQMSNPTTRQEMAAVCYETNVLGFKGPRKMTVLIPGMNLNHERIPFQPQNDSESLLSRWGNKCQENIIELHNKAPVWNDDTQSYVLNFHGRVTHASVKNFQIVHDNDPDYIVMQFGRVAEDFFTLDYSYPLCALQAFSVALSSFDSKLACE 509          
BLAST of Tubby-like protein vs. Ensembl Xenopus
Match: tulp3 (TUB like protein 3 [Source:NCBI gene;Acc:100144732])

HSP 1 Score: 343.199 bits (879), Expect = 2.947e-111
Identity = 161/303 (53.14%), Postives = 216/303 (71.29%), Query Frame = 1
Query:  673 NVAVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNS--SNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            N +  P +A+SK+S +  +G  +++P D          P   +    +++ F  +PAP+  V+K RI+RDK GMD+G+YPTYY+HLER N + +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YDNG+ P  V    SN   R E+AA+ +ETNVLGFKGPRKMT++IPGM      I FQP+   + LL     +  +N++ELHNK PVWN+D+QSYVLNFHGRVT ASVKNFQIVHDND +YI+MQFGR ++  FT+D++YPL A+QAF +ALSSFD KLACE
Sbjct:  226 NASTRPASASSKKS-LTETGTAEAVPPD----------PSGDIGEIGDLKEFALRPAPRGVVIKTRISRDKKGMDRGLYPTYYMHLERDNNRKVFLLAGRKRKRSKTSNYLISIDPTDLSREGGNFIGKLRSNLMGTKFTIYDNGESPAKVQGQMSNPTTRQEMAAVCYETNVLGFKGPRKMTVLIPGMNLNHERIPFQPQNDSESLLSRWGNKCQENIIELHNKAPVWNDDTQSYVLNFHGRVTHASVKNFQIVHDNDPDYIVMQFGRVAEDFFTLDYSYPLCALQAFSVALSSFDSKLACE 517          
BLAST of Tubby-like protein vs. Ensembl Mouse
Match: Tub (tubby bipartite transcription factor [Source:MGI Symbol;Acc:MGI:2651573])

HSP 1 Score: 339.732 bits (870), Expect = 7.078e-111
Identity = 151/257 (58.75%), Postives = 198/257 (77.04%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSS---NKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E F  +PAPQ   +KCRITRDK GMD+GMYPTY+LHL+R++ K +FLLA R+RK  KTSNYLIS D TD+ + G  Y+ KLR+N +GT+F++YDNG  P+  +SS   +  LR ELAA+ +ETNVLGFKGPRKM++I+PGM  +   +  +P+   + LL   + +  ++++EL NK PVWN+D+QSYVLNFHGRVTQASVKNFQI+H ND +YI+MQFGR ++  FTMD+ YPL A+QAF IALSSFD KLACE
Sbjct:  203 DLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVCIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 459          
BLAST of Tubby-like protein vs. Ensembl Mouse
Match: Tub (tubby bipartite transcription factor [Source:MGI Symbol;Acc:MGI:2651573])

HSP 1 Score: 340.117 bits (871), Expect = 2.495e-110
Identity = 151/257 (58.75%), Postives = 198/257 (77.04%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSS---NKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E F  +PAPQ   +KCRITRDK GMD+GMYPTY+LHL+R++ K +FLLA R+RK  KTSNYLIS D TD+ + G  Y+ KLR+N +GT+F++YDNG  P+  +SS   +  LR ELAA+ +ETNVLGFKGPRKM++I+PGM  +   +  +P+   + LL   + +  ++++EL NK PVWN+D+QSYVLNFHGRVTQASVKNFQI+H ND +YI+MQFGR ++  FTMD+ YPL A+QAF IALSSFD KLACE
Sbjct:  249 DLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVCIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 505          
BLAST of Tubby-like protein vs. Ensembl Mouse
Match: Tulp3 (tubby-like protein 3 [Source:MGI Symbol;Acc:MGI:1329045])

HSP 1 Score: 330.102 bits (845), Expect = 5.334e-107
Identity = 149/255 (58.43%), Postives = 190/255 (74.51%), Query Frame = 1
Query:  817 IESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNS--SNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            +E F   PAP+   VKC++TRDK GMD+G++PTYY+HLER+  + +FLLA R+RK  KTSNYL+S D TD+ + G  Y+ KLR+N +GT+F++YD+G  P            R ELAAI +ETNVLGFKGPRKM++IIPGM      I F+P+   + LL   + + ++NL+ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQIVH ND +YI+MQFGR +D  FT+D+ YPL A+QAF I LSSFD KLACE
Sbjct:  206 LEDFAYSPAPRGVTVKCKVTRDKKGMDRGLFPTYYMHLEREENRKIFLLAGRKRKKSKTSNYLVSTDPTDLSREGESYIGKLRSNLMGTKFTVYDHGVNPVKAQGLVEKAHTRQELAAICYETNVLGFKGPRKMSVIIPGMNMNHERIPFRPRNEHESLLSKWQNKSMENLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHGNDPDYIVMQFGRVADDVFTLDYNYPLCALQAFAIGLSSFDSKLACE 460          
BLAST of Tubby-like protein vs. Ensembl Mouse
Match: Tulp1 (tubby like protein 1 [Source:MGI Symbol;Acc:MGI:109571])

HSP 1 Score: 320.472 bits (820), Expect = 6.579e-103
Identity = 144/255 (56.47%), Postives = 192/255 (75.29%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSN-KPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            E   FV +PAPQ   V+CR+TRDK GMD+GMYP+Y+LHL+    K +FLLA R+RK  KT+NYLIS D T++ + G  ++ KLR+N +G +F+++DNGQ P+     +   LR ELAA+++ETNVLGF+GPR+MT+IIPGM      +  +P+   D LL   + + L++L+ELHNK P+WNEDS SY LNF GRVTQASVKNFQIVH +D +YI++QFGR ++ +FT+D+ YPL A+QAF IALSSFDGKLACE
Sbjct:  240 EPREFVLQPAPQGRAVRCRLTRDKKGMDRGMYPSYFLHLD--TEKKVFLLAGRKRKRSKTANYLISSDPTNLSRGGENFIGKLRSNLLGNRFTVFDNGQNPQRGGGGDVGSLRQELAAVVYETNVLGFRGPRRMTVIIPGMNSDNERVPIRPRNASDGLLVRWQNKTLESLIELHNKPPIWNEDSGSYTLNFQGRVTQASVKNFQIVHADDPDYIVLQFGRVAEDAFTLDYRYPLCALQAFAIALSSFDGKLACE 492          
BLAST of Tubby-like protein vs. Ensembl Mouse
Match: Tulp1 (tubby like protein 1 [Source:MGI Symbol;Acc:MGI:109571])

