PREP homeodomain-like protein

Overview
NamePREP homeodomain-like protein (ADB54565.1)
Smed IDSMED30028733
Length (bp)2898
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PREP homeodomain-like protein (SMED30028733) t-SNE clustered cells

Violin plots show distribution of expression levels for PREP homeodomain-like protein (SMED30028733) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PREP homeodomain-like protein (SMED30028733) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PREP homeodomain-like protein (SMED30028733) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028733

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028733SMESG000013307.1 prepsmed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30028733SMESG000013309.1 SMESG000013307.1 dd_Smed_v4_8606_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30028733SMESG000013307.1 prepsmed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30028733SMESG000013307.1 SmedASXL_011380SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
anterior tipSMED30028733SMESG000013307.1 prepsmed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30028733SMESG000013307.1 prepsmed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30028733SMESG000013309.1 SMESG000013307.1 dd_Smed_v4_8606_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30028733SMESG000013309.1 SMESG000013307.1 dd_Smed_v6_8606_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30028733SMESG000013307.1 OX_Smed_1.0.23033ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
headSMED30028733SMESG000013307.1 GU290186.1smed_ncbi_20200123PMID:20422023
Felix et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30028733SMESG000013307.1 GU290186smed_ncbi_20200123PMID:20422023
Felix et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028733SMESG000013309.1 SMESG000013307.1 dd_Smed_v4_8606_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30028733SMESG000013307.1 prepsmed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
anterior pole cellSMED30028733SMESG000013307.1 prepsmed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PREP homeodomain-like protein vs. Ensembl Human
Match: PKNOX2 (PBX/knotted 1 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:16714])

HSP 1 Score: 219.55 bits (558), Expect = 7.071e-62
Identity = 156/383 (40.73%), Postives = 209/383 (54.57%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNG-----SNNSPPLSGMSLPDEIT-----NNNYLSSLASG---------NSRYSNLLD----PTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAV 1571
            LE +K+++Y HPL+P+L+LL E+CEQAT   +  +  +F+ D+++++ + +   K FF+D+ +LD+LMVKAIQVLRIHL+EL KVNELC+DFC+RYI CLKTK+                S+ L   +    G  Y SP      L  ++ L+ + N      M+ + N  Q       GI V       G     + NS  +SG +L   +T           ++  G         N   ++LLD     +K KRGVLPK AT IM+ WLFQHL+HPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPMLD+S            P+   K+                      KK  + +RP+  RFWP S+AA V
Sbjct:   67 LEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMH---------------SDNL---LRNDLGGPY-SPNQPSINLHSQDLLQNSPNS-----MSGVSNNPQ-------GIVVPASALQQGNIAMTTVNSQVVSGGALYQPVTMVTSQGQVVTQAIPQGAIQIQNTQVNLDLTSLLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASN-----------PDPAPKA----------------------KKIKSQHRPT-QRFWPNSIAAGV 384          
BLAST of PREP homeodomain-like protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 198.749 bits (504), Expect = 1.529e-55
Identity = 120/301 (39.87%), Postives = 175/301 (58.14%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K +IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S    A    SS          R++ + T+ H                ++   G S       +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   60 LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSS---------WRDHDDATSTH----------------SAGTPGPSSGGHASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 326          
BLAST of PREP homeodomain-like protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 198.749 bits (504), Expect = 1.529e-55
Identity = 120/301 (39.87%), Postives = 175/301 (58.14%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K +IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S    A    SS          R++ + T+ H                ++   G S       +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   60 LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSS---------WRDHDDATSTH----------------SAGTPGPSSGGHASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 326          
BLAST of PREP homeodomain-like protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 198.749 bits (504), Expect = 2.143e-55
Identity = 120/301 (39.87%), Postives = 175/301 (58.14%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K +IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S    A    SS          R++ + T+ H                ++   G S       +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   60 LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSS---------WRDHDDATSTH----------------SAGTPGPSSGGHASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 326          
BLAST of PREP homeodomain-like protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 198.749 bits (504), Expect = 2.782e-55
Identity = 120/301 (39.87%), Postives = 175/301 (58.14%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K +IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S    A    SS          R++ + T+ H                ++   G S       +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   73 LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSS---------WRDHDDATSTH----------------SAGTPGPSSGGHASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 339          
BLAST of PREP homeodomain-like protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 188.348 bits (477), Expect = 6.907e-51
Identity = 127/383 (33.16%), Postives = 196/383 (51.17%), Query Frame = 3
Query:  423 NLMQDIQKYPTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPD-----------TFEADLQSYILRN-DNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTK-----IQXXXXXXXXXXXXPNGSERL----SPSILTGAGSV-YSSPYNSQT-------GLMGRNYLELTN-------------------NHRHQHMMNQIHNMEQNCNS--TINGISVDCMDYMNGSN---NSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQK------------RG--VLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            NL  ++   PT T +   +    ++++K+SIY HPLYP+L LL E+CE AT++P   S D           +F+ DL  ++    +N +K ++  N  LD +M+++IQ+LR HL+EL KV+ELC +FC+RY+ CLK K     +  +         SP     L    SPS+  GA  + Y  PY  Q+       G+MG + +E ++                   N    H +     +     +  T+  I+V      +      +S PLSG + P    N N + S++      ++    +K K            RG  + PK+AT  ++QWLFQ+L HPYP+E++K+Q+A +T LT+LQVNNWFINARRRI+QPM+
Sbjct:   33 NLYTNMGGAPTSTPMMHHEMGEAMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNPQLDQIMLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDERASSSQPPMSPGSMGHLGHSSSPSMAGGATPMHYPPPYEPQSVPLPENAGVMGGHPMEGSSMAYSMAGMAAAAASSSSSSNQAGDHPLANGGTLHSTAGASQTLLPIAVSSPSTCSSGGLRQDSTPLSGET-PMGHANGNSMDSISEAAPSSASSSSSSKNKPSTPNGGRIGKSRGRGIFPKQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 414          
BLAST of PREP homeodomain-like protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 188.348 bits (477), Expect = 1.380e-50
Identity = 127/383 (33.16%), Postives = 196/383 (51.17%), Query Frame = 3
Query:  423 NLMQDIQKYPTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPD-----------TFEADLQSYILRN-DNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTK-----IQXXXXXXXXXXXXPNGSERL----SPSILTGAGSV-YSSPYNSQT-------GLMGRNYLELTN-------------------NHRHQHMMNQIHNMEQNCNS--TINGISVDCMDYMNGSN---NSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQK------------RG--VLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            NL  ++   PT T +   +    ++++K+SIY HPLYP+L LL E+CE AT++P   S D           +F+ DL  ++    +N +K ++  N  LD +M+++IQ+LR HL+EL KV+ELC +FC+RY+ CLK K     +  +         SP     L    SPS+  GA  + Y  PY  Q+       G+MG + +E ++                   N    H +     +     +  T+  I+V      +      +S PLSG + P    N N + S++      ++    +K K            RG  + PK+AT  ++QWLFQ+L HPYP+E++K+Q+A +T LT+LQVNNWFINARRRI+QPM+
Sbjct:   70 NLYTNMGGAPTSTPMMHHEMGEAMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNPQLDQIMLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDERASSSQPPMSPGSMGHLGHSSSPSMAGGATPMHYPPPYEPQSVPLPENAGVMGGHPMEGSSMAYSMAGMAAAAASSSSSSNQAGDHPLANGGTLHSTAGASQTLLPIAVSSPSTCSSGGLRQDSTPLSGET-PMGHANGNSMDSISEAAPSSASSSSSSKNKPSTPNGGRIGKSRGRGIFPKQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 451          
BLAST of PREP homeodomain-like protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 185.652 bits (470), Expect = 2.627e-50
Identity = 125/374 (33.42%), Postives = 192/374 (51.34%), Query Frame = 3
Query:  450 PTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPD-----------TFEADLQSYILRN-DNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTK-----IQXXXXXXXXXXXXPNGSERL----SPSILTGAGSV-YSSPYNSQT-------GLMGRNYLELTN-------------------NHRHQHMMNQIHNMEQNCNS--TINGISVDCMDYMNGSN---NSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQK------------RG--VLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            PT T +   +    ++++K+SIY HPLYP+L LL E+CE AT++P   S D           +F+ DL  ++    +N +K ++  N  LD +M+++IQ+LR HL+EL KV+ELC +FC+RY+ CLK K     +  +         SP     L    SPS+  GA  + Y  PY  Q+       G+MG + +E ++                   N    H +     +     +  T+  I+V      +      +S PLSG + P    N N + S++      ++    +K K            RG  + PK+AT  ++QWLFQ+L HPYP+E++K+Q+A +T LT+LQVNNWFINARRRI+QPM+
Sbjct:    5 PTSTPMMHHEMGEAMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNPQLDQIMLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDERASSSQPPMSPGSMGHLGHSSSPSMAGGATPMHYPPPYEPQSVPLPENAGVMGGHPMEGSSMAYSMAGMAAAAASSSSSSNQAGDHPLANGGTLHSTAGASQTLLPIAVSSPSTCSSGGLRQDSTPLSGET-PMGHANGNSMDSISEAAPSSASSSSSSKNKPSTPNGGRIGKSRGRGIFPKQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 377          
BLAST of PREP homeodomain-like protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 180.644 bits (457), Expect = 3.296e-48
Identity = 122/387 (31.52%), Postives = 192/387 (49.61%), Query Frame = 3
Query:  423 NLMQDIQKYPTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPD-----------TFEADLQSYILRN-DNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTK-----IQXXXXXXXXXXXXPNGSERL----SPSILTGAGSV-YSSPYNSQT-------GLMGRNYLELTN-------------------NHRHQHMMNQIHNMEQNCNS--TINGISVDCMDYMNGSN---NSPPLSGMSLPDEITNNNYLSSLASGNSRYS----------NLLDPT--------KQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            NL  ++   PT T +   +    ++++K+SIY HPLYP+L LL E+CE AT++P   S D           +F+ DL  ++    +N +K ++  N  LD +M+++IQ+LR HL+EL KV+ELC +FC+RY+ CLK K     +  +         SP     L    SPS+  GA  + Y  PY  Q+       G+MG + +E ++                   N    H +     +     +  T+  I+V      +      +S PLSG + P    N N + S++     +S          ++L  +        ++   V  K+A    + WLF +L HPYP+E++K+Q+A +T LT+LQVNNWFINARRRI+QPM+
Sbjct:   33 NLYTNMGGAPTSTPMMHHEMGEAMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNPQLDQIMLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDERASSSQPPMSPGSMGHLGHSSSPSMAGGATPMHYPPPYEPQSVPLPENAGVMGGHPMEGSSMAYSMAGMAAAAASSSSSSNQAGDHPLANGGTLHSTAGASQTLLPIAVSSPSTCSSGGLRQDSTPLSGET-PMGHANGNSMDSISEAGDEFSVCGSNDDGRDSVLSDSANGSQNGKRKVPKVFSKEAITKFRAWLFHNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 418          
BLAST of PREP homeodomain-like protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 180.644 bits (457), Expect = 3.296e-48
Identity = 122/387 (31.52%), Postives = 192/387 (49.61%), Query Frame = 3
Query:  423 NLMQDIQKYPTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPD-----------TFEADLQSYILRN-DNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTK-----IQXXXXXXXXXXXXPNGSERL----SPSILTGAGSV-YSSPYNSQT-------GLMGRNYLELTN-------------------NHRHQHMMNQIHNMEQNCNS--TINGISVDCMDYMNGSN---NSPPLSGMSLPDEITNNNYLSSLASGNSRYS----------NLLDPT--------KQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            NL  ++   PT T +   +    ++++K+SIY HPLYP+L LL E+CE AT++P   S D           +F+ DL  ++    +N +K ++  N  LD +M+++IQ+LR HL+EL KV+ELC +FC+RY+ CLK K     +  +         SP     L    SPS+  GA  + Y  PY  Q+       G+MG + +E ++                   N    H +     +     +  T+  I+V      +      +S PLSG + P    N N + S++     +S          ++L  +        ++   V  K+A    + WLF +L HPYP+E++K+Q+A +T LT+LQVNNWFINARRRI+QPM+
Sbjct:   33 NLYTNMGGAPTSTPMMHHEMGEAMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNPQLDQIMLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDERASSSQPPMSPGSMGHLGHSSSPSMAGGATPMHYPPPYEPQSVPLPENAGVMGGHPMEGSSMAYSMAGMAAAAASSSSSSNQAGDHPLANGGTLHSTAGASQTLLPIAVSSPSTCSSGGLRQDSTPLSGET-PMGHANGNSMDSISEAGDEFSVCGSNDDGRDSVLSDSANGSQNGKRKVPKVFSKEAITKFRAWLFHNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 418          
BLAST of PREP homeodomain-like protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0344145)

