LRP2-binding protein

Overview
NameLRP2-binding protein
Smed IDSMED30028730
Length (bp)1281
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LRP2-binding protein (SMED30028730) t-SNE clustered cells

Violin plots show distribution of expression levels for LRP2-binding protein (SMED30028730) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LRP2-binding protein (SMED30028730) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LRP2-binding protein (SMED30028730) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028730

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028730SMESG000050759.1 SmedASXL_006342SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30028730SMESG000050759.1 dd_Smed_v4_9780_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30028730SMESG000050759.1 dd_Smed_v4_9780_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30028730SMESG000050759.1 dd_Smed_v6_9780_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30028730SMESG000050759.1 Contig18712newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30028730SMESG000050759.1 Contig18712uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
lateral branchSMED30028730SMESG000050759.1 Contig18712newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
lateral branchSMED30028730SMESG000050759.1 Contig18712uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30028730SMESG000050759.1 OX_Smed_1.0.19133ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
dorsal midlineSMED30028730SMESG000050759.1 dd_Smed_v4_9780_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028730SMESG000050759.1 dd_Smed_v4_9780_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30028730SMESG000050759.1 dd_Smed_v4_9780_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30028730SMESG000050759.1 dd_Smed_v4_9780_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LRP2-binding protein vs. Ensembl Human
Match: LRP2BP (LRP2 binding protein [Source:HGNC Symbol;Acc:HGNC:25434])

HSP 1 Score: 269.626 bits (688), Expect = 4.246e-87
Identity = 142/311 (45.66%), Postives = 200/311 (64.31%), Query Frame = 3
Query:  177 DKLKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLV 1109
            D    NL++  L+  L + +  G+  A+F  GQL+F++  Y E++  F+   +K  D Q  +QLGV+YYDGLG   D   G  YMK+I +S   P   HL  +AAYNLGRA Y+G G+K+S+ EAE+ WL AAD+GNP+ SV AQ+ LG +YSTKE  +L+KAF+WHSEACGNG++ESQ  LG++YLYG G+  +  AAL CL  AAERG++YA+GNL  Y+YK K FTK    S ++A   E   I +    +  + E++ +G+++A F  ARCL LGLG+  D   A  YYSK+ + +  L  +   L+
Sbjct:   10 DYTHANLVDKALQ-LLKERILKGDTLAYFLRGQLYFEEGWYEEALEQFEEIKEK--DHQATYQLGVMYYDGLGTTLDAEKGVDYMKKILDSPC-PKARHLKFAAAYNLGRAYYEGKGVKRSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSEACGNGNLESQGALGLMYLYGQGIRQDTEAALQCLREAAERGNVYAQGNLVEYYYKMKFFTKCVAFSKRIADYDEVHDIPMIAQVTDCLPEFIGRGMAMASFYHARCLQLGLGITRDETTAKHYYSKACRLNPALADELHSLL 316          
BLAST of LRP2-binding protein vs. Ensembl Human
Match: LRP2BP (LRP2 binding protein [Source:HGNC Symbol;Acc:HGNC:25434])

HSP 1 Score: 269.626 bits (688), Expect = 7.403e-87
Identity = 142/314 (45.22%), Postives = 201/314 (64.01%), Query Frame = 3
Query:  168 DTKDKLKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLV 1109
            +  D    NL++  L+  L + +  G+  A+F  GQL+F++  Y E++  F+   +K  D Q  +QLGV+YYDGLG   D   G  YMK+I +S   P   HL  +AAYNLGRA Y+G G+K+S+ EAE+ WL AAD+GNP+ SV AQ+ LG +YSTKE  +L+KAF+WHSEACGNG++ESQ  LG++YLYG G+  +  AAL CL  AAERG++YA+GNL  Y+YK K FTK    S ++A   E   I +    +  + E++ +G+++A F  ARCL LGLG+  D   A  YYSK+ + +  L  +   L+
Sbjct:   33 EKTDYTHANLVDKALQ-LLKERILKGDTLAYFLRGQLYFEEGWYEEALEQFEEIKEK--DHQATYQLGVMYYDGLGTTLDAEKGVDYMKKILDSPC-PKARHLKFAAAYNLGRAYYEGKGVKRSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSEACGNGNLESQGALGLMYLYGQGIRQDTEAALQCLREAAERGNVYAQGNLVEYYYKMKFFTKCVAFSKRIADYDEVHDIPMIAQVTDCLPEFIGRGMAMASFYHARCLQLGLGITRDETTAKHYYSKACRLNPALADELHSLL 342          
BLAST of LRP2-binding protein vs. Ensembl Human
Match: LRP2BP (LRP2 binding protein [Source:HGNC Symbol;Acc:HGNC:25434])