HSP 1 Score: 320.472 bits (820), Expect = 2.598e-102
Identity = 144/255 (56.47%), Postives = 192/255 (75.29%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSN-KPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            E   FV +PAPQ   V+CR+TRDK GMD+GMYP+Y+LHL+    K +FLLA R+RK  KT+NYLIS D T++ + G  ++ KLR+N +G +F+++DNGQ P+     +   LR ELAA+++ETNVLGF+GPR+MT+IIPGM      +  +P+   D LL   + + L++L+ELHNK P+WNEDS SY LNF GRVTQASVKNFQIVH +D +YI++QFGR ++ +FT+D+ YPL A+QAF IALSSFDGKLACE
Sbjct:  291 EPREFVLQPAPQGRAVRCRLTRDKKGMDRGMYPSYFLHLD--TEKKVFLLAGRKRKRSKTANYLISSDPTNLSRGGENFIGKLRSNLLGNRFTVFDNGQNPQRGGGGDVGSLRQELAAVVYETNVLGFRGPRRMTVIIPGMNSDNERVPIRPRNASDGLLVRWQNKTLESLIELHNKPPIWNEDSGSYTLNFQGRVTQASVKNFQIVHADDPDYIVLQFGRVAEDAFTLDYRYPLCALQAFAIALSSFDGKLACE 543          
BLAST of Tubby-like protein vs. UniProt/SwissProt
Match: sp|P50607|TUB_HUMAN (Tubby protein homolog OS=Homo sapiens OX=9606 GN=TUB PE=1 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 2.605e-111
Identity = 154/267 (57.68%), Postives = 203/267 (76.03%), Query Frame = 1
Query:  787 PEHILDSNLE-IESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSS---NKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            PE  +D  ++ +E F  +PAPQ   +KCRITRDK GMD+GMYPTY+LHL+R++ K +FLLA R+RK  KTSNYLIS D TD+ + G  Y+ KLR+N +GT+F++YDNG  P+  +SS   +  LR ELAA+ +ETNVLGFKGPRKM++I+PGM  +   +  +P+   + LL   + +  ++++EL NK PVWN+D+QSYVLNFHGRVTQASVKNFQI+H ND +YI+MQFGR ++  FTMD+ YPL A+QAF IALSSFD KLACE
Sbjct:  240 PEQPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 506          
BLAST of Tubby-like protein vs. UniProt/SwissProt
Match: sp|P50586|TUB_MOUSE (Tubby protein OS=Mus musculus OX=10090 GN=Tub PE=1 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 1.746e-109
Identity = 151/257 (58.75%), Postives = 198/257 (77.04%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSS---NKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E F  +PAPQ   +KCRITRDK GMD+GMYPTY+LHL+R++ K +FLLA R+RK  KTSNYLIS D TD+ + G  Y+ KLR+N +GT+F++YDNG  P+  +SS   +  LR ELAA+ +ETNVLGFKGPRKM++I+PGM  +   +  +P+   + LL   + +  ++++EL NK PVWN+D+QSYVLNFHGRVTQASVKNFQI+H ND +YI+MQFGR ++  FTMD+ YPL A+QAF IALSSFD KLACE
Sbjct:  249 DLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVCIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 505          
BLAST of Tubby-like protein vs. UniProt/SwissProt
Match: sp|O88808|TUB_RAT (Tubby protein homolog OS=Rattus norvegicus OX=10116 GN=Tub PE=2 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 2.118e-109
Identity = 151/257 (58.75%), Postives = 198/257 (77.04%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSS---NKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E F  +PAPQ   +KCRITRDK GMD+GMYPTY+LHL+R++ K +FLLA R+RK  KTSNYLIS D TD+ + G  Y+ KLR+N +GT+F++YDNG  P+  +SS   +  LR ELAA+ +ETNVLGFKGPRKM++I+PGM  +   +  +P+   + LL   + +  ++++EL NK PVWN+D+QSYVLNFHGRVTQASVKNFQI+H ND +YI+MQFGR ++  FTMD+ YPL A+QAF IALSSFD KLACE
Sbjct:  249 DLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVCIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 505          
BLAST of Tubby-like protein vs. UniProt/SwissProt
Match: sp|B0WI30|TULP2_CULQU (Protein king tubby 2 OS=Culex quinquefasciatus OX=7176 GN=king-tubby2 PE=3 SV=2)