HSP 1 Score: 107.071 bits (266), Expect = 2.336e-25
Identity = 50/111 (45.05%), Postives = 78/111 (70.27%), Query Frame = 3
Query:  495 EKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKI 803
            +++K +IY HPL+P+L+L+ E+CE AT +P        D  S ++F  D+  +  +   ++K ++T + ++DSLMV+AIQVLR HL+EL KV+ELC +FC RYI+CLK K+
Sbjct:   91 KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFS-KQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKM 200          
BLAST of PREP homeodomain-like protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0100455)

HSP 1 Score: 107.071 bits (266), Expect = 2.336e-25
Identity = 50/111 (45.05%), Postives = 78/111 (70.27%), Query Frame = 3
Query:  495 EKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKI 803
            +++K +IY HPL+P+L+L+ E+CE AT +P        D  S ++F  D+  +  +   ++K ++T + ++DSLMV+AIQVLR HL+EL KV+ELC +FC RYI+CLK K+
Sbjct:   91 KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFS-KQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKM 200          
BLAST of PREP homeodomain-like protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0100454)

HSP 1 Score: 106.686 bits (265), Expect = 3.867e-25
Identity = 50/111 (45.05%), Postives = 78/111 (70.27%), Query Frame = 3
Query:  495 EKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKI 803
            +++K +IY HPL+P+L+L+ E+CE AT +P        D  S ++F  D+  +  +   ++K ++T + ++DSLMV+AIQVLR HL+EL KV+ELC +FC RYI+CLK K+
Sbjct:   91 KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFS-KQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKM 200          
BLAST of PREP homeodomain-like protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082256)

HSP 1 Score: 110.153 bits (274), Expect = 6.032e-25
Identity = 50/100 (50.00%), Postives = 66/100 (66.00%), Query Frame = 3
Query: 1071 NSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
             SP   G S   + +N +  S   +G           ++KRG+ PK AT I++ WLFQHL HPYP+ED+K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:  314 GSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 413          

HSP 2 Score: 107.842 bits (268), Expect = 3.566e-24
Identity = 50/111 (45.05%), Postives = 78/111 (70.27%), Query Frame = 3
Query:  495 EKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKI 803
            +++K +IY HPL+P+L+L+ E+CE AT +P        D  S ++F  D+  +  +   ++K ++T + ++DSLMV+AIQVLR HL+EL KV+ELC +FC RYI+CLK K+
Sbjct:   91 KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFS-KQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKM 200          
BLAST of PREP homeodomain-like protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082255)

HSP 1 Score: 110.153 bits (274), Expect = 7.310e-25
Identity = 50/100 (50.00%), Postives = 66/100 (66.00%), Query Frame = 3
Query: 1071 NSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
             SP   G S   + +N +  S   +G           ++KRG+ PK AT I++ WLFQHL HPYP+ED+K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:  329 GSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 428          

HSP 2 Score: 107.842 bits (268), Expect = 4.332e-24
Identity = 50/111 (45.05%), Postives = 78/111 (70.27%), Query Frame = 3
Query:  495 EKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKI 803
            +++K +IY HPL+P+L+L+ E+CE AT +P        D  S ++F  D+  +  +   ++K ++T + ++DSLMV+AIQVLR HL+EL KV+ELC +FC RYI+CLK K+
Sbjct:   91 KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFS-KQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKM 200          
BLAST of PREP homeodomain-like protein vs. Ensembl Zebrafish
Match: pknox1.2 (pbx/knotted 1 homeobox 1.2 [Source:ZFIN;Acc:ZDB-GENE-020123-1])

HSP 1 Score: 217.238 bits (552), Expect = 1.493e-61
Identity = 147/382 (38.48%), Postives = 202/382 (52.88%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTG-AGSVYS----SPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSR----------------YSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAVN 1574
            +E  K +IY HPL+P+L+LL E+CEQ+T S +  +  +F+ D+++++   +   K FF+++ DLD+LMVKAIQVLRIHL+EL KVN+LC+DFCSRYI CLKTK+                    S ++L+G  GS YS     P N  TG M    + +  +   Q             N T+  ++   M  + G     P++ ++   ++       +L+ G  R                +S     +K KRG+LPK AT +M+ WLFQH+ HPYPTEDEK+QIA QTNLTLLQVNNWFINARRRILQPMLD+S                                  +S     KKK    RP   RFWP SLA++V+
Sbjct:   62 MEVYKSAIYRHPLFPLLALLFEKCEQSTQSSECVTSASFDVDIENFVRNQEKEGKAFFSEDPDLDNLMVKAIQVLRIHLLELEKVNDLCKDFCSRYIACLKTKMN-------------------SETLLSGDPGSPYSPSPTQPQNPFTGAMSPQGIVVPASALQQG------------NVTVTAVNPTQM--VTGGTVYQPVTVVTPQGQVVTQ----TLSPGTVRIQNSQLQLQLNQDLSFFSQEDGSSKAKRGILPKHATNVMRSWLFQHIGHPYPTEDEKKQIALQTNLTLLQVNNWFINARRRILQPMLDAS----------------------------------SSDTPKSKKKTPQTRPL-QRFWPNSLASSVS 371          
BLAST of PREP homeodomain-like protein vs. Ensembl Zebrafish
Match: meis1a (Meis homeobox 1 a [Source:ZFIN;Acc:ZDB-GENE-020122-3])

HSP 1 Score: 198.749 bits (504), Expect = 1.153e-55
Identity = 120/300 (40.00%), Postives = 174/300 (58.00%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP-------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K +IYGHPL+P+L+L+ E+CE AT +P       D  S ++F+ D+  +  +    EK FF+ N DLD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + DD E  S +  E  +     G+  V+    ++ +       +  T+        +  HN +   NS+ +G      D+++ S  SP       PD+   NN                    +KRG+ PK AT IM+ WLFQHL HPYP+E++KRQ++  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   63 LKRDKDAIYGHPLFPLLALVFEKCELATCTPRESGVTGDVCSSESFDEDITVFS-KQIRAEKPFFSSNPDLDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVVDDKEGGSRSDGEEFT-RTPGGSEQVFWREDDTAS-------VHSTDTPAACGRRSSSHNGD---NSSEHG------DFLDQSVASPSTGEEEDPDKERKNN--------------------KKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKRQLSQDTGLTILQVNNWFINARRRIVQPMI 324          
BLAST of PREP homeodomain-like protein vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 198.749 bits (504), Expect = 1.302e-55
Identity = 119/301 (39.53%), Postives = 177/301 (58.80%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K  IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S      S   + +N  +    R++ + T+ H                ++   G S   +   +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   69 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGS------STNLADHNPASW---RDHDDATSTH----------------SAGTPGPSSGGLASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 335          
BLAST of PREP homeodomain-like protein vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 198.749 bits (504), Expect = 1.683e-55
Identity = 119/301 (39.53%), Postives = 177/301 (58.80%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K  IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S      S   + +N  +    R++ + T+ H                ++   G S   +   +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   69 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGS------STNLADHNPASW---RDHDDATSTH----------------SAGTPGPSSGGLASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 335          
BLAST of PREP homeodomain-like protein vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 198.364 bits (503), Expect = 2.053e-55
Identity = 119/301 (39.53%), Postives = 177/301 (58.80%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K  IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S      S   + +N  +    R++ + T+ H                ++   G S   +   +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   68 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGS------STNLADHNPASW---RDHDDATSTH----------------SAGTPGPSSGGLASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 334          
BLAST of PREP homeodomain-like protein vs. Ensembl Xenopus
Match: pde4dip (phosphodiesterase 4D interacting protein [Source:Xenbase;Acc:XB-GENE-982015])

HSP 1 Score: 219.55 bits (558), Expect = 2.488e-62
Identity = 154/369 (41.73%), Postives = 213/369 (57.72%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLS-----GMSLPDEITNNNYLSSLASGNSRYSNLLD----PTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAV 1571
            LE +K+++Y HPL+P+L+LL E+CEQAT   +  +  +F+ D+++++ + +   K FF+++ +LD+LMVKAIQVLRIHL+EL KVNELC+DFC+RYI CLKTK+        ++   P    + S S+ T    + +SP NS TG        L+NN   Q ++     ++Q     I+  +V+    ++G     P++     G  +   I         A  N   ++LLD     +K KRGVLPK AT IM+ WLFQHL+HPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPMLD+S            P+   K+                      KK  + +RP+  RFWP S+AA V
Sbjct:   66 LEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSEDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMH-SDNLLRNDLGGPYSPNQPSNSLHT-QDMLQNSP-NSMTG--------LSNN--PQGIVVPASALQQ---GNISMTTVNSSQVVSGGALYQPVAMVTSQGQVVTQAIPQGAIQIQNAQVNLELTSLLDSEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASN-----------PDPAPKA----------------------KKIKSQHRPT-QRFWPNSIAAGV 384          
BLAST of PREP homeodomain-like protein vs. Ensembl Xenopus
Match: pde4dip (phosphodiesterase 4D interacting protein [Source:Xenbase;Acc:XB-GENE-982015])

HSP 1 Score: 219.55 bits (558), Expect = 3.165e-62
Identity = 154/369 (41.73%), Postives = 213/369 (57.72%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLS-----GMSLPDEITNNNYLSSLASGNSRYSNLLD----PTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAV 1571
            LE +K+++Y HPL+P+L+LL E+CEQAT   +  +  +F+ D+++++ + +   K FF+++ +LD+LMVKAIQVLRIHL+EL KVNELC+DFC+RYI CLKTK+        ++   P    + S S+ T    + +SP NS TG        L+NN   Q ++     ++Q     I+  +V+    ++G     P++     G  +   I         A  N   ++LLD     +K KRGVLPK AT IM+ WLFQHL+HPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPMLD+S            P+   K+                      KK  + +RP+  RFWP S+AA V
Sbjct:   66 LEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSEDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMH-SDNLLRNDLGGPYSPNQPSNSLHT-QDMLQNSP-NSMTG--------LSNN--PQGIVVPASALQQ---GNISMTTVNSSQVVSGGALYQPVAMVTSQGQVVTQAIPQGAIQIQNAQVNLELTSLLDSEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASN-----------PDPAPKA----------------------KKIKSQHRPT-QRFWPNSIAAGV 384          
BLAST of PREP homeodomain-like protein vs. Ensembl Xenopus
Match: pde4dip (phosphodiesterase 4D interacting protein [Source:Xenbase;Acc:XB-GENE-982015])