HSP 1 Score: 269.626 bits (688), Expect = 7.403e-87
Identity = 142/314 (45.22%), Postives = 201/314 (64.01%), Query Frame = 3
Query:  168 DTKDKLKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLV 1109
            +  D    NL++  L+  L + +  G+  A+F  GQL+F++  Y E++  F+   +K  D Q  +QLGV+YYDGLG   D   G  YMK+I +S   P   HL  +AAYNLGRA Y+G G+K+S+ EAE+ WL AAD+GNP+ SV AQ+ LG +YSTKE  +L+KAF+WHSEACGNG++ESQ  LG++YLYG G+  +  AAL CL  AAERG++YA+GNL  Y+YK K FTK    S ++A   E   I +    +  + E++ +G+++A F  ARCL LGLG+  D   A  YYSK+ + +  L  +   L+
Sbjct:   33 EKTDYTHANLVDKALQ-LLKERILKGDTLAYFLRGQLYFEEGWYEEALEQFEEIKEK--DHQATYQLGVMYYDGLGTTLDAEKGVDYMKKILDSPC-PKARHLKFAAAYNLGRAYYEGKGVKRSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSEACGNGNLESQGALGLMYLYGQGIRQDTEAALQCLREAAERGNVYAQGNLVEYYYKMKFFTKCVAFSKRIADYDEVHDIPMIAQVTDCLPEFIGRGMAMASFYHARCLQLGLGITRDETTAKHYYSKACRLNPALADELHSLL 342          
BLAST of LRP2-binding protein vs. Ensembl Human
Match: LRP2BP (LRP2 binding protein [Source:HGNC Symbol;Acc:HGNC:25434])

HSP 1 Score: 86.2705 bits (212), Expect = 1.694e-19
Identity = 50/117 (42.74%), Postives = 73/117 (62.39%), Query Frame = 3
Query:  192 NLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSD 542
            NL++  L+  L + +  G+  A+F  GQL+F++  Y E++  F+   +K  D Q  +QLGV+YYDGLG   D   G  YMK+I +S   P   HL  +AAYNLGRA Y+G G+K+S+
Sbjct:   41 NLVDKALQL-LKERILKGDTLAYFLRGQLYFEEGWYEEALEQFEEIKEK--DHQATYQLGVMYYDGLGTTLDAEKGVDYMKKILDSPC-PKARHLKFAAAYNLGRAYYEGKGVKRSN 153          
BLAST of LRP2-binding protein vs. Ensembl Fly
Match: Hrd3 (gene:FBgn0028475 transcript:FBtr0084467)