HSP 1 Score: 333.569 bits (854), Expect = 4.302e-108
Identity = 161/291 (55.33%), Postives = 213/291 (73.20%), Query Frame = 1
Query:  709 QSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTP--MKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            Q D  SSG++ S+ H  + + + H+  E   D    IE +V++PA Q  + KCRITRD+ GMD+G++P YYLHLER   K LF LA R+RK  KTSNY+ISCD TD+ +   G++ KLR+N  GT F +YDNG+K +PV+      R +LA +I++TN+LGFKGPR MT+++PGMT    +  I+     G+  LL+  +++ +DN++ELHNK P+WN+++QSYVLNFHGRVTQASVKNFQ+VHD+D +YI+MQFGRTSD  FTMDF YPL A QAF IALSSFDGKLACE
Sbjct:  141 QQDSGSSGNLKSMEHS-SPQASGHNDAEG--DVAGPIEQWVTQPAAQGVLYKCRITRDRKGMDRGLFPIYYLHLERDYGKRLFCLAGRKRKKSKTSNYIISCDPTDLSRQADGFVGKLRSNVFGTTFFVYDNGKKDDPVSP-----RLDLAVVIYDTNILGFKGPRNMTVLLPGMTEDDQRVKINSSDSHGQG-LLDSWKSKHMDNVVELHNKTPIWNDETQSYVLNFHGRVTQASVKNFQLVHDSDPDYIVMQFGRTSDDIFTMDFRYPLCAFQAFAIALSSFDGKLACE 422          
BLAST of Tubby-like protein vs. UniProt/SwissProt
Match: sp|B0XFQ9|TULP1_CULQU (Protein king tubby 1 OS=Culex quinquefasciatus OX=7176 GN=king-tubby1 PE=3 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 4.876e-108
Identity = 161/291 (55.33%), Postives = 213/291 (73.20%), Query Frame = 1
Query:  709 QSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTP--MKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            Q D  SSG++ S+ H  + + + H+  E   D    IE +V++PA Q  + KCRITRD+ GMD+G++P YYLHLER   K LF LA R+RK  KTSNY+ISCD TD+ +   G++ KLR+N  GT F +YDNG+K +PV+      R +LA +I++TN+LGFKGPR MT+++PGMT    +  I+     G+  LL+  +++ +DN++ELHNK P+WN+++QSYVLNFHGRVTQASVKNFQ+VHD+D +YI+MQFGRTSD  FTMDF YPL A QAF IALSSFDGKLACE
Sbjct:  146 QQDSGSSGNLKSMEHS-SPQASGHNDAEG--DVAGPIEQWVTQPAAQGVLYKCRITRDRKGMDRGLFPIYYLHLERDYGKRLFCLAGRKRKKSKTSNYIISCDPTDLSRQADGFVGKLRSNVFGTTFFVYDNGKKDDPVSP-----RLDLAVVIYDTNILGFKGPRNMTVLLPGMTEDDQRVKINSSDSHGQG-LLDSWKSKHMDNVVELHNKTPIWNDETQSYVLNFHGRVTQASVKNFQLVHDSDPDYIVMQFGRTSDDIFTMDFRYPLCAFQAFAIALSSFDGKLACE 427          
BLAST of Tubby-like protein vs. TrEMBL
Match: A0A1I8HU81 (Tub domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 2.666e-115
Identity = 161/260 (61.92%), Postives = 205/260 (78.85%), Query Frame = 1
Query:  796 ILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            I D   ++E FV +PAPQ CV+K RITRD  G+++  YPTYYLH+ER + K +FLLAAR+R++  T+NYLISCD TD+K+ G  ++ KLR NF GT F+++DNG+ P+    S +  R ELAAI +ETNVLGF+GPRKMT+++PGM      I+ +PK  +D LL   + ++++NLLELHNK PVWNED+QSYVLNFHGRVTQASVKNFQ+VHDND +YI+MQFGR SD  FTMDFAYP+ A+QAFG+ALSSFDGKLACE
Sbjct:  223 IPDPTEDLEEFVLRPAPQGCVIKGRITRDTRGIERTRYPTYYLHMERDDGKKIFLLAARKRRHSSTANYLISCDPTDLKRAGESFVGKLRGNFFGTGFTVFDNGEAPK---KSGELARRELAAIAYETNVLGFRGPRKMTVLLPGMNADSERIELRPKSDDDGLLARYKRKEMNNLLELHNKTPVWNEDTQSYVLNFHGRVTQASVKNFQVVHDNDVDYIVMQFGRISDDIFTMDFAYPMCALQAFGVALSSFDGKLACE 479          
BLAST of Tubby-like protein vs. TrEMBL
Match: A0A1I8H558 (Tub domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 2.823e-115
Identity = 161/260 (61.92%), Postives = 205/260 (78.85%), Query Frame = 1
Query:  796 ILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            I D   ++E FV +PAPQ CV+K RITRD  G+++  YPTYYLH+ER + K +FLLAAR+R++  T+NYLISCD TD+K+ G  ++ KLR NF GT F+++DNG+ P+    S +  R ELAAI +ETNVLGF+GPRKMT+++PGM      I+ +PK  +D LL   + ++++NLLELHNK PVWNED+QSYVLNFHGRVTQASVKNFQ+VHDND +YI+MQFGR SD  FTMDFAYP+ A+QAFG+ALSSFDGKLACE
Sbjct:  220 IPDPTEDLEEFVLRPAPQGCVIKGRITRDTRGIERTRYPTYYLHMERDDGKKIFLLAARKRRHSSTANYLISCDPTDLKRAGESFVGKLRGNFFGTGFTVFDNGEAPK---KSGELARRELAAIAYETNVLGFRGPRKMTVLLPGMNADSERIELRPKSDDDGLLARYKRKEMNNLLELHNKTPVWNEDTQSYVLNFHGRVTQASVKNFQVVHDNDVDYIVMQFGRISDDIFTMDFAYPMCALQAFGVALSSFDGKLACE 476          
BLAST of Tubby-like protein vs. TrEMBL
Match: A0A267FHG9 (Tub domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001705g1 PE=3 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 4.539e-114
Identity = 161/260 (61.92%), Postives = 205/260 (78.85%), Query Frame = 1
Query:  796 ILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            I D   ++E FV +PAPQ CV+K RITRD  G+++  YPTYYLH+ER + K +FLLAAR+R++  T+NYLISCD TD+K+ G  ++ KLR NF GT F+++DNG+ P+    S +  R ELAAI +ETNVLGF+GPRKMT+++PGM      I+ +PK  +D LL   + ++++NLLELHNK PVWNED+QSYVLNFHGRVTQASVKNFQ+VHDND +YI+MQFGR SD  FTMDFAYP+ A+QAFG+ALSSFDGKLACE
Sbjct:  331 IPDPTEDLEEFVLRPAPQGCVIKGRITRDTRGIERTRYPTYYLHMERDDGKKIFLLAARKRRHSSTANYLISCDPTDLKRAGESFVGKLRGNFFGTGFTVFDNGEAPK---KSGELARRELAAIAYETNVLGFRGPRKMTVLLPGMNADSERIELRPKSDDDGLLARYKRKEMNNLLELHNKTPVWNEDTQSYVLNFHGRVTQASVKNFQVVHDNDVDYIVMQFGRISDDIFTMDFAYPMCALQAFGVALSSFDGKLACE 587          
BLAST of Tubby-like protein vs. TrEMBL
Match: A0A369RWL4 (Tubby-like protein OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_007638 PE=3 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 4.953e-114
Identity = 161/255 (63.14%), Postives = 202/255 (79.22%), Query Frame = 1
Query:  817 IESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEP--VNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            IE F+   APQD  +KCRI+RDK G+D+G+YPTYYLHLER++ K +FL+A R+RK  KTSNYLIS DATD+ +NG  ++ KLR+N IGT+F++YDNG  P    V       R ELAAII++TNVLGFKGPRKMTI+IPGM   +  +  +P+   + LLE  ++ ++DNLLELHNK P WN+++QSYVLNFHGRVTQASVKNFQ+VHDND +YIIMQFGR S+ +FTMD+ YPLSA+QAF I+LSSFDGKLACE
Sbjct:  204 IEKFIQSTAPQDTTIKCRISRDKKGVDRGIYPTYYLHLEREDGKKIFLMAGRKRKKSKTSNYLISNDATDLSRNGESFVGKLRSNLIGTRFTVYDNGINPAKGSVGIDGSSNREELAAIIYDTNVLGFKGPRKMTILIPGMDANQERVAVRPRNANETLLERWKSGRMDNLLELHNKAPEWNDNTQSYVLNFHGRVTQASVKNFQVVHDNDVDYIIMQFGRVSEDAFTMDYKYPLSALQAFAISLSSFDGKLACE 458          
BLAST of Tubby-like protein vs. TrEMBL
Match: A0A267H862 (Tub domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025713g2 PE=3 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 5.414e-114
Identity = 161/260 (61.92%), Postives = 205/260 (78.85%), Query Frame = 1
Query:  796 ILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            I D   ++E FV +PAPQ CV+K RITRD  G+++  YPTYYLH+ER + K +FLLAAR+R++  T+NYLISCD TD+K+ G  ++ KLR NF GT F+++DNG+ P+    S +  R ELAAI +ETNVLGF+GPRKMT+++PGM      I+ +PK  +D LL   + ++++NLLELHNK PVWNED+QSYVLNFHGRVTQASVKNFQ+VHDND +YI+MQFGR SD  FTMDFAYP+ A+QAFG+ALSSFDGKLACE
Sbjct:  336 IPDPTEDLEEFVLRPAPQGCVIKGRITRDTRGIERTRYPTYYLHMERDDGKKIFLLAARKRRHSSTANYLISCDPTDLKRAGESFVGKLRGNFFGTGFTVFDNGEAPK---KSGELARRELAAIAYETNVLGFRGPRKMTVLLPGMNADSERIELRPKSDDDGLLARYKRKEMNNLLELHNKTPVWNEDTQSYVLNFHGRVTQASVKNFQVVHDNDVDYIVMQFGRISDDIFTMDFAYPMCALQAFGVALSSFDGKLACE 592          
BLAST of Tubby-like protein vs. Ensembl Cavefish
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:107197122])