HSP 1 Score: 219.935 bits (559), Expect = 4.326e-62
Identity = 154/369 (41.73%), Postives = 213/369 (57.72%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLS-----GMSLPDEITNNNYLSSLASGNSRYSNLLD----PTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAV 1571
            LE +K+++Y HPL+P+L+LL E+CEQAT   +  +  +F+ D+++++ + +   K FF+++ +LD+LMVKAIQVLRIHL+EL KVNELC+DFC+RYI CLKTK+        ++   P    + S S+ T    + +SP NS TG        L+NN   Q ++     ++Q     I+  +V+    ++G     P++     G  +   I         A  N   ++LLD     +K KRGVLPK AT IM+ WLFQHL+HPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPMLD+S            P+   K+                      KK  + +RP+  RFWP S+AA V
Sbjct:   66 LEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSEDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMH-SDNLLRNDLGGPYSPNQPSNSLHT-QDMLQNSP-NSMTG--------LSNN--PQGIVVPASALQQ---GNISMTTVNSSQVVSGGALYQPVAMVTSQGQVVTQAIPQGAIQIQNAQVNLELTSLLDSEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASN-----------PDPAPKA----------------------KKIKSQHRPT-QRFWPNSIAAGV 384          
BLAST of PREP homeodomain-like protein vs. Ensembl Xenopus
Match: meis3 (Meis homeobox 3 [Source:NCBI gene;Acc:448474])

HSP 1 Score: 205.297 bits (521), Expect = 4.823e-57
Identity = 123/304 (40.46%), Postives = 172/304 (56.58%), Query Frame = 3
Query:  489 GLEKEKKSIYGHPLYPILSLLLEQCEQATASP----------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            GL++EK  IYGHPL+P+L+L+ E+CE AT SP          D  S D+F  D+  +  +    EK  F+ N +LDSLM++AIQVLR HL+EL KV++LC +FC RYI CLK K+  D + DD      +GS +      TG+ +  S   NS      R++ E  + H                 S   G S   +   +G N+S     M        +N ++S ++G+    +      +KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   62 GLKREKDEIYGHPLFPLLALVFEKCELATCSPRDNSGSFPGGDVCSSDSFNEDIAVFA-KQVRTEKPLFSSNPELDSLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIDDR-----DGSSKSDLEDFTGSCTSLSDQNNSWI----RDHDETGSTH-----------------SGTPGPSSGGLASQSGDNSSEQGDCM--------DNSVASPSTGDDDDLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 330          
BLAST of PREP homeodomain-like protein vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 192.586 bits (488), Expect = 2.928e-53
Identity = 117/301 (38.87%), Postives = 170/301 (56.48%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K +IYGHPL+P+L+L+ E+CE AT +P        D  S ++F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + +D E  S + SE ++ S   G  S +SS       L   +    T +       +  H      NS+  G  +D                          N ++S ++G+    +      +KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   71 LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFA-KQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIEDREGGSKSDSEDMTRS---GNISEFSS-------LGDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLD--------------------------NSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 334          
BLAST of PREP homeodomain-like protein vs. Ensembl Mouse
Match: Pknox2 (Pbx/knotted 1 homeobox 2 [Source:MGI Symbol;Acc:MGI:2445415])

HSP 1 Score: 219.164 bits (557), Expect = 6.519e-62
Identity = 156/383 (40.73%), Postives = 209/383 (54.57%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNG-----SNNSPPLSGMSLPDEIT-----NNNYLSSLASG---------NSRYSNLLD----PTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAV 1571
            LE +K+++Y HPL+P+L+LL E+CEQAT   +  +  +F+ D+++++ + +   K FF+D+ +LD+LMVKAIQVLRIHL+EL KVNELC+DFC+RYI CLKTK+                S+ L   +    G  Y SP      L  ++ L+ + N      M+ + N  Q       GI V       G     + NS  +SG +L   +T           ++  G         N   ++LLD     +K KRGVLPK AT IM+ WLFQHL+HPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPMLD+S            P+   K+                      KK  + +RP+  RFWP S+AA V
Sbjct:   67 LEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMH---------------SDNL---LRNDLGGPY-SPNQPSINLHSQDLLQNSPNS-----MSGVSNNPQ-------GIVVPASALQQGNIAMTTVNSQVVSGGALYQPVTMVTSQGQVVTQAIPQGAIQIQNTQVNLDLTSLLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASN-----------PDPAPKA----------------------KKIKSQHRPT-QRFWPNSIAAGV 384          
BLAST of PREP homeodomain-like protein vs. Ensembl Mouse
Match: Pknox2 (Pbx/knotted 1 homeobox 2 [Source:MGI Symbol;Acc:MGI:2445415])

HSP 1 Score: 219.164 bits (557), Expect = 6.519e-62
Identity = 156/383 (40.73%), Postives = 209/383 (54.57%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNG-----SNNSPPLSGMSLPDEIT-----NNNYLSSLASG---------NSRYSNLLD----PTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAV 1571
            LE +K+++Y HPL+P+L+LL E+CEQAT   +  +  +F+ D+++++ + +   K FF+D+ +LD+LMVKAIQVLRIHL+EL KVNELC+DFC+RYI CLKTK+                S+ L   +    G  Y SP      L  ++ L+ + N      M+ + N  Q       GI V       G     + NS  +SG +L   +T           ++  G         N   ++LLD     +K KRGVLPK AT IM+ WLFQHL+HPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPMLD+S            P+   K+                      KK  + +RP+  RFWP S+AA V
Sbjct:   67 LEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMH---------------SDNL---LRNDLGGPY-SPNQPSINLHSQDLLQNSPNS-----MSGVSNNPQ-------GIVVPASALQQGNIAMTTVNSQVVSGGALYQPVTMVTSQGQVVTQAIPQGAIQIQNTQVNLDLTSLLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASN-----------PDPAPKA----------------------KKIKSQHRPT-QRFWPNSIAAGV 384          
BLAST of PREP homeodomain-like protein vs. Ensembl Mouse
Match: Pknox2 (Pbx/knotted 1 homeobox 2 [Source:MGI Symbol;Acc:MGI:2445415])

HSP 1 Score: 219.164 bits (557), Expect = 6.519e-62
Identity = 156/383 (40.73%), Postives = 209/383 (54.57%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNG-----SNNSPPLSGMSLPDEIT-----NNNYLSSLASG---------NSRYSNLLD----PTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAV 1571
            LE +K+++Y HPL+P+L+LL E+CEQAT   +  +  +F+ D+++++ + +   K FF+D+ +LD+LMVKAIQVLRIHL+EL KVNELC+DFC+RYI CLKTK+                S+ L   +    G  Y SP      L  ++ L+ + N      M+ + N  Q       GI V       G     + NS  +SG +L   +T           ++  G         N   ++LLD     +K KRGVLPK AT IM+ WLFQHL+HPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPMLD+S            P+   K+                      KK  + +RP+  RFWP S+AA V
Sbjct:   67 LEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMH---------------SDNL---LRNDLGGPY-SPNQPSINLHSQDLLQNSPNS-----MSGVSNNPQ-------GIVVPASALQQGNIAMTTVNSQVVSGGALYQPVTMVTSQGQVVTQAIPQGAIQIQNTQVNLDLTSLLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASN-----------PDPAPKA----------------------KKIKSQHRPT-QRFWPNSIAAGV 384          
BLAST of PREP homeodomain-like protein vs. Ensembl Mouse
Match: Meis2 (Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564])

HSP 1 Score: 198.749 bits (504), Expect = 1.910e-55
Identity = 120/301 (39.87%), Postives = 175/301 (58.14%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K +IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S    A    SS          R++ + T+ H                ++   G S       +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   73 LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSS---------WRDHDDATSTH----------------SAGTPGPSSGGHASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 339          
BLAST of PREP homeodomain-like protein vs. Ensembl Mouse
Match: Meis2 (Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564])

HSP 1 Score: 198.364 bits (503), Expect = 1.955e-55
Identity = 120/301 (39.87%), Postives = 175/301 (58.14%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K +IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S    A    SS          R++ + T+ H                ++   G S       +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   72 LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSS---------WRDHDDATSTH----------------SAGTPGPSSGGHASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 338          
BLAST of PREP homeodomain-like protein vs. UniProt/SwissProt
Match: sp|Q96KN3|PKNX2_HUMAN (Homeobox protein PKNOX2 OS=Homo sapiens OX=9606 GN=PKNOX2 PE=1 SV=2)

HSP 1 Score: 219.55 bits (558), Expect = 3.396e-61
Identity = 156/383 (40.73%), Postives = 209/383 (54.57%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNG-----SNNSPPLSGMSLPDEIT-----NNNYLSSLASG---------NSRYSNLLD----PTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAV 1571
            LE +K+++Y HPL+P+L+LL E+CEQAT   +  +  +F+ D+++++ + +   K FF+D+ +LD+LMVKAIQVLRIHL+EL KVNELC+DFC+RYI CLKTK+                S+ L   +    G  Y SP      L  ++ L+ + N      M+ + N  Q       GI V       G     + NS  +SG +L   +T           ++  G         N   ++LLD     +K KRGVLPK AT IM+ WLFQHL+HPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPMLD+S            P+   K+                      KK  + +RP+  RFWP S+AA V
Sbjct:   67 LEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMH---------------SDNL---LRNDLGGPY-SPNQPSINLHSQDLLQNSPNS-----MSGVSNNPQ-------GIVVPASALQQGNIAMTTVNSQVVSGGALYQPVTMVTSQGQVVTQAIPQGAIQIQNTQVNLDLTSLLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASN-----------PDPAPKA----------------------KKIKSQHRPT-QRFWPNSIAAGV 384          
BLAST of PREP homeodomain-like protein vs. UniProt/SwissProt
Match: sp|Q8BG99|PKNX2_MOUSE (Homeobox protein PKNOX2 OS=Mus musculus OX=10090 GN=Pknox2 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 4.560e-61
Identity = 156/383 (40.73%), Postives = 209/383 (54.57%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNG-----SNNSPPLSGMSLPDEIT-----NNNYLSSLASG---------NSRYSNLLD----PTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAV 1571
            LE +K+++Y HPL+P+L+LL E+CEQAT   +  +  +F+ D+++++ + +   K FF+D+ +LD+LMVKAIQVLRIHL+EL KVNELC+DFC+RYI CLKTK+                S+ L   +    G  Y SP      L  ++ L+ + N      M+ + N  Q       GI V       G     + NS  +SG +L   +T           ++  G         N   ++LLD     +K KRGVLPK AT IM+ WLFQHL+HPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPMLD+S            P+   K+                      KK  + +RP+  RFWP S+AA V
Sbjct:   67 LEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMH---------------SDNL---LRNDLGGPY-SPNQPSINLHSQDLLQNSPNS-----MSGVSNNPQ-------GIVVPASALQQGNIAMTTVNSQVVSGGALYQPVTMVTSQGQVVTQAIPQGAIQIQNTQVNLDLTSLLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASN-----------PDPAPKA----------------------KKIKSQHRPT-QRFWPNSIAAGV 384          
BLAST of PREP homeodomain-like protein vs. UniProt/SwissProt
Match: sp|Q5R6L1|PKNX2_PONAB (Homeobox protein PKNOX2 OS=Pongo abelii OX=9601 GN=PKNOX2 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 5.505e-61
Identity = 155/383 (40.47%), Postives = 209/383 (54.57%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNG-----SNNSPPLSGMSLPDEIT-----NNNYLSSLASG---------NSRYSNLLD----PTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAV 1571
            LE +K+++Y HPL+P+L+LL E+CEQAT   +  +  +F+ D+++++ + +   K FF+D+ +LD+LMVKAIQVLRIHL+EL KVNELC+DFC+RYI CLKTK+                S+ L   +    G  Y SP      L  ++ L+ + N      M+ + N  Q       GI V       G     + NS  +SG +L   +T           ++  G         N   ++LLD     +K KRGVLPK AT IM+ WLFQHL+HPYPTEDEKRQIA QTNLTLLQVNNWF+NARRRILQPMLD+S            P+   K+                      KK  + +RP+  RFWP S+AA V
Sbjct:   67 LEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMH---------------SDNL---LRNDLGGPY-SPNQPSINLHSQDLLQNSPNS-----MSGVSNNPQ-------GIVVPASALQQGNIAMTTVNSQVVSGGALYQPVTMVTSQGQVVTQAIPQGAIQIQNTQVNLDLTSLLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFVNARRRILQPMLDASN-----------PDPAPKA----------------------KKIKSQHRPT-QRFWPNSIAAGV 384          
BLAST of PREP homeodomain-like protein vs. UniProt/SwissProt
Match: sp|Q6DIF3|MEIS3_XENTR (Homeobox protein meis3 OS=Xenopus tropicalis OX=8364 GN=meis3 PE=2 SV=2)