HSP 1 Score: 50.8322 bits (120), Expect = 1.971e-6
Identity = 77/301 (25.58%), Postives = 127/301 (42.19%), Query Frame = 3
Query:  243 GNNEAFFQLGQLFFD-----KEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLG-VVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHL--DLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKA-------ADLSSKVAQ-----VTEDEIIRV--SKHSSIIIEEYLRK-----GISIACFIFARCLHLGLGVQMDCEEAFKYYSKS 1064
            G+ ++   LGQ+++      ++D+ +++ YFK   D        F LG +Y +G   + AD      Y  +  E  G+P+           LG    +G G+ +   +A  Y+  AAD    QG V  Q  LG  Y T   +  D K AF + + A  +G + +   LGV+  YG+G+  +  AA+      +ERG   ++  + Y  YK     +A       A++  +VAQ     + + + + V   +H  +I   Y  K     G S A        + G G   D E A   Y K+
Sbjct:  331 GDIQSQVGLGQVYYQGGKVTEQDHQKALEYFKMAADAGSAVGIAF-LGKLYLEGSDQIRADNDAAFGYFSKAAE-MGDPV-------GQSGLGLMYLKGLGVPKDSIKALSYFTQAAD----QGWVDGQLQLGNMYFTGNGVKTDYKLAFKYFNLATQSGHVLAYYNLGVMNAYGMGMLRSCPAAVEFFKTVSERGRWSSRLMMAYSDYKNNRIDEAYMQYSLMAEMGYEVAQSNAAFLLDRKEVHVFNDRHEDLIRAFYYWKRAAGQGYSAAQVKLGDYYYYGWGTSTDFETAAALYRKA 618          
BLAST of LRP2-binding protein vs. Ensembl Fly
Match: Hrd3 (gene:FBgn0028475 transcript:FBtr0321255)

HSP 1 Score: 50.8322 bits (120), Expect = 1.971e-6
Identity = 77/301 (25.58%), Postives = 127/301 (42.19%), Query Frame = 3
Query:  243 GNNEAFFQLGQLFFD-----KEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLG-VVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHL--DLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKA-------ADLSSKVAQ-----VTEDEIIRV--SKHSSIIIEEYLRK-----GISIACFIFARCLHLGLGVQMDCEEAFKYYSKS 1064
            G+ ++   LGQ+++      ++D+ +++ YFK   D        F LG +Y +G   + AD      Y  +  E  G+P+           LG    +G G+ +   +A  Y+  AAD    QG V  Q  LG  Y T   +  D K AF + + A  +G + +   LGV+  YG+G+  +  AA+      +ERG   ++  + Y  YK     +A       A++  +VAQ     + + + + V   +H  +I   Y  K     G S A        + G G   D E A   Y K+
Sbjct:  331 GDIQSQVGLGQVYYQGGKVTEQDHQKALEYFKMAADAGSAVGIAF-LGKLYLEGSDQIRADNDAAFGYFSKAAE-MGDPV-------GQSGLGLMYLKGLGVPKDSIKALSYFTQAAD----QGWVDGQLQLGNMYFTGNGVKTDYKLAFKYFNLATQSGHVLAYYNLGVMNAYGMGMLRSCPAAVEFFKTVSERGRWSSRLMMAYSDYKNNRIDEAYMQYSLMAEMGYEVAQSNAAFLLDRKEVHVFNDRHEDLIRAFYYWKRAAGQGYSAAQVKLGDYYYYGWGTSTDFETAAALYRKA 618          
BLAST of LRP2-binding protein vs. Ensembl Zebrafish
Match: lrp2bp (LRP2 binding protein [Source:NCBI gene;Acc:100073340])

HSP 1 Score: 258.07 bits (658), Expect = 1.324e-82
Identity = 142/326 (43.56%), Postives = 203/326 (62.27%), Query Frame = 3
Query:  129 FNIIDELVEKGIIDTKDKLKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRI--FESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQ 1100
               I+++ E+G  ++K          K    L +   +G+++A F LGQL + +  Y E+   F    DK  D Q ++QL VIYYDGLG   D      YM R+  ++S     V +   +A YNLG+A  +G+G++ S SEAE+ WL AADDGNP  SV AQ+ALG FYS  E LDL+KAFFWHS+ACGNGS+ESQA LG++YLYG GV  +  +AL CL  AAERGS+YA+G+L   +Y+R+L+++AA L  +V +  +   I      +  +EEY+RKGI+I  F +ARCLHLG GV  + ++A  Y +++ + D  +C + Q
Sbjct:   18 LRAINQIYEEGREESKHSETNAASVEKTMNLLKEKAETGDSQATFLLGQLHYVQGCYAEAELIFDRIKDK--DPQALYQLAVIYYDGLGTKEDLGRAVEYMGRVAFWDSSEAGSVRY---AALYNLGQAYLEGFGVQASSSEAERLWLLAADDGNPNASVKAQSALGMFYSRPESLDLRKAFFWHSQACGNGSLESQAALGLMYLYGHGVQRDSDSALFCLKEAAERGSVYAQGHLTACYYRRQLYSRAAALGQRVCEYKDTAAI---AQQTDCLEEYVRKGIAIGMFYYARCLHLGRGVPQNRDKAKHYCTQAVRIDPLICKELQ 335          
BLAST of LRP2-binding protein vs. Ensembl Xenopus
Match: lrp2bp (LRP2 binding protein [Source:NCBI gene;Acc:100145071])