HSP 1 Score: 344.739 bits (883), Expect = 5.872e-113
Identity = 155/256 (60.55%), Postives = 197/256 (76.95%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKP--LRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E F  +PAPQ   VKCRITRDK GMD+GMYPTYYLHLER++ K +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YDNG  P    S+ +   LR ELAA+ +ETNVLGFKGPRKM++IIPGM      +  +P+   + LL   + +  ++++ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQI+HDND +YI+MQFGR ++  FTMDF YP+ A+QAF IALSSFD KLACE
Sbjct:  200 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGMNPVKTTSTLEASNLRQELAAVCYETNVLGFKGPRKMSVIIPGMNMDHERVCIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDFNYPMCALQAFAIALSSFDSKLACE 455          
BLAST of Tubby-like protein vs. Ensembl Cavefish
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:107197122])

HSP 1 Score: 346.28 bits (887), Expect = 7.384e-113
Identity = 155/256 (60.55%), Postives = 197/256 (76.95%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKP--LRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E F  +PAPQ   VKCRITRDK GMD+GMYPTYYLHLER++ K +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YDNG  P    S+ +   LR ELAA+ +ETNVLGFKGPRKM++IIPGM      +  +P+   + LL   + +  ++++ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQI+HDND +YI+MQFGR ++  FTMDF YP+ A+QAF IALSSFD KLACE
Sbjct:  251 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGMNPVKTTSTLEASNLRQELAAVCYETNVLGFKGPRKMSVIIPGMNMDHERVCIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDFNYPMCALQAFAIALSSFDSKLACE 506          
BLAST of Tubby-like protein vs. Ensembl Cavefish
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:107197122])

HSP 1 Score: 345.895 bits (886), Expect = 8.237e-113
Identity = 155/256 (60.55%), Postives = 197/256 (76.95%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKP--LRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E F  +PAPQ   VKCRITRDK GMD+GMYPTYYLHLER++ K +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YDNG  P    S+ +   LR ELAA+ +ETNVLGFKGPRKM++IIPGM      +  +P+   + LL   + +  ++++ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQI+HDND +YI+MQFGR ++  FTMDF YP+ A+QAF IALSSFD KLACE
Sbjct:  245 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGMNPVKTTSTLEASNLRQELAAVCYETNVLGFKGPRKMSVIIPGMNMDHERVCIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDFNYPMCALQAFAIALSSFDSKLACE 500          
BLAST of Tubby-like protein vs. Ensembl Cavefish
Match: zmp:0000000711 (tubby-related protein 3-like [Source:NCBI gene;Acc:103026270])

HSP 1 Score: 343.199 bits (879), Expect = 1.551e-112
Identity = 158/258 (61.24%), Postives = 197/258 (76.36%), Query Frame = 1
Query:  817 IESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEP-----VNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            +E FV +PAP+   +KCRITRDK GMD+G+YPTY++HLER++ K LFLLA R+RK  KTSNYLIS DATD+ + G  ++ KLR+N +GT+F++YDNG  P       +  SN   R ELAAI +ETNVLGFKGPRKMT+IIPGM      +  +P   ++ LL   + R LDNL+ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQIVHDND +YI+MQFGR ++  FT+D+ YP+ A+QAF I LSSFD KLACE
Sbjct:  188 LEEFVVRPAPRGATIKCRITRDKKGMDRGLYPTYFMHLEREDGKKLFLLAGRKRKKSKTSNYLISVDATDLSREGESFVGKLRSNMMGTKFTVYDNGTNPTKNPGTLLEESNT--RQELAAICYETNVLGFKGPRKMTVIIPGMNMNFERVPVRPTNDQESLLSKWQNRALDNLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDPDYIVMQFGRVAEDVFTLDYNYPMCALQAFAIGLSSFDSKLACE 443          
BLAST of Tubby-like protein vs. Ensembl Cavefish
Match: zmp:0000000711 (tubby-related protein 3-like [Source:NCBI gene;Acc:103026270])

HSP 1 Score: 343.584 bits (880), Expect = 2.265e-112
Identity = 158/258 (61.24%), Postives = 197/258 (76.36%), Query Frame = 1
Query:  817 IESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEP-----VNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            +E FV +PAP+   +KCRITRDK GMD+G+YPTY++HLER++ K LFLLA R+RK  KTSNYLIS DATD+ + G  ++ KLR+N +GT+F++YDNG  P       +  SN   R ELAAI +ETNVLGFKGPRKMT+IIPGM      +  +P   ++ LL   + R LDNL+ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQIVHDND +YI+MQFGR ++  FT+D+ YP+ A+QAF I LSSFD KLACE
Sbjct:  206 LEEFVVRPAPRGATIKCRITRDKKGMDRGLYPTYFMHLEREDGKKLFLLAGRKRKKSKTSNYLISVDATDLSREGESFVGKLRSNMMGTKFTVYDNGTNPTKNPGTLLEESNT--RQELAAICYETNVLGFKGPRKMTVIIPGMNMNFERVPVRPTNDQESLLSKWQNRALDNLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDPDYIVMQFGRVAEDVFTLDYNYPMCALQAFAIGLSSFDSKLACE 461          
BLAST of Tubby-like protein vs. Ensembl Sea Lamprey
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 273.863 bits (699), Expect = 2.727e-89
Identity = 139/258 (53.88%), Postives = 175/258 (67.83%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPE--PVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDND--AEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E+F  +PAPQ   VKCRITRDK GMD+GM+PTY+LH++R + K +FLLA R+RK  KTSNYL+S D T++ + G  Y+ KLR+N +GT+F++YDNG KP+   +      LR ELAA+ +E   L  +   K T                         EH+        +ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQIVH ND  AEYIIMQFGR ++  FTMD++YPL A+QAF IALSSFDGKLACE
Sbjct:    3 DLEAFALRPAPQGGPVKCRITRDKKGMDRGMFPTYFLHMDRDDGKKVFLLAGRKRKKSKTSNYLLSTDPTNLSREGESYIGKLRSNVMGTRFTVYDNGIKPDRTGILGDGSNLRQELAAVCYEHETLVSRWHNKNT-------------------------EHT--------VELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHYNDRAAEYIIMQFGRVAEDIFTMDYSYPLCALQAFSIALSSFDGKLACE 227          
BLAST of Tubby-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003777.1 (pep scaffold:Pmarinus_7.0:GL496087:2648:3421:1 gene:ENSPMAG00000003451.1 transcript:ENSPMAT00000003777.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.102 bits (318), Expect = 1.277e-33
Identity = 84/257 (32.68%), Postives = 145/257 (56.42%), Query Frame = 1
Query:  820 ESFVSKPAPQDC-VVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSN-KPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTP--MKTPIDFQPKFGEDDLLEHSR-TRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            +S + +P P +  +++  I R KSG    ++P+++L+LE+   + + +L A++R + KT+N+LIS + T  K+ G   L KLR+N    ++ L+++G  P+ ++ +    +R E  AI ++         RK  +IIPG+ P  MK   + +P   ED +++     +  +N     +  P WN  +  Y  +F GR+++ASVKNF+ V   +   + +QFGRT+D+ F +D  YP S  QAFG+AL+ FD    CE
Sbjct:    1 KSIMMQPIPFEVGMLQFEIQRKKSGFSV-LHPSFHLYLEKGGDEKVSILYAKKRAFNKTANFLISTEKTKNKRGGDECLGKLRSNETKERYFLFNDGDNPKNMHKTAISGIRNEHMAIQYKYVPCSIGKLRKAKVIIPGVDPNTMKNR-EHKPLKKEDTMIKKIEDPQAAENFYVFVDNPPQWNPKTHGYHYDFRGRISEASVKNFKGV---NIRGMNVQFGRTNDNVFKLDAQYPFSIFQAFGLALTVFD----CE 248          
BLAST of Tubby-like protein vs. Ensembl Nematostella
Match: EDO38412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD12])