HSP 1 Score: 205.297 bits (521), Expect = 2.555e-56
Identity = 123/304 (40.46%), Postives = 172/304 (56.58%), Query Frame = 3
Query:  489 GLEKEKKSIYGHPLYPILSLLLEQCEQATASP----------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            GL++EK  IYGHPL+P+L+L+ E+CE AT SP          D  S D+F  D+  +  +    EK  F+ N +LDSLM++AIQVLR HL+EL KV++LC +FC RYI CLK K+  D + DD      +GS +      TG+ +  S   NS      R++ E  + H                 S   G S   +   +G N+S     M        +N ++S ++G+    +      +KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   62 GLKREKDEIYGHPLFPLLALVFEKCELATCSPRDNSGSFPGGDVCSSDSFNEDIAVFA-KQVRTEKPLFSSNPELDSLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIDDR-----DGSSKSDLEDFTGSCTSLSDQNNSWI----RDHDETGSTH-----------------SGTPGPSSGGLASQSGDNSSEQGDCM--------DNSVASPSTGDDDDLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 330          
BLAST of PREP homeodomain-like protein vs. UniProt/SwissProt
Match: sp|Q5U4X3|MEI3A_XENLA (Homeobox protein meis3-A OS=Xenopus laevis OX=8355 GN=meis3-a PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 4.633e-56
Identity = 123/304 (40.46%), Postives = 172/304 (56.58%), Query Frame = 3
Query:  489 GLEKEKKSIYGHPLYPILSLLLEQCEQATASP----------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            GL++EK  IYGHPL+P+L+L+ E+CE AT SP          D  S D+F  D+  +  +    EK  F+ N +LDSLM++AIQVLR HL+EL KV++LC +FC RYI CLK K+  D + DD      +GS +      TG+ +  S   NS      R++ E  + H                 S   G S   +   +G N+S     M        +N ++S ++G+    +      +KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   62 GLKREKDEIYGHPLFPLLALVFEKCELATCSPRDNSGSFPGGDVCSSDSFNEDIAVFA-KQVRTEKPLFSSNPELDSLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIDDR-----DGSSKSDLEDFTGSCTSLSDQNNSWL----RDHDETGSAH-----------------SGTPGPSSGGLASQSGDNSSEQGDCM--------DNSVASPSTGDDDDLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 330          
BLAST of PREP homeodomain-like protein vs. TrEMBL
Match: D2Y165 (PREP homeodomain-like protein OS=Schmidtea mediterranea OX=79327 GN=prep PE=2 SV=1)

HSP 1 Score: 1363.21 bits (3527), Expect = 0.000e+0
Identity = 713/715 (99.72%), Postives = 715/715 (100.00%), Query Frame = 3
Query:  429 MQDIQKYPTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAVNMLSCHASMSGCTSTSPMTTVASGHSTPKMVSQLDSQGIXXXXXXXXXXXXNKRTKTSPPSTEIYQPPKLFIPNKHSYDNCMNDSDFKLRMKDETSSNQSTPLFTDLRSPNHSKSACIEDNERNKSELFTMSTPINSTAHSNKSTSPKTTNELKKTSKAAFFQSYFSSTKTTNPHSHELSTASLFPPNPCSYGSSNPYANMIMPQSNPYLAHSAVIYNASLHHAVTQGDPNSLFNIRPPNPHSFPIYDSIYTGYDNLIDKRTNMVSHINDLFTNPGTLNRSWEEQQGILNPIHRSHYNQLENSPYLPMKSEFMDRLPESNSVFNHSYSNIDTFS 2573
            MQDIQKYPTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQSDSMFDDSEESSPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLDSSGSPGKDKSSNSLPNKQDKSDSVSESEDMSVGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAVNMLSCHASMSGCTSTSPMTTVASGHSTPKMVSQLDSQGISCSHYSEPSPSSNKRTKTSPPSTEIYQPPKLFIPNKHSYDNCMNDSDFKLRMKDETSSNQSTPLFTDLRSPNHSKSACIEDNERNKSELFTMSTPINSTAHSNKSTSPKTTNELKKTSKAAFFQSYFSSTKTTNPHSHELSTA+LFPPNPCSYGSSNPYANMIMPQSNPYLAHSAVIYNASLHHAVTQGDPNSLFNIRPPNPHSFPIYDS+YTGYDNLIDKRTNMVSHINDLFTNPGTLNRSWEEQQGILNPIHRSHYNQLENSPYLPMKSEFMDRLPESNSVFNHSYSNIDTFS
Sbjct:    1 MQDIQKYPTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQSDSMFDDSEESSPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLDSSGSPGKDKSSNSLPNKQDKSDSVSESEDMSVGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAVNMLSCHASMSGCTSTSPMTTVASGHSTPKMVSQLDSQGISCSHYSEPSPSSNKRTKTSPPSTEIYQPPKLFIPNKHSYDNCMNDSDFKLRMKDETSSNQSTPLFTDLRSPNHSKSACIEDNERNKSELFTMSTPINSTAHSNKSTSPKTTNELKKTSKAAFFQSYFSSTKTTNPHSHELSTANLFPPNPCSYGSSNPYANMIMPQSNPYLAHSAVIYNASLHHAVTQGDPNSLFNIRPPNPHSFPIYDSMYTGYDNLIDKRTNMVSHINDLFTNPGTLNRSWEEQQGILNPIHRSHYNQLENSPYLPMKSEFMDRLPESNSVFNHSYSNIDTFS 715          
BLAST of PREP homeodomain-like protein vs. TrEMBL
Match: T1DF70 (PREP-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 466/736 (63.32%), Postives = 570/736 (77.45%), Query Frame = 3
Query:  429 MQDIQKYPTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNS-RYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAVNMLSCHASMSGCTSTSPMTTVASGHSTPKMVSQLDSQGIXXXXXXXXXXXXNKRTKTSPPSTEIYQPPKLFIPNKHSYDNCMNDSDFKLRMKDETS-SNQSTPLFTDLRSPNHSKSACIEDNERNKSELFTMSTPINSTAHSNKSTSPKTTNELKKTSKAAFFQSYFSSTKTTNPHSHELSTASLFPPNPCSYGSSNPYANMIMPQSNPYLAHSAVIYNASLHHAVTQGDPNS----LFNIRPPNPHSFPIYDSIYTGYDNLIDKRTNMVSHINDLFTNPGTLNRSWEEQQGILNPIHRSHYNQLENSPYLPMKSEFMDRLPESNSVFNHSYSNIDTFSNLSMKPAFHSKTNTN 2618
            MQDIQKYPTVTSLQ+QQADPGLEKEKKSIY HPLYP+LSLLLEQCEQAT+SPDSQSPDTF+ADLQSYI R++ N+K FFTDN DLDSL+VKAIQVLRIHL ELRKVNELCRDFC+RYI+CLKTKI  DSMFDDSEESSPNGSERLSP+++ G+GS Y+SPY+     MGRNYL++ +NHRHQHMM Q++NM  +CNS ++GISVDC++YMNG+N SPPLSGMS+ D+ITNNNYL+S+AS NS  Y+NLLDP+KQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPML  S      + ++ +  K +KSDSVSESED   G+IY+SSCGNRKKKAATNRPSNNRFWPASLAAAVN+LS H +M+ C  +SP+TTVAS  STPK++SQ+++           +  S KRTKT+    ++YQPPK+F   K SY++ +++ D+K   KD  S S+ STP +T+L SPN+SKS  ++D +R + E   + + I     +N+++SPK+  +  K  K     SY SS+   N  SH+L + SLFPPNPCSY SSNPYAN+++PQ+N YL H A+ YNASL  AV Q D NS    LFN+R PNPHSFPIYDS+Y  Y++LIDKR N+ SHINDLFT P   +RSWEEQ+ I N          +N P + +K+EF + + ES S+ NHSY++++ F N     AFHSKTN+N
Sbjct:    1 MQDIQKYPTVTSLQIQQADPGLEKEKKSIYSHPLYPLLSLLLEQCEQATSSPDSQSPDTFDADLQSYIQRHEGNDKMFFTDNNDLDSLIVKAIQVLRIHLNELRKVNELCRDFCTRYISCLKTKIHQDSMFDDSEESSPNGSERLSPTMMPGSGSAYNSPYSLHGSSMGRNYLDMGSNHRHQHMMGQLNNMGHSCNSAMSGISVDCVEYMNGTNTSPPLSGMSMHDDITNNNYLTSVASANSGAYNNLLDPSKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIANQTNLTLLQVNNWFINARRRILQPML-DSSGSPNKERNSHVNLKHEKSDSVSESEDTCSGLIYSSSCGNRKKKAATNRPSNNRFWPASLAAAVNILSTHQTMNNCIPSSPITTVASDRSTPKIISQVEA---------ADNLRSRKRTKTNSSDVDVYQPPKIFSSTKESYESYISELDYKSHQKDAKSQSDTSTPQYTELSSPNNSKSNSMDDGDRIRPEPLNLPSTI---LPNNRNSSPKSLQDSNKPHKPDILSSYLSSSNNFNTISHDLPSVSLFPPNPCSYVSSNPYANIVIPQTNSYLNHPAMFYNASLQRAVQQNDSNSMSSALFNMRHPNPHSFPIYDSMYPNYEHLIDKRQNVASHINDLFTVPHGFSRSWEEQKAIKN---------FDNPPNV-IKNEFTESVQESGSLNNHSYAHLEAFPNFK---AFHSKTNSN 710          
BLAST of PREP homeodomain-like protein vs. TrEMBL
Match: T1DBK9 (PREP-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 4.939e-133
Identity = 262/529 (49.53%), Postives = 344/529 (65.03%), Query Frame = 3
Query:  876 LTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSR-YSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAVNMLSCHASMSGCTSTSPMTTVASGHSTPKMVSQLDSQGIXXXXXXXXXXXXNKRTKTSPPSTEIYQPPKLFIPNKHSYDNCMNDSDFKLRMKDETS-SNQSTPLFTDLRSPNHSKSACIEDNERNKSELF---TMSTPINSTAHSNKSTSPKTTNELKKTSKAAFFQSYFSSTKTTNPHSHELSTASLFPPNPCSYGSSNPYANMIMPQSNPYLAHSAVIYNASLHHAVTQGDPN----SLFNIRPPNPHSFPIYDSIYTGYDNLIDKRTNMVSHINDLFTNPGTLNRSWEEQQGI 2435
            + G+G VY+  Y+   G + RNY E+   HR +HM++ ++NM   CNS +NGISVD  DY+NG++ SP L+ +S  DEITNNNYL SL S NS  Y+NL+DP+KQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQ+A QTNLT+LQVNNWFINARRRILQPMLDSS S  K+K+  S  +K +KSDS+SESED   G+ Y+SSCGNRKKKA +NRPSNNRFWPASLAAAVN+LS H +++ C+S  P+ T   G S  K+ S +D               S KR++T     ++Y+ P++       Y++C N+ + KL + D  S S+ STP +T+L S N+SK+  +ED +RN+ +     T S PI         TSP T +++    K+     Y SS +   P        +LFP NPC+Y SSN Y N+I+PQ   YL +SA+ YN+S+  AV Q D +    +L N+  PN  SF +YD +Y+ YD++IDK+ NM SH N        L RS E+Q  I
Sbjct:    1 MIGSGLVYNRSYSLNGGSIDRNYREI---HRSRHMIDHLNNMGHGCNSGMNGISVDGADYINGTHGSPSLTAISSHDEITNNNYLKSLRSPNSDVYNNLIDPSKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQVAHQTNLTMLQVNNWFINARRRILQPMLDSSDSSFKEKNVES-NSKLEKSDSISESEDTCSGLFYSSSCGNRKKKAVSNRPSNNRFWPASLAAAVNILSTHQTLNNCSSDFPVIT---GVSEEKLFSNID---------ISNDLRSRKRSRTKSSDIDVYKSPRILSVTDECYESCTNEQNRKLNLIDTRSQSDPSTPQYTELNSSNNSKTNSLEDGDRNRCDHLSIPTTSLPI--------VTSPLTKSKI--LHKSNMMSPYLSSPRNLPP-------TTLFPLNPCTYVSSNHYTNIIIPQPTSYLNNSAMFYNSSIQRAVQQHDTDIMSAALINMHYPNSTSFHMYDPMYSNYDHIIDKKPNMASHNNSFIAASPGLKRSLEDQMVI 496          
BLAST of PREP homeodomain-like protein vs. TrEMBL
Match: A0A210QHK1 (Homeobox protein PKNOX2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21977 PE=4 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 4.370e-75
Identity = 164/404 (40.59%), Postives = 220/404 (54.46%), Query Frame = 3
Query:  450 PTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSP--------SILTGAGSVYSS-------PYNSQTGLMGRNYLELTNNHRHQHMMN----------QIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDE-ITNNNYLSSLAS-------GNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLA 1562
            PTV +   ++ D   E+EK++IYGHPL+P+++LL E+CEQA+ + D  S D+F+ D+Q+++   + + K FF+++ +LD+LMVKAIQVLRIHL+EL KV ELC+DFC+RYI CLK K+QS+ +     +      E LSP          +  +G V S+       P  +Q  +   N  ++ +      M+           QIH        T   +       ++GS    PLS + L    +T+   +SS AS        +S   ++L   K KRGVLPK ATQIMK WLFQH+VHPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPMLD+S                                  N   G  KK    +RP   RFWP S+A
Sbjct:   32 PTVLT---KEGDLNSEEEKRAIYGHPLFPLMALLFEKCEQASQTSDCPSSDSFDVDIQAFVHHQEKDRKPFFSEDPELDALMVKAIQVLRIHLLELEKVTELCKDFCNRYIACLKGKLQSEQLLRIDSDFDDPPPEELSPLGQGQMPMQQVLPSGVVNSANNLTMLQPGMAQPAMATLNQGQIVSGGTVYQMVQTPQGLVAQPIQIHTAPVQPQITATPV-------IHGST---PLSQIGLVSSPVTHAQTVSSQASSMQATLLSDSDGDDILGKKKNKRGVLPKSATQIMKSWLFQHIVHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDAS----------------------------------NPEQGKAKKPKTQHRPVQQRFWPDSIA 388          
BLAST of PREP homeodomain-like protein vs. TrEMBL
Match: K1Q1J3 (Homeobox protein PKNOX2 OS=Crassostrea gigas OX=29159 GN=CGI_10011944 PE=4 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 9.131e-72
Identity = 140/303 (46.20%), Postives = 190/303 (62.71%), Query Frame = 3
Query:  483 DPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSL-------PDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            D   E EKK IYGHPL+P++ LL  +CEQA+ + D  S D+F+ D+Q+++ R +   K FF+++ +LD+LMVK+IQVLRIHL+EL KVNELC+DFC+RYINCLK K+QS+ +     +   + SE  S   L+G     ++   + TG+       +         +NQ++ M Q    T  G+    +   +    SP +S   +       P  + ++    + A+ +S   + L   K KRGVLPK ATQ+MK WLFQH+VHPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPML
Sbjct:   45 DAQYEDEKKKIYGHPLFPLMELLFVKCEQASQTSDCPSSDSFDVDIQTFVQRQEKERKPFFSEDTELDNLMVKSIQVLRIHLLELEKVNELCKDFCNRYINCLKGKLQSEQLLRVDTDFD-DFSEHGSSPPLSGGQVSGTAGVVTSTGM-------VIQQQSAAATLNQVYQMVQ----TPQGLVAQPIQIQSTPLQSPIVSSAVIGGSSSLNPLGLVSSQSAQAAAALDSDDDDPLGKKKSKRGVLPKHATQVMKSWLFQHIVHPYPTEDEKRQIANQTNLTLLQVNNWFINARRRILQPML 335          
BLAST of PREP homeodomain-like protein vs. Ensembl Cavefish
Match: meis1b (Meis homeobox 1 [Source:NCBI gene;Acc:103042376])