HSP 1 Score: 345.895 bits (886), Expect = 7.577e-117
Identity = 157/249 (63.05%), Postives = 195/249 (78.31%), Query Frame = 1
Query:  835 KPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEP--VNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            +PAPQ   VKCRITRDK GMD+GMYPTY+LH+ER + K +FLLA R+RK   TSNYLIS DATD+ + G  ++ KLRAN +GT+FS++DNG  P    V S    +R EL  II++TNVLGFKGPRKMT+++PGM   +  +  +P+   + +LE  R R+L+NL+ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQIVHD+D +YIIMQFGR ++  FTMD+ YP+ AVQAF IALSSFDGKLACE
Sbjct:    1 RPAPQGIPVKCRITRDKKGMDRGMYPTYFLHMERDDGKKVFLLAGRKRKKSTTSNYLISTDATDLSRGGESFVGKLRANLVGTKFSIFDNGVNPRKGGVMSDGSNIREELGGIIYDTNVLGFKGPRKMTVVLPGMGLDQQRVPVRPRLESETILERHRNRQLENLVELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDSDVDYIIMQFGRVAEDVFTMDYNYPMCAVQAFAIALSSFDGKLACE 249          
BLAST of Tubby-like protein vs. Ensembl Nematostella
Match: EDO28462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD12])

HSP 1 Score: 345.895 bits (886), Expect = 7.577e-117
Identity = 157/249 (63.05%), Postives = 195/249 (78.31%), Query Frame = 1
Query:  835 KPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEP--VNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            +PAPQ   VKCRITRDK GMD+GMYPTY+LH+ER + K +FLLA R+RK   TSNYLIS DATD+ + G  ++ KLRAN +GT+FS++DNG  P    V S    +R EL  II++TNVLGFKGPRKMT+++PGM   +  +  +P+   + +LE  R R+L+NL+ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQIVHD+D +YIIMQFGR ++  FTMD+ YP+ AVQAF IALSSFDGKLACE
Sbjct:    1 RPAPQGIPVKCRITRDKKGMDRGMYPTYFLHMERDDGKKVFLLAGRKRKKSTTSNYLISTDATDLSRGGESFVGKLRANLVGTKFSIFDNGVNPRKGGVMSDGSNIREELGGIIYDTNVLGFKGPRKMTVVLPGMGLDQQRVPVRPRLESETILERHRNRQLENLVELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDSDVDYIIMQFGRVAEDVFTMDYNYPMCAVQAFAIALSSFDGKLACE 249          
BLAST of Tubby-like protein vs. Ensembl Medaka
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:101162435])

HSP 1 Score: 344.739 bits (883), Expect = 2.059e-112
Identity = 155/256 (60.55%), Postives = 197/256 (76.95%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKP--LRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E F  +PAPQ   VKCRITRDK GMD+GMYPTYYLHLER++ K +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YDNG  P    +S +   LR ELAAI +ETNVLGFKGPRKM++IIPGM      +  +P+   + LL   + +  ++++ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQI+HDND +YI+MQFGR ++  FTMD+ YP+ A+QAF IALSSFD KLACE
Sbjct:  241 DLEEFSLRPAPQGVRVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGLNPMKSTTSLEASNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNDHESLLARWQNKNTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 496          
BLAST of Tubby-like protein vs. Ensembl Medaka
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:101162435])

HSP 1 Score: 345.125 bits (884), Expect = 2.078e-112
Identity = 155/256 (60.55%), Postives = 197/256 (76.95%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKP--LRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E F  +PAPQ   VKCRITRDK GMD+GMYPTYYLHLER++ K +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YDNG  P    +S +   LR ELAAI +ETNVLGFKGPRKM++IIPGM      +  +P+   + LL   + +  ++++ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQI+HDND +YI+MQFGR ++  FTMD+ YP+ A+QAF IALSSFD KLACE
Sbjct:  247 DLEEFSLRPAPQGVRVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGLNPMKSTTSLEASNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNDHESLLARWQNKNTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 502          
BLAST of Tubby-like protein vs. Ensembl Medaka
Match: zmp:0000000711 (TUB like protein 3 [Source:NCBI gene;Acc:101160279])

HSP 1 Score: 336.265 bits (861), Expect = 2.855e-109
Identity = 149/265 (56.23%), Postives = 200/265 (75.47%), Query Frame = 1
Query:  790 EHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSS---NKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            +H+L     +E FV  PAP+   +KCRI+RDK GMD+G+YPTY++H+E+++ K +FLLA R+RK  KTSNYLIS DATD+ + G  ++ KLR+N +GT+F++YD+G  P     +   + P R E+AA+ +ETNVLGFKGPRKMT+IIPGM      +  +P+  ++ LL   +   ++NL+ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQIVHDND +YI+MQFGR ++  FT+D+ YP+ A+QAF I LSSFD KLACE
Sbjct:  222 DHLLSEMSNLEEFVLSPAPRGVTIKCRISRDKKGMDRGLYPTYFMHMEKEDGKKVFLLAGRKRKKSKTSNYLISVDATDLSREGDSFIGKLRSNLMGTKFTVYDSGSNPGKTVGALMEDSPARQEMAAVCYETNVLGFKGPRKMTVIIPGMNMNFERLPVRPQNEQESLLSRWQNHSMENLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDPDYIVMQFGRVAEDIFTLDYNYPMCALQAFAIGLSSFDSKLACE 486          
BLAST of Tubby-like protein vs. Ensembl Medaka
Match: zmp:0000000711 (TUB like protein 3 [Source:NCBI gene;Acc:101160279])

HSP 1 Score: 336.265 bits (861), Expect = 8.041e-109
Identity = 149/265 (56.23%), Postives = 200/265 (75.47%), Query Frame = 1
Query:  790 EHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSS---NKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            +H+L     +E FV  PAP+   +KCRI+RDK GMD+G+YPTY++H+E+++ K +FLLA R+RK  KTSNYLIS DATD+ + G  ++ KLR+N +GT+F++YD+G  P     +   + P R E+AA+ +ETNVLGFKGPRKMT+IIPGM      +  +P+  ++ LL   +   ++NL+ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQIVHDND +YI+MQFGR ++  FT+D+ YP+ A+QAF I LSSFD KLACE
Sbjct:  252 DHLLSEMSNLEEFVLSPAPRGVTIKCRISRDKKGMDRGLYPTYFMHMEKEDGKKVFLLAGRKRKKSKTSNYLISVDATDLSREGDSFIGKLRSNLMGTKFTVYDSGSNPGKTVGALMEDSPARQEMAAVCYETNVLGFKGPRKMTVIIPGMNMNFERLPVRPQNEQESLLSRWQNHSMENLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDPDYIVMQFGRVAEDIFTLDYNYPMCALQAFAIGLSSFDSKLACE 516          
BLAST of Tubby-like protein vs. Ensembl Medaka
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:101162435])

HSP 1 Score: 329.331 bits (843), Expect = 4.611e-106
Identity = 155/283 (54.77%), Postives = 197/283 (69.61%), Query Frame = 1
Query:  814 EIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKP--LRAELAAIIF---------------------------ETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            ++E F  +PAPQ   VKCRITRDK GMD+GMYPTYYLHLER++ K +FLLA R+RK  KTSNYLIS D TD+ + G  ++ KLR+N +GT+F++YDNG  P    +S +   LR ELAAI +                           ETNVLGFKGPRKM++IIPGM      +  +P+   + LL   + +  ++++ELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQI+HDND +YI+MQFGR ++  FTMD+ YP+ A+QAF IALSSFD KLACE
Sbjct:  241 DLEEFSLRPAPQGVRVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGLNPMKSTTSLEASNLRQELAAICYVSKRTAMKQLKLYCIVTDNVLLCHFIQETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNDHESLLARWQNKNTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 523          
BLAST of Tubby-like protein vs. Planmine SMEST
Match: SMESG000009644.1 (SMESG000009644.1)

HSP 1 Score: 1004.97 bits (2597), Expect = 0.000e+0
Identity = 496/499 (99.40%), Postives = 497/499 (99.60%), Query Frame = 1
Query:   79 MSSEARQRKLNQQRQKIRDNQNKKHIQQLKSIQINDNEAILNFNFLSVKEETSLLVKNSSSENQISGKFAYDGPQSFELANIYNSHDSEIEIYHLNDPTITEKSLIIEKSHKSDSVXXXXXXXXXXXXMGTKAGFNYSKHNARENNNDFETQIGMNDVTDGSEKLSAGVNQSESSILRDGINTIESTENDLDSSANISNVAVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE 1575
            MSSEARQRKLNQQRQKIRDNQNKKHIQQLKSIQINDNEAILN NFLSVKEETSLLVKNSSSENQISGKFAYDGPQSFELANIYNSHDSEIEIYHLNDPTITEKSLIIEKSHKSDSVKKESRNKNSNKEMGTKAGFNYSKHNARENNNDFETQIGMNDVTDGSEKLSAGVNQSESSILRDGINTIESTENDLDSSANISNVAVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDK GMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSF+MDFAYPLSAVQAFGIALSSFDGKLACE
Sbjct:    1 MSSEARQRKLNQQRQKIRDNQNKKHIQQLKSIQINDNEAILNLNFLSVKEETSLLVKNSSSENQISGKFAYDGPQSFELANIYNSHDSEIEIYHLNDPTITEKSLIIEKSHKSDSVKKESRNKNSNKEMGTKAGFNYSKHNARENNNDFETQIGMNDVTDGSEKLSAGVNQSESSILRDGINTIESTENDLDSSANISNVAVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKRGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFSMDFAYPLSAVQAFGIALSSFDGKLACE 499          
BLAST of Tubby-like protein vs. Planmine SMEST
Match: SMESG000073925.1 (SMESG000073925.1)

HSP 1 Score: 271.552 bits (693), Expect = 9.649e-86
Identity = 171/434 (39.40%), Postives = 249/434 (57.37%), Query Frame = 1
Query:  103 KLNQQRQKIRDNQNKKHIQQLKSIQINDNEAILNFNFLSVKEETSLLVKNSSSEN-QISGKFAYDGPQSFELANIYNSHDSEIEIYHLNDPTITEKSLIIEKSHKSDSVXXXXXXXXXXXXMGTKAGFNYSKHNARENNNDFETQIGMNDVTDGSEKLSAG-VNQSESSILRDGINTIESTENDLDSSANISNVAVSPYNATSKQSDVCSSGDV-DSIPHDIADEENFH-SFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPE-PVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFH 1389
            K N++RQKI+ NQ +K + + + +Q +D + I      + K+E   L +NS+++N +    +AYDGPQ++E+ N      + +++  +N     EK L+ +     D V                                +ET       +  S KLS+  + +++     + I TIE++++ L            P N +S+++D  S  D+ D  P  +    +   SFP    DS L++E FV +PA Q+  +KCRI+RDK G+DKG+YPTYYLHL+R + K LFLLAARRRK   TSNYLISCDATD+K++G  Y+ KLR+NF+GT F +YDNG  P+     +NK +R EL+AI ++TNVLGFKGPRKMT+IIPGM      I+FQ K  ED L+E  + +K+ NLLELHNK PVWN D +    NF+
Sbjct:   14 KFNKERQKIKHNQLRKQVHETQKLQPSDLKEI------TFKDEKRPLFENSNNDNTEYHCNYAYDGPQAYEMTNPDGLSTTHVQVLKVN----PEKPLVTK-----DPVLS------------------------------YET-------SQNSTKLSSSNILKTKQETYEEDIETIETSDSQL------------PTNNSSEKTD--SKNDLSDENPGSVDTANSLTVSFP----DSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGKRLFLLAARRRKKSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWN-DGKDISENFY 376          
BLAST of Tubby-like protein vs. Planmine SMEST
Match: SMESG000073925.1 (SMESG000073925.1)