HSP 1 Score: 196.438 bits (498), Expect = 8.300e-55
Identity = 115/301 (38.21%), Postives = 168/301 (55.81%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K +IYGHPL+P+L+L+ E+CE AT +P        D  S ++F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ E  S + SE +S S         S P +  +     +    T +       +  H      NS+  G  +D                          N ++S ++G+    +      +KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   69 LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFA-KQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDEREGGSKSDSEEISRS---------SGPLDQTSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLD--------------------------NSVASPSTGDDDDPDKEKKRNKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 333          
BLAST of PREP homeodomain-like protein vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 197.978 bits (502), Expect = 8.879e-55
Identity = 119/301 (39.53%), Postives = 176/301 (58.47%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K  IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S      S   + +N  +    R++ + T+ H                ++   G S       +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   73 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGS------STNLADHNPTS---WRDHDDATSTH----------------SAGTPGPSSGGHASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 339          
BLAST of PREP homeodomain-like protein vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 195.282 bits (495), Expect = 2.622e-54
Identity = 118/301 (39.20%), Postives = 176/301 (58.47%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K  IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S      S   + +N  +    R++ + T+ H                ++   G S       +G N+S         ++   +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   73 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGS------STNLADHNPTS---WRDHDDATSTH----------------SAGTPGPSSGGHASQSGDNSS---------EQDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 338          
BLAST of PREP homeodomain-like protein vs. Ensembl Cavefish
Match: meis1b (Meis homeobox 1 [Source:NCBI gene;Acc:103042376])

HSP 1 Score: 195.282 bits (495), Expect = 2.697e-54
Identity = 115/301 (38.21%), Postives = 168/301 (55.81%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K +IYGHPL+P+L+L+ E+CE AT +P        D  S ++F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ E  S + SE +S S         S P +  +     +    T +       +  H      NS+  G  +D                          N ++S ++G+    +      +KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   88 LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFA-KQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDEREGGSKSDSEEISRS---------SGPLDQTSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLD--------------------------NSVASPSTGDDDDPDKEKKRNKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 352          
BLAST of PREP homeodomain-like protein vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 194.126 bits (492), Expect = 9.830e-54
Identity = 121/311 (38.91%), Postives = 177/311 (56.91%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSP----------PLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K  IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S      S   + +N  +    R++ + T+ H                ++   G S       +G N+S            L    L  E   +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   73 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGS------STNLADHNPTS---WRDHDDATSTH----------------SAGTPGPSSGGHASQSGDNSSEQEKARGTGLLELWSFRLGREDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 357          
BLAST of PREP homeodomain-like protein vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 130.954 bits (328), Expect = 4.071e-33
Identity = 72/126 (57.14%), Postives = 80/126 (63.49%), Query Frame = 3
Query: 1188 KRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAA 1565
            KRGVLPK AT +M+ WLFQH+VHPYPTEDEKRQIA QTNLTLLQVNNWFINARRRILQPMLD+S            P+   ++                     RK KAA  RPS+ RFWP SL A
Sbjct:  261 KRGVLPKHATTVMRSWLFQHIVHPYPTEDEKRQIANQTNLTLLQVNNWFINARRRILQPMLDASN-----------PDPSPRAA--------------------RKLKAAP-RPSSQRFWPDSLGA 354          

HSP 2 Score: 118.242 bits (295), Expect = 8.514e-29
Identity = 57/105 (54.29%), Postives = 83/105 (79.05%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQ 806
            LE +K+++Y HPL+P+L+LL E+CE+AT   DS S   F+ D++ ++ R ++  K FF+D  ++D+LMVKAIQVLRIHL+EL KV++LC+DFCSRYI CLK+K+ 
Sbjct:   38 LEADKRAVYRHPLFPLLALLFERCEEATLGSDSVSSAGFDLDIEGFVQRQESERKPFFSDEPEIDNLMVKAIQVLRIHLLELEKVSDLCKDFCSRYITCLKSKMH 142          
BLAST of PREP homeodomain-like protein vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 110.923 bits (276), Expect = 6.214e-27
Identity = 48/104 (46.15%), Postives = 71/104 (68.27%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKI 803
            ++ +K SIY HPL+P+L L++ +CE+AT   +  +     A++Q+ +      +   F+ N D DSLM+KA+QVLRIHL+EL KV ELC+DFC RYI CL+ K+
Sbjct:   38 MDADKNSIYSHPLFPLLRLMMLRCEEATQGAEGITSAGLSAEIQAML----GTQSELFSGNGDTDSLMLKAVQVLRIHLLELEKVRELCQDFCERYIACLRGKL 137          

HSP 2 Score: 99.3673 bits (246), Expect = 5.283e-23
Identity = 43/50 (86.00%), Postives = 45/50 (90.00%), Query Frame = 3
Query: 1182 KQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNW 1331
            K KRGVLPK AT IM+ WLFQH+VHPYPTEDEKRQIA QTNLTLLQVNNW
Sbjct:  253 KSKRGVLPKHATGIMRSWLFQHIVHPYPTEDEKRQIAAQTNLTLLQVNNW 302          
BLAST of PREP homeodomain-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001860.1 (pep scaffold:Pmarinus_7.0:GL485367:2529:11155:-1 gene:ENSPMAG00000001690.1 transcript:ENSPMAT00000001860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 3.204e-25
Identity = 49/102 (48.04%), Postives = 69/102 (67.65%), Query Frame = 3
Query:  522 HPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKI 803
            HPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+
Sbjct:    1 HPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKM 101          
BLAST of PREP homeodomain-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002620.1 (pep scaffold:Pmarinus_7.0:GL484724:8057:10194:-1 gene:ENSPMAG00000002391.1 transcript:ENSPMAT00000002620.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 9.284e-11
Identity = 28/64 (43.75%), Postives = 39/64 (60.94%), Query Frame = 3
Query: 1164 NLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRI 1355
             + DP  +K     + AT  +K WL +H  +PYPT+ EK  +A  T +TL QV+ WF NARRR+
Sbjct:   34 GVADPAFRKNAT--RDATATLKAWLNEHRKNPYPTKGEKIMLAIITRMTLTQVSTWFANARRRL 95          
BLAST of PREP homeodomain-like protein vs. Ensembl Sea Lamprey
Match: mkxb (mohawk homeobox b [Source:ZFIN;Acc:ZDB-GENE-080513-2])

HSP 1 Score: 58.5362 bits (140), Expect = 1.412e-9
Identity = 23/44 (52.27%), Postives = 35/44 (79.55%), Query Frame = 3
Query: 1224 MKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRI 1355
            +K WL++H  +PYPT+ EK  +A  +++TL+QV+NWF NARRR+
Sbjct:   16 LKHWLYKHRHNPYPTKTEKILLALGSHMTLVQVSNWFANARRRL 59          
BLAST of PREP homeodomain-like protein vs. Ensembl Yeast
Match: CUP9 (Homeodomain-containing transcriptional repressor; regulates expression of PTR2, which encodes a major peptide transporter; imported peptides activate ubiquitin-dependent proteolysis, resulting in degradation of Cup9p and de-repression of PTR2 transcription; CUP9 has a paralog, TOS8, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006098])

HSP 1 Score: 71.633 bits (174), Expect = 6.743e-14
Identity = 29/55 (52.73%), Postives = 40/55 (72.73%), Query Frame = 3
Query: 1188 KRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRR 1352
            +R  LPK+  QI+  WL  HL +PYPT+ EKR++  +T LT +Q++NWFIN RRR
Sbjct:  165 RRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 219          
BLAST of PREP homeodomain-like protein vs. Ensembl Yeast
Match: TOS8 (Homeodomain-containing protein and putative transcription factor; found associated with chromatin; target of SBF transcription factor; induced during meiosis and under cell-damaging conditions; TOS8 has a paralog, CUP9, that arose from the whole genome duplication [Source:SGD;Acc:S000003064])

HSP 1 Score: 71.2478 bits (173), Expect = 6.904e-14
Identity = 30/55 (54.55%), Postives = 40/55 (72.73%), Query Frame = 3
Query: 1188 KRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRR 1352
            KR  LPK    I+ +WL +H+ +PYPT  EKR++  +T LT LQ++NWFINARRR
Sbjct:  197 KRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRR 251          
BLAST of PREP homeodomain-like protein vs. Ensembl Nematostella
Match: EDO39375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC9])

HSP 1 Score: 227.254 bits (578), Expect = 1.408e-67
Identity = 126/295 (42.71%), Postives = 174/295 (58.98%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEIT--NNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            +E EK +IY HPL+P+L++LLE+CE AT + D  + D F+ D+++++++++   K  F+ +++LD+L++KAIQV RIHL+EL KVNELC+DFC RYI CLK K+Q               SE L   + +   + + +P     G + +++ +L +    Q  + Q   +             D   Y      SP    M+ P  I+          AS  S         K KRGVLPK+AT IMK WLFQH++HPYPTEDEKR IA QTNLT+LQVNNWFINARRRILQPML
Sbjct:    1 MENEKVAIYRHPLFPLLAMLLEKCEHATQTSDCPTSDAFDNDIKNFMMQHNREGKPCFSGDQELDNLIIKAIQVFRIHLLELEKVNELCKDFCQRYIACLKGKMQ---------------SENL---LRSPMSTTFQTP---SIGCVSQSFQQLPSAQPQQTFIQQAQLLAPQ----------DVAYY----TTSPCTIAMATPPNISVIATQVQQQQASPMSYTPQQSATVKSKRGVLPKQATSIMKTWLFQHIMHPYPTEDEKRSIAQQTNLTILQVNNWFINARRRILQPML 260          
BLAST of PREP homeodomain-like protein vs. Ensembl Nematostella
Match: EDO36439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN3])

HSP 1 Score: 113.235 bits (282), Expect = 2.135e-27
Identity = 51/111 (45.95%), Postives = 78/111 (70.27%), Query Frame = 3
Query:  495 EKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKI 803
            +++K+ +YGHPL+P+L+L+ E+CE AT +P        D  S  +F  D+Q++  +   ++K  F+ N ++DSLM++AIQVLR HL+EL KV+ELC +FC RYI CLK K+
Sbjct:   31 KRDKEVLYGHPLFPLLALIFEKCELATCTPREPGAVGGDVCSSASFNEDIQAFA-KQFKSDKAIFSSNHEVDSLMIQAIQVLRFHLLELEKVHELCDNFCKRYITCLKGKM 140          

HSP 2 Score: 111.309 bits (277), Expect = 9.967e-27
Identity = 44/64 (68.75%), Postives = 56/64 (87.50%), Query Frame = 3
Query: 1179 TKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            +++KRG+ PK AT IMK WLFQHL HPYP+E++KR +A +T LT+LQVNNWFINARRRI+QPM+
Sbjct:  238 SQKKRGIFPKAATNIMKAWLFQHLTHPYPSEEQKRSLAQETGLTILQVNNWFINARRRIVQPMI 301          
BLAST of PREP homeodomain-like protein vs. Ensembl Nematostella
Match: EDO41178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S544])

HSP 1 Score: 74.3294 bits (181), Expect = 3.641e-16
Identity = 31/63 (49.21%), Postives = 47/63 (74.60%), Query Frame = 3
Query: 1182 KQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            K++RG LPK +  +++ WL++H  + YP+E EK+ ++   NL++LQV NWFINARRRIL  M+
Sbjct:   17 KRRRGNLPKDSVNVLRLWLWEHRFNAYPSEAEKQYLSKAANLSVLQVCNWFINARRRILPDMI 79          
BLAST of PREP homeodomain-like protein vs. Ensembl Nematostella
Match: EDO41982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2T4])

HSP 1 Score: 59.3066 bits (142), Expect = 3.488e-11
Identity = 25/50 (50.00%), Postives = 35/50 (70.00%), Query Frame = 3
Query: 1206 KKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRI 1355
            ++ T  +K WLF+H  +PYPT+ EK  +A  T +TL QV+ WF NARRR+
Sbjct:    8 RETTSTLKAWLFEHRKNPYPTKGEKIMLAILTKMTLTQVSTWFANARRRL 57          
BLAST of PREP homeodomain-like protein vs. Ensembl Nematostella
Match: EDO43361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYQ8])

HSP 1 Score: 58.9214 bits (141), Expect = 3.509e-9
Identity = 24/64 (37.50%), Postives = 44/64 (68.75%), Query Frame = 3
Query: 1161 SNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRR 1352
            S  LD  +++R    K+AT+I+ ++ + HL +PYP+E+ K ++A + N+++ Q++NWF N R R
Sbjct:  193 SRFLDARRKRRN-FSKQATEILNEYFYSHLSNPYPSEEAKEELARKCNISVAQISNWFGNKRIR 255          
BLAST of PREP homeodomain-like protein vs. Ensembl Medaka
Match: pknox1.2 (PBX/knotted 1 homeobox 1 [Source:NCBI gene;Acc:101171152])

HSP 1 Score: 214.542 bits (545), Expect = 6.725e-61
Identity = 144/376 (38.30%), Postives = 203/376 (53.99%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGA-GSVYSSPYNSQTGLMGRNYLE----LTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEIT------------NNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAA 1568
            ++ +K SIY HPL+P+L+LL E+CEQ+T S D  +  +F+ D+++++   +   + FF+++ +LD+LMVKAIQVLRIHL+EL KV++LC+DFCSRYI CLKTK+                    S ++L+G  GS Y SP   Q         +    ++     Q  +    +  Q  N T+  ++ + M  + G     P++ ++   ++             NN +        + +++  + TK KRGVLPK AT +M+ WLFQH+ HPYPTEDEK+QIATQTNLTLLQVNNWFINARRRILQPMLD+S                                   S     KKK   NRP   RFWP S+AA 
Sbjct:   35 MDADKASIYRHPLFPLLALLFEKCEQSTLSADCITSASFDVDIENFVRSQEKEGRPFFSEDPELDNLMVKAIQVLRIHLLELEKVSDLCKDFCSRYIACLKTKMN-------------------SETLLSGEPGSPY-SPVQGQAQAFSPTKTQTPSSMSGAISPQGQIVVPASTLQQGNVTVTAVNPNQM--VAGGAVYQPVTVVTPQGQVVTQTLSPGTIRVQNNQFQLQFHQDVNLFNHDDNSTKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIATQTNLTLLQVNNWFINARRRILQPMLDASA----------------------------------SEAPKSKKKTPQNRPL-QRFWPDSIAAG 353          
BLAST of PREP homeodomain-like protein vs. Ensembl Medaka
Match: pknox1.2 (PBX/knotted 1 homeobox 1 [Source:NCBI gene;Acc:101171152])

HSP 1 Score: 214.927 bits (546), Expect = 8.496e-61
Identity = 144/376 (38.30%), Postives = 203/376 (53.99%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGA-GSVYSSPYNSQTGLMGRNYLE----LTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEIT------------NNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAA 1568
            ++ +K SIY HPL+P+L+LL E+CEQ+T S D  +  +F+ D+++++   +   + FF+++ +LD+LMVKAIQVLRIHL+EL KV++LC+DFCSRYI CLKTK+                    S ++L+G  GS Y SP   Q         +    ++     Q  +    +  Q  N T+  ++ + M  + G     P++ ++   ++             NN +        + +++  + TK KRGVLPK AT +M+ WLFQH+ HPYPTEDEK+QIATQTNLTLLQVNNWFINARRRILQPMLD+S                                   S     KKK   NRP   RFWP S+AA 
Sbjct:   52 MDADKASIYRHPLFPLLALLFEKCEQSTLSADCITSASFDVDIENFVRSQEKEGRPFFSEDPELDNLMVKAIQVLRIHLLELEKVSDLCKDFCSRYIACLKTKMN-------------------SETLLSGEPGSPY-SPVQGQAQAFSPTKTQTPSSMSGAISPQGQIVVPASTLQQGNVTVTAVNPNQM--VAGGAVYQPVTVVTPQGQVVTQTLSPGTIRVQNNQFQLQFHQDVNLFNHDDNSTKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIATQTNLTLLQVNNWFINARRRILQPMLDASA----------------------------------SEAPKSKKKTPQNRPL-QRFWPDSIAAG 370          
BLAST of PREP homeodomain-like protein vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 197.593 bits (501), Expect = 4.128e-55
Identity = 119/301 (39.53%), Postives = 176/301 (58.47%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K  IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S      S   + +N  +    R++ + T+ H                ++   G S       +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   70 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGS------STNLADHNPAS---WRDHDDATSTH----------------SAGTPGPSSGGHASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 336          
BLAST of PREP homeodomain-like protein vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 197.208 bits (500), Expect = 4.667e-55
Identity = 119/301 (39.53%), Postives = 176/301 (58.47%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K  IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S      S   + +N  +    R++ + T+ H                ++   G S       +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   71 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGS------STNLADHNPAS---WRDHDDATSTH----------------SAGTPGPSSGGHASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 337          
BLAST of PREP homeodomain-like protein vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 197.593 bits (501), Expect = 2.388e-54
Identity = 119/301 (39.53%), Postives = 176/301 (58.47%), Query Frame = 3
Query:  492 LEKEKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            L+++K  IYGHPL+P+L+L+ E+CE AT +P        D  S D+F  D+  +  +    EK  F+ N +LD+LM++AIQVLR HL+EL KV+ELC +FC RYI+CLK K+  D + D+ + SS +  E LS S      S   + +N  +    R++ + T+ H                ++   G S       +G N+S    G+        +N ++S  +G+    +     ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:   71 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFA-KQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGS------STNLADHNPAS---WRDHDDATSTH----------------SAGTPGPSSGGHASQSGDNSSEQGDGL--------DNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 337          
BLAST of PREP homeodomain-like protein vs. Planmine SMEST
Match: SMESG000013307.1 (SMESG000013307.1)