HSP 1 Score: 251.521 bits (641), Expect = 2.018e-76
Identity = 120/204 (58.82%), Postives = 151/204 (74.02%), Query Frame = 1
Query:  781 SFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPE-PVNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFH 1389
            SFP    DS L++E FV +PA Q+  +KCRI+RDK G+DKG+YPTYYLHL+R + K LFLLAARRRK   TSNYLISCDATD+K++G  Y+ KLR+NF+GT F +YDNG  P+     +NK +R EL+AI ++TNVLGFKGPRKMT+IIPGM      I+FQ K  ED L+E  + +K+ NLLELHNK PVWN D +    NF+
Sbjct:  314 SFP----DSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGKRLFLLAARRRKKSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWN-DGKDISENFY 512          
BLAST of Tubby-like protein vs. Planmine SMEST
Match: SMESG000043973.1 (SMESG000043973.1)

HSP 1 Score: 77.411 bits (189), Expect = 1.105e-15
Identity = 50/128 (39.06%), Postives = 67/128 (52.34%), Query Frame = 1
Query: 1201 PRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKL----DNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQI-VHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLA 1569
            PR +T  IP     K   DF  +      L   RT  L    D ++ L N+ P ++ED + YVLNF GRVT+ SVKNF + ++ N     + Q G+   H + +DF YPL   QAF IALS    K+A
Sbjct:  130 PRTITAAIPNWDESKGYYDFSNE------LPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 250          
BLAST of Tubby-like protein vs. Planmine SMEST
Match: SMESG000043973.1 (SMESG000043973.1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.672e-14
Identity = 50/128 (39.06%), Postives = 67/128 (52.34%), Query Frame = 1
Query: 1201 PRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKL----DNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQI-VHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLA 1569
            PR +T  IP     K   DF  +      L   RT  L    D ++ L N+ P ++ED + YVLNF GRVT+ SVKNF + ++ N     + Q G+   H + +DF YPL   QAF IALS    K+A
Sbjct:  660 PRTITAAIPNWDESKGYYDFSNE------LPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 780          
The following BLAST results are available for this feature:
BLAST of Tubby-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUB3.753e-11257.68TUB bipartite transcription factor [Source:HGNC Sy... [more]
TUB5.424e-11257.68TUB bipartite transcription factor [Source:HGNC Sy... [more]
TUB1.216e-11053.44TUB bipartite transcription factor [Source:HGNC Sy... [more]
TULP31.067e-10759.69TUB like protein 3 [Source:HGNC Symbol;Acc:HGNC:12... [more]
TULP11.215e-10457.65TUB like protein 1 [Source:HGNC Symbol;Acc:HGNC:12... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tub-11.380e-10353.07Tubby protein homolog 1 [Source:UniProtKB/Swiss-P... [more]
tub-26.168e-1352.38TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53... [more]
tub-24.787e-1252.38TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ktub7.018e-10758.59gene:FBgn0015721 transcript:FBtr0089600[more]
ktub1.374e-10658.59gene:FBgn0015721 transcript:FBtr0342842[more]
Tusp1.241e-1751.90gene:FBgn0039530 transcript:FBtr0335245[more]
Tusp1.252e-1751.90gene:FBgn0039530 transcript:FBtr0302589[more]
Tusp1.252e-1751.90gene:FBgn0039530 transcript:FBtr0302590[more]
back to top
BLAST of Tubby-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tub1.477e-11360.55TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
tub1.615e-11355.45TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
tub1.643e-11360.55TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
tub2.196e-11355.45TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
tub2.959e-11355.45TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tulp17.634e-11360.08TUB like protein 1 [Source:NCBI gene;Acc:549236][more]
tulp33.317e-11253.14TUB like protein 3 [Source:NCBI gene;Acc:100144732... [more]
tulp36.283e-11253.14TUB like protein 3 [Source:NCBI gene;Acc:100144732... [more]
tulp36.600e-11253.14TUB like protein 3 [Source:NCBI gene;Acc:100144732... [more]
tulp32.947e-11153.14TUB like protein 3 [Source:NCBI gene;Acc:100144732... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tub7.078e-11158.75tubby bipartite transcription factor [Source:MGI S... [more]
Tub2.495e-11058.75tubby bipartite transcription factor [Source:MGI S... [more]
Tulp35.334e-10758.43tubby-like protein 3 [Source:MGI Symbol;Acc:MGI:13... [more]
Tulp16.579e-10356.47tubby like protein 1 [Source:MGI Symbol;Acc:MGI:10... [more]
Tulp12.598e-10256.47tubby like protein 1 [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Tubby-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50607|TUB_HUMAN2.605e-11157.68Tubby protein homolog OS=Homo sapiens OX=9606 GN=T... [more]
sp|P50586|TUB_MOUSE1.746e-10958.75Tubby protein OS=Mus musculus OX=10090 GN=Tub PE=1... [more]
sp|O88808|TUB_RAT2.118e-10958.75Tubby protein homolog OS=Rattus norvegicus OX=1011... [more]
sp|B0WI30|TULP2_CULQU4.302e-10855.33Protein king tubby 2 OS=Culex quinquefasciatus OX=... [more]
sp|B0XFQ9|TULP1_CULQU4.876e-10855.33Protein king tubby 1 OS=Culex quinquefasciatus OX=... [more]
back to top
BLAST of Tubby-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HU812.666e-11561.92Tub domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8H5582.823e-11561.92Tub domain-containing protein OS=Macrostomum ligna... [more]
A0A267FHG94.539e-11461.92Tub domain-containing protein (Fragment) OS=Macros... [more]
A0A369RWL44.953e-11463.14Tubby-like protein OS=Trichoplax sp. H2 OX=287889 ... [more]
A0A267H8625.414e-11461.92Tub domain-containing protein (Fragment) OS=Macros... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tub5.872e-11360.55TUB bipartite transcription factor [Source:NCBI ge... [more]
tub7.384e-11360.55TUB bipartite transcription factor [Source:NCBI ge... [more]
tub8.237e-11360.55TUB bipartite transcription factor [Source:NCBI ge... [more]
zmp:00000007111.551e-11261.24tubby-related protein 3-like [Source:NCBI gene;Acc... [more]
zmp:00000007112.265e-11261.24tubby-related protein 3-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tub2.727e-8953.88TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
ENSPMAT00000003777.11.277e-3332.68pep scaffold:Pmarinus_7.0:GL496087:2648:3421:1 gen... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubby-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO384127.577e-11763.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284627.577e-11763.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tub2.059e-11260.55TUB bipartite transcription factor [Source:NCBI ge... [more]
tub2.078e-11260.55TUB bipartite transcription factor [Source:NCBI ge... [more]
zmp:00000007112.855e-10956.23TUB like protein 3 [Source:NCBI gene;Acc:101160279... [more]
zmp:00000007118.041e-10956.23TUB like protein 3 [Source:NCBI gene;Acc:101160279... [more]
tub4.611e-10654.77TUB bipartite transcription factor [Source:NCBI ge... [more]
back to top
BLAST of Tubby-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009644.10.000e+099.40SMESG000009644.1[more]
SMESG000073925.19.649e-8639.40SMESG000073925.1[more]
SMESG000073925.12.018e-7658.82SMESG000073925.1[more]
SMESG000043973.11.105e-1539.06SMESG000043973.1[more]
SMESG000043973.11.672e-1439.06SMESG000043973.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028737 ID=SMED30028737|Name=Tubby-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1712bp
ATTTAACAATTTAATCAAAGCGAAGGTCAAATATAATTGAAAAAGATAGA
TATTGTGATGTCATACAGAATATTTTGAATGTCTTCTGAAGCAAGACAAC
GCAAATTAAATCAACAAAGACAGAAAATCAGAGACAATCAAAACAAAAAG
CATATACAGCAATTGAAATCCATACAAATTAACGATAATGAAGCTATATT
AAATTTTAATTTTTTATCTGTCAAAGAAGAAACAAGTCTCCTGGTCAAGA
ATAGCAGTTCCGAAAATCAAATATCGGGCAAATTTGCTTATGATGGGCCA
CAGTCATTTGAGCTGGCAAACATTTATAACTCTCATGATAGTGAAATAGA
AATATATCATTTGAACGATCCAACAATTACAGAAAAATCTTTAATTATAG
AAAAATCTCACAAGTCGGATTCTGTCAAAAAGGAAAGTCGAAACAAAAAT
TCAAACAAAGAAATGGGAACTAAGGCCGGATTTAATTACTCGAAGCATAA
TGCTAGAGAAAATAATAATGACTTTGAGACGCAAATAGGTATGAACGATG
TAACTGATGGAAGCGAAAAATTATCAGCTGGAGTGAATCAAAGCGAATCC
AGCATTCTTCGAGATGGAATAAATACCATTGAATCCACAGAAAATGATTT
AGATAGTAGTGCAAATATATCAAATGTTGCAGTGTCTCCATACAATGCGA
CTAGTAAGCAGAGTGATGTTTGTTCATCGGGAGACGTTGATTCGATTCCT
CACGATATTGCGGACGAAGAAAATTTCCATAGCTTTCCAGAACATATACT
AGACTCGAATTTAGAGATAGAATCCTTCGTGTCAAAACCAGCTCCGCAAG
ATTGCGTAGTAAAATGTCGCATTACGAGAGATAAAAGTGGAATGGACAAA
GGTATGTACCCAACATACTACCTTCACCTTGAACGAAAAAATGCGAAGCC
TCTATTTCTTCTTGCGGCTCGCAGACGAAAATATTGCAAAACAAGCAATT
ATCTCATAAGTTGTGATGCTACTGATATGAAGAAAAATGGTTTCGGTTAT
TTAGCCAAGTTACGAGCTAATTTTATTGGTACGCAATTTTCACTTTACGA
TAACGGTCAAAAACCGGAGCCTGTAAATTCTTCAAATAAACCATTGAGGG
CAGAGTTGGCAGCAATTATATTTGAGACAAATGTGTTGGGATTTAAAGGT
CCTCGAAAAATGACCATAATTATTCCGGGAATGACACCAATGAAGACACC
GATTGATTTTCAGCCTAAATTTGGCGAAGATGATCTTCTTGAACACAGCA
GAACGCGGAAATTGGACAATTTACTTGAATTACATAATAAAAAACCCGTG
TGGAACGAAGATTCCCAATCATATGTGCTCAATTTCCACGGACGAGTAAC
CCAGGCTTCGGTGAAAAATTTTCAAATCGTCCATGACAATGACGCCGAGT
ATATCATAATGCAATTCGGTCGGACATCAGATCATTCGTTTACCATGGAT
TTTGCCTATCCTCTTTCTGCTGTTCAAGCATTTGGAATTGCTCTCTCGTC
GTTTGATGGGAAATTAGCATGTGAATGATGGGATATGAAACTGAATAAAA
TCCACATTCTAAATATTTATTGCACCAACATGTACATAAATGACATGATA
AATTTTTAATTCTATTTTATTTATTTGGACTGAAAAATAATAATAAATAG
GAATATTTTCAG
back to top