HSP 1 Score: 1393.64 bits (3606), Expect = 0.000e+0
Identity = 728/730 (99.73%), Postives = 730/730 (100.00%), Query Frame = 3
Query:  429 MQDIQKYPTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQXXXXXXXXXXXXPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLXXXXXXXXXXXXXXLPNKQDKXXXXXXXXXXXXGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAVNMLSCHASMSGCTSTSPMTTVASGHSTPKMVSQLDSQGIXXXXXXXXXXXXNKRTKTSPPSTEIYQPPKLFIPNKHSYDNCMNDSDFKLRMKDETSSNQSTPLFTDLRSPNHSKSACIEDNERNKSELFTMSTPINSTAHSNKSTSPKTTNELKKTSKAAFFQSYFSSTKTTNPHSHELSTASLFPPNPCSYGSSNPYANMIMPQSNPYLAHSAVIYNASLHHAVTQGDPNSLFNIRPPNPHSFPIYDSIYTGYDNLIDKRTNMVSHINDLFTNPGTLNRSWEEQQGILNPIHRSHYNQLENSPYLPMKSEFMDRLPESNSVFNHSYSNIDTFSNLSMKPAFHSKTNTN 2618
            MQDIQKYPTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQSDSMFDDSEESSPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLDSSGSPGKDKSSNSLPNKQDKSDSVSESEDMSVGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAVNMLSCHASMSGCTSTSPMTTVASGHSTPKMVSQLDSQGISCSHYSEPSPSSNKRTKTSPPSTEIYQPPKLFIPNKHSYDNCMNDSDFKLRMKDETSSNQSTPLFTDLRSPNHSKSACIEDNERNKSELFTMSTPINSTAHSNKSTSPKTTNELKKTSKAAFFQSYFSSTKTTNPHSHELSTA+LFPPNPCSYGSSNPYANMIMPQSNPYLAHSAVIYNASLHHAVTQGDPNSLFNIRPPNPHSFPIYDS+YTGYDNLIDKRTNMVSHINDLFTNPGTLNRSWEEQQGILNPIHRSHYNQLENSPYLPMKSEFMDRLPESNSVFNHSYSNIDTFSNLSMKPAFHSKTNTN
Sbjct:    1 MQDIQKYPTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQSDSMFDDSEESSPNGSERLSPSILTGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTINGISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDPTKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPMLDSSGSPGKDKSSNSLPNKQDKSDSVSESEDMSVGVIYNSSCGNRKKKAATNRPSNNRFWPASLAAAVNMLSCHASMSGCTSTSPMTTVASGHSTPKMVSQLDSQGISCSHYSEPSPSSNKRTKTSPPSTEIYQPPKLFIPNKHSYDNCMNDSDFKLRMKDETSSNQSTPLFTDLRSPNHSKSACIEDNERNKSELFTMSTPINSTAHSNKSTSPKTTNELKKTSKAAFFQSYFSSTKTTNPHSHELSTANLFPPNPCSYGSSNPYANMIMPQSNPYLAHSAVIYNASLHHAVTQGDPNSLFNIRPPNPHSFPIYDSMYTGYDNLIDKRTNMVSHINDLFTNPGTLNRSWEEQQGILNPIHRSHYNQLENSPYLPMKSEFMDRLPESNSVFNHSYSNIDTFSNLSMKPAFHSKTNTN 730          
BLAST of PREP homeodomain-like protein vs. Planmine SMEST
Match: SMESG000006530.1 (SMESG000006530.1)

HSP 1 Score: 110.538 bits (275), Expect = 1.644e-24
Identity = 49/109 (44.95%), Postives = 76/109 (69.72%), Query Frame = 3
Query:  501 EKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKI 803
            +KK IY HPL+P+L+L+ E+CE AT SP        D  S ++F  D+ +++     +EK  F+ + D++SL+++A+QVLR HL+E+ KV+ELC +FC+RYI CLK K+
Sbjct:  126 DKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPDINSLIIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKM 234          

HSP 2 Score: 108.997 bits (271), Expect = 5.543e-24
Identity = 43/63 (68.25%), Postives = 55/63 (87.30%), Query Frame = 3
Query: 1182 KQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:  484 QKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 546          
BLAST of PREP homeodomain-like protein vs. Planmine SMEST
Match: SMESG000006530.1 (SMESG000006530.1)

HSP 1 Score: 110.538 bits (275), Expect = 1.720e-24
Identity = 49/109 (44.95%), Postives = 76/109 (69.72%), Query Frame = 3
Query:  501 EKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKI 803
            +KK IY HPL+P+L+L+ E+CE AT SP        D  S ++F  D+ +++     +EK  F+ + D++SL+++A+QVLR HL+E+ KV+ELC +FC+RYI CLK K+
Sbjct:  126 DKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPDINSLIIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKM 234          

HSP 2 Score: 108.997 bits (271), Expect = 5.407e-24
Identity = 43/63 (68.25%), Postives = 55/63 (87.30%), Query Frame = 3
Query: 1182 KQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:  484 QKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 546          
BLAST of PREP homeodomain-like protein vs. Planmine SMEST
Match: SMESG000078684.1 (SMESG000078684.1)

HSP 1 Score: 109.768 bits (273), Expect = 2.945e-24
Identity = 43/63 (68.25%), Postives = 55/63 (87.30%), Query Frame = 3
Query: 1182 KQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPML 1370
            ++KRG+ PK AT IM+ WLFQHL HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+
Sbjct:  475 QKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 537          

HSP 2 Score: 105.916 bits (263), Expect = 4.171e-23
Identity = 48/117 (41.03%), Postives = 77/117 (65.81%), Query Frame = 3
Query:  474 QQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPD-------SQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKI 803
             ++D   + EK+SIY H L+P+L+++ E+CE AT +P          S ++F  D+  +      ++K  ++ N ++D LM++AIQVLR HL+E+ KV+ELC +FCSRYI CLK+K+
Sbjct:   87 HESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYSSSSMDICSSESFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKM 203          
BLAST of PREP homeodomain-like protein vs. Planmine SMEST
Match: SMESG000062973.1 (SMESG000062973.1)

HSP 1 Score: 100.138 bits (248), Expect = 4.357e-24
Identity = 40/60 (66.67%), Postives = 52/60 (86.67%), Query Frame = 3
Query: 1188 KRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNNWFINARRRILQPM 1367
            K G+ PK +T  M+ WLF++++HPYPTED+K+ +A QT+LT+LQVNNWFINARRRILQPM
Sbjct:   26 KHGLFPKSSTNTMRSWLFKNILHPYPTEDQKKSLANQTSLTILQVNNWFINARRRILQPM 85          
The following BLAST results are available for this feature:
BLAST of PREP homeodomain-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PKNOX27.071e-6240.73PBX/knotted 1 homeobox 2 [Source:HGNC Symbol;Acc:H... [more]
MEIS21.529e-5539.87Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS21.529e-5539.87Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS22.143e-5539.87Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS22.782e-5539.87Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
back to top
BLAST of PREP homeodomain-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-626.907e-5133.16Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-621.380e-5033.16Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-622.627e-5033.42Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-623.296e-4831.52Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-623.296e-4831.52Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of PREP homeodomain-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hth2.336e-2545.05gene:FBgn0001235 transcript:FBtr0344145[more]
hth2.336e-2545.05gene:FBgn0001235 transcript:FBtr0100455[more]
hth3.867e-2545.05gene:FBgn0001235 transcript:FBtr0100454[more]
hth6.032e-2550.00gene:FBgn0001235 transcript:FBtr0082256[more]
hth7.310e-2550.00gene:FBgn0001235 transcript:FBtr0082255[more]
back to top
BLAST of PREP homeodomain-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pknox1.21.493e-6138.48pbx/knotted 1 homeobox 1.2 [Source:ZFIN;Acc:ZDB-GE... [more]
meis1a1.153e-5540.00Meis homeobox 1 a [Source:ZFIN;Acc:ZDB-GENE-020122... [more]
meis2a1.302e-5539.53Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis2a1.683e-5539.53Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis2a2.053e-5539.53Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
back to top
BLAST of PREP homeodomain-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde4dip2.488e-6241.73phosphodiesterase 4D interacting protein [Source:X... [more]
pde4dip3.165e-6241.73phosphodiesterase 4D interacting protein [Source:X... [more]
pde4dip4.326e-6241.73phosphodiesterase 4D interacting protein [Source:X... [more]
meis34.823e-5740.46Meis homeobox 3 [Source:NCBI gene;Acc:448474][more]
MEIS12.928e-5338.87Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
back to top
BLAST of PREP homeodomain-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pknox26.519e-6240.73Pbx/knotted 1 homeobox 2 [Source:MGI Symbol;Acc:MG... [more]
Pknox26.519e-6240.73Pbx/knotted 1 homeobox 2 [Source:MGI Symbol;Acc:MG... [more]
Pknox26.519e-6240.73Pbx/knotted 1 homeobox 2 [Source:MGI Symbol;Acc:MG... [more]
Meis21.910e-5539.87Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564][more]
Meis21.955e-5539.87Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564][more]
back to top
BLAST of PREP homeodomain-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96KN3|PKNX2_HUMAN3.396e-6140.73Homeobox protein PKNOX2 OS=Homo sapiens OX=9606 GN... [more]
sp|Q8BG99|PKNX2_MOUSE4.560e-6140.73Homeobox protein PKNOX2 OS=Mus musculus OX=10090 G... [more]
sp|Q5R6L1|PKNX2_PONAB5.505e-6140.47Homeobox protein PKNOX2 OS=Pongo abelii OX=9601 GN... [more]
sp|Q6DIF3|MEIS3_XENTR2.555e-5640.46Homeobox protein meis3 OS=Xenopus tropicalis OX=83... [more]
sp|Q5U4X3|MEI3A_XENLA4.633e-5640.46Homeobox protein meis3-A OS=Xenopus laevis OX=8355... [more]
back to top
BLAST of PREP homeodomain-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2Y1650.000e+099.72PREP homeodomain-like protein OS=Schmidtea mediter... [more]
T1DF700.000e+063.32PREP-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1DBK94.939e-13349.53PREP-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A210QHK14.370e-7540.59Homeobox protein PKNOX2 OS=Mizuhopecten yessoensis... [more]
K1Q1J39.131e-7246.20Homeobox protein PKNOX2 OS=Crassostrea gigas OX=29... [more]
back to top
BLAST of PREP homeodomain-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis1b8.300e-5538.21Meis homeobox 1 [Source:NCBI gene;Acc:103042376][more]
meis2a8.879e-5539.53Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
meis2a2.622e-5439.20Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
meis1b2.697e-5438.21Meis homeobox 1 [Source:NCBI gene;Acc:103042376][more]
meis2a9.830e-5438.91Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
back to top
BLAST of PREP homeodomain-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pknox24.071e-3357.14pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
pknox26.214e-2746.15pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000001860.13.204e-2548.04pep scaffold:Pmarinus_7.0:GL485367:2529:11155:-1 g... [more]
ENSPMAT00000002620.19.284e-1143.75pep scaffold:Pmarinus_7.0:GL484724:8057:10194:-1 g... [more]
mkxb1.412e-952.27mohawk homeobox b [Source:ZFIN;Acc:ZDB-GENE-080513... [more]
back to top
BLAST of PREP homeodomain-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CUP96.743e-1452.73Homeodomain-containing transcriptional repressor; ... [more]
TOS86.904e-1454.55Homeodomain-containing protein and putative transc... [more]
back to top
BLAST of PREP homeodomain-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO393751.408e-6742.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364392.135e-2745.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411783.641e-1649.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419823.488e-1150.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433613.509e-937.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PREP homeodomain-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pknox1.26.725e-6138.30PBX/knotted 1 homeobox 1 [Source:NCBI gene;Acc:101... [more]
pknox1.28.496e-6138.30PBX/knotted 1 homeobox 1 [Source:NCBI gene;Acc:101... [more]
meis2a4.128e-5539.53Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis2a4.667e-5539.53Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis2a2.388e-5439.53Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
back to top
BLAST of PREP homeodomain-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013307.10.000e+099.73SMESG000013307.1[more]
SMESG000006530.11.644e-2444.95SMESG000006530.1[more]
SMESG000006530.11.720e-2444.95SMESG000006530.1[more]
SMESG000078684.12.945e-2468.25SMESG000078684.1[more]
SMESG000062973.14.357e-2466.67SMESG000062973.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30028733
GenBankADB54565.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028733 ID=SMED30028733|Name=PREP homeodomain-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2898bp
TTTATTCATTTGTTTAAATAATTCAATTAAATCATTTTGCATTCTGTTGC
ATTTTTAACTGAAGTGCCTTATTATGAATTTTATACTTTTATAAACATAT
CAATCACACTTCCAGACCTAAGAAAACGAAAAAAAACATAAATCAACAAG
AAACACGCTGACAGATGCCGTGACCACGGACAACTAATCCGAGATTCACA
AAAAAATTTATTAATAGAAATTTTGACAATTCTTAAAAGTCTCAATCAAA
TTTATTTTTTGGAAATAATTCGAATACTTATATTTTCCATAGAATATTAA
TCGTAACTACAATCACTGTCAGATTTAGGCAGATAATTCTGGCAAACATA
AACAGAAATTCGAGTGGAAGCGAAATTTGTTATGAACAGACCCAAGACTC
ACAAATATCGTCGACGACAACGAATTTAATGCAAGACATTCAAAAGTATC
CAACCGTGACCAGTTTACAATTGCAACAAGCTGATCCTGGTTTAGAAAAG
GAAAAGAAAAGCATTTATGGACATCCATTGTATCCAATTTTATCATTGCT
ACTAGAGCAATGTGAACAAGCAACTGCCTCACCAGATTCTCAATCTCCTG
ACACCTTTGAAGCGGATCTCCAGTCTTATATACTTAGAAATGACAATAAT
GAAAAATATTTCTTCACTGATAATAAAGATCTCGATTCATTGATGGTGAA
AGCGATTCAGGTTTTAAGAATACACCTTATAGAACTAAGGAAAGTCAATG
AATTGTGCAGAGACTTTTGCTCACGGTATATCAACTGTTTAAAAACGAAA
ATTCAATCAGATTCCATGTTTGATGATTCTGAAGAGTCATCTCCAAACGG
GTCAGAGAGATTATCTCCTAGTATTTTAACCGGTGCCGGTTCGGTTTATA
GCAGTCCTTATAATTCTCAAACCGGATTAATGGGCAGAAATTATTTAGAG
CTTACCAATAACCATAGACATCAACATATGATGAATCAAATTCACAACAT
GGAACAAAATTGTAACTCAACTATCAACGGAATATCCGTTGACTGCATGG
ACTACATGAATGGTTCCAATAATTCTCCTCCGCTTTCTGGAATGTCTTTA
CCTGATGAAATCACCAATAACAATTATCTTTCATCTCTGGCATCTGGAAA
TTCGAGATATTCAAATCTTCTAGATCCCACAAAACAGAAGCGAGGAGTAT
TGCCAAAAAAAGCAACTCAAATAATGAAACAATGGTTATTCCAGCATCTC
GTTCATCCCTATCCTACTGAAGATGAAAAACGGCAGATTGCCACTCAGAC
TAATTTGACTTTGCTTCAAGTTAACAACTGGTTCATCAATGCCCGACGCA
GAATCCTACAACCGATGCTTGACTCTTCTGGCTCACCAGGCAAAGATAAG
TCCAGCAATTCACTTCCGAATAAACAAGACAAATCAGATTCTGTATCCGA
ATCCGAAGACATGAGTGTCGGGGTGATTTATAATTCTTCATGTGGTAACA
GAAAAAAGAAAGCAGCAACTAATAGACCTTCTAATAATCGATTTTGGCCG
GCTAGTTTGGCTGCTGCCGTTAACATGTTGTCATGTCATGCTTCAATGAG
TGGCTGCACTTCAACCTCCCCGATGACTACAGTAGCTTCAGGTCACAGTA
CTCCAAAGATGGTATCACAACTGGATTCACAAGGTATCAGTTGTAGTCAT
TACTCAGAACCAAGTCCTTCATCAAACAAAAGAACCAAAACTAGTCCACC
TAGTACAGAAATCTATCAACCACCGAAATTATTCATACCTAACAAACATT
CATATGACAATTGTATGAATGATTCAGATTTTAAGTTACGCATGAAAGAC
GAAACATCAAGCAACCAATCAACACCTCTTTTTACAGATTTAAGAAGTCC
AAACCACTCAAAGTCAGCATGTATAGAAGACAACGAAAGAAATAAATCAG
AATTATTTACCATGTCTACGCCAATAAATTCAACAGCTCATTCTAACAAG
AGTACCTCTCCTAAAACGACAAATGAATTGAAAAAAACATCCAAAGCCGC
TTTCTTTCAATCTTACTTTTCATCGACGAAAACCACAAATCCTCATTCTC
ATGAACTTTCAACAGCGAGCCTGTTCCCACCAAATCCCTGCTCATATGGT
TCATCAAACCCTTATGCAAATATGATAATGCCTCAATCAAATCCTTATTT
AGCTCATTCTGCAGTAATCTACAATGCCAGTCTTCATCACGCAGTAACTC
AAGGAGATCCAAACTCTTTATTTAACATTCGACCTCCGAATCCTCATTCA
TTCCCGATTTACGATTCCATATATACAGGATATGATAATTTGATAGATAA
ACGAACTAATATGGTATCTCATATCAATGATCTGTTTACCAATCCAGGAA
CACTTAATAGATCATGGGAAGAGCAACAGGGCATACTAAATCCGATTCAC
AGGTCTCATTATAATCAGCTGGAAAATTCTCCTTATTTACCAATGAAATC
CGAATTCATGGACAGACTACCAGAATCGAATTCGGTTTTCAACCATTCCT
ATTCTAACATTGACACTTTTTCCAATTTGTCCATGAAACCTGCCTTTCAT
TCAAAGACAAACACGAATTAAAGGATCTTTTTTGAGCATTTATTTAAACA
AAAAAATAATAATTCAAACAAAACAAATTGTAACATAATTTCCAACATGT
ATACGAGAATGTATTTATTAATCATTTCGGACGACAGGGTACAGTTTGGA
ACACAATGGAACTTTCTTTTTTTACCTGTTTATTTTTTTTGTAAATTTCA
TATTTAATATCATGTAATTAGATGATGGCTGATCATTTCGATTTTGACTG
GGAATGATGCGTGAAATCCAACGGAATAAATCTAAAACGACTCTCATT
back to top

protein sequence of SMED30028733-orf-1

>SMED30028733-orf-1 ID=SMED30028733-orf-1|Name=SMED30028733-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=731bp
MQDIQKYPTVTSLQLQQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATA
SPDSQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHL
IELRKVNELCRDFCSRYINCLKTKIQSDSMFDDSEESSPNGSERLSPSIL
TGAGSVYSSPYNSQTGLMGRNYLELTNNHRHQHMMNQIHNMEQNCNSTIN
GISVDCMDYMNGSNNSPPLSGMSLPDEITNNNYLSSLASGNSRYSNLLDP
TKQKRGVLPKKATQIMKQWLFQHLVHPYPTEDEKRQIATQTNLTLLQVNN
WFINARRRILQPMLDSSGSPGKDKSSNSLPNKQDKSDSVSESEDMSVGVI
YNSSCGNRKKKAATNRPSNNRFWPASLAAAVNMLSCHASMSGCTSTSPMT
TVASGHSTPKMVSQLDSQGISCSHYSEPSPSSNKRTKTSPPSTEIYQPPK
LFIPNKHSYDNCMNDSDFKLRMKDETSSNQSTPLFTDLRSPNHSKSACIE
DNERNKSELFTMSTPINSTAHSNKSTSPKTTNELKKTSKAAFFQSYFSST
KTTNPHSHELSTASLFPPNPCSYGSSNPYANMIMPQSNPYLAHSAVIYNA
SLHHAVTQGDPNSLFNIRPPNPHSFPIYDSIYTGYDNLIDKRTNMVSHIN
DLFTNPGTLNRSWEEQQGILNPIHRSHYNQLENSPYLPMKSEFMDRLPES
NSVFNHSYSNIDTFSNLSMKPAFHSKTNTN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002005anterior tip
PLANA:0003109anterior pole cell
PLANA:0003116parenchymal cell
PLANA:0007561head margin
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR032453PKNOX/Meis_N
IPR008422Homeobox_KN_domain
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 251..316
e-value: 7.9E-11
score: 52.0
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 249..312
score: 12.633
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 252..308
e-value: 1.31932E-14
score: 66.498
IPR008422Homeobox KN domainPFAMPF05920Homeobox_KNcoord: 269..308
e-value: 1.9E-18
score: 66.1
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 249..327
e-value: 1.2E-32
score: 113.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 318..335
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 401..443
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 315..344
NoneNo IPR availablePANTHERPTHR11850:SF141coord: 18..343
NoneNo IPR availablePANTHERPTHR11850HOMEOBOX PROTEIN TRANSCRIPTION FACTORScoord: 18..343
IPR032453Homeobox protein PKNOX/Meis, N-terminalPFAMPF16493Meis_PKNOX_Ncoord: 53..135
e-value: 4.9E-30
score: 103.7
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 251..318