protein sequence of SMED30028737-orf-1

>SMED30028737-orf-1 ID=SMED30028737-orf-1|Name=SMED30028737-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=500bp
MSSEARQRKLNQQRQKIRDNQNKKHIQQLKSIQINDNEAILNFNFLSVKE
ETSLLVKNSSSENQISGKFAYDGPQSFELANIYNSHDSEIEIYHLNDPTI
TEKSLIIEKSHKSDSVKKESRNKNSNKEMGTKAGFNYSKHNARENNNDFE
TQIGMNDVTDGSEKLSAGVNQSESSILRDGINTIESTENDLDSSANISNV
AVSPYNATSKQSDVCSSGDVDSIPHDIADEENFHSFPEHILDSNLEIESF
VSKPAPQDCVVKCRITRDKSGMDKGMYPTYYLHLERKNAKPLFLLAARRR
KYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVN
SSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGE
DDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQI
VHDNDAEYIIMQFGRTSDHSFTMDFAYPLSAVQAFGIALSSFDGKLACE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR025659Tubby-like_C
IPR000007Tubby_C
IPR018066Tubby_C_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000007Tubby, C-terminalPRINTSPR01573SUPERTUBBYcoord: 418..435
score: 62.63
coord: 324..348
score: 45.64
coord: 308..324
score: 40.11
coord: 357..384
score: 58.12
coord: 436..452
score: 85.29
coord: 477..499
score: 80.24
coord: 456..475
score: 46.36
IPR000007Tubby, C-terminalPFAMPF01167Tubcoord: 253..493
e-value: 3.3E-85
score: 285.7
IPR025659Tubby-like, C-terminalGENE3DG3DSA:3.20.90.10coord: 242..499
e-value: 7.2E-110
score: 368.4
IPR025659Tubby-like, C-terminalSUPERFAMILYSSF54518Tubby C-terminal domain-likecoord: 244..499
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 110..126
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 110..131
NoneNo IPR availablePANTHERPTHR16517TUBBY-RELATEDcoord: 4..499
NoneNo IPR availablePANTHERPTHR16517:SF20TUBBY PROTEIN HOMOLOGcoord: 4..499
IPR018066Tubby, C-terminal, conserved sitePROSITEPS01201TUB_2coord: 484..499
IPR018066Tubby, C-terminal, conserved sitePROSITEPS01200TUB_1coord: 436..449