HSP 1 Score: 273.863 bits (699), Expect = 1.430e-88
Identity = 139/296 (46.96%), Postives = 201/296 (67.91%), Query Frame = 3
Query:  213 EAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQ 1100
            E +L   +  G+ +A F LGQLFF++  Y +++  F+   ++  D Q ++Q GV+YYDGLG   D   G  YM+RI  S  +P V HL  +AAYNLGRA ++GYG++ SD +AE++WLFAAD+GNP+ S+ AQ+ LG +YS+  ++DL KAFFWHSEACGNGS+ESQ  LGV+YLYG G+  N  AA+ CL  AAERG++YA+G+L   +Y+RKL+TKA +L+ K+  V  D  I +  +++  +  Y  KG+++A F  ARCLHLGL ++ D   A + YSK+ Q D  + ++  
Sbjct:   44 ETFLKSRIKEGDVQANFFLGQLFFEEGWYEDALLQFEKVKEE--DDQALYQAGVMYYDGLGTQEDHRKGVRYMERIVTSD-SPSVKHLKYAAAYNLGRAYFEGYGVRHSDRDAERWWLFAADNGNPKASLKAQSMLGMYYSSPPNVDLHKAFFWHSEACGNGSLESQGALGVMYLYGQGIKKNVQAAMECLKEAAERGNVYAQGHLVSCYYQRKLYTKAVELAKKI--VAHDN-IELLVNATECLPSYTVKGVAMATFYLARCLHLGLAIEQDSTAAKQLYSKAAQLDATVAAELH 333          
BLAST of LRP2-binding protein vs. Ensembl Xenopus
Match: lrp2bp (LRP2 binding protein [Source:NCBI gene;Acc:100145071])

HSP 1 Score: 268.855 bits (686), Expect = 8.388e-87
Identity = 137/283 (48.41%), Postives = 195/283 (68.90%), Query Frame = 3
Query:  213 EAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSK 1061
            E +L   +  G+ +A F LGQLFF++  Y +++  F+   ++  D Q ++Q GV+YYDGLG   D   G  YM+RI  S  +P V HL  +AAYNLGRA ++GYG++ SD +AE++WLFAAD+GNP+ S+ AQ+ LG +YS+  ++DL KAFFWHSEACGNGS+ESQ  LGV+YLYG G+  N  AA+ CL  AAERG++YA+G+L   +Y+RKL+TKA +L+ K+  V  D  I +  +++  +  Y  KG+++A F  ARCLHLGL ++ D   A + YSK
Sbjct:   44 ETFLKSRIKEGDVQANFFLGQLFFEEGWYEDALLQFEKVKEE--DDQALYQAGVMYYDGLGTQEDHRKGVRYMERIVTSD-SPSVKHLKYAAAYNLGRAYFEGYGVRHSDRDAERWWLFAADNGNPKASLKAQSMLGMYYSSPPNVDLHKAFFWHSEACGNGSLESQGALGVMYLYGQGIKKNVQAAMECLKEAAERGNVYAQGHLVSCYYQRKLYTKAVELAKKI--VAHDN-IELLVNATECLPSYTVKGVAMATFYLARCLHLGLAIEQDSTAAKQLYSK 320          
BLAST of LRP2-binding protein vs. Ensembl Mouse
Match: Lrp2bp (Lrp2 binding protein [Source:MGI Symbol;Acc:MGI:1914870])

HSP 1 Score: 276.174 bits (705), Expect = 1.368e-89
Identity = 143/309 (46.28%), Postives = 203/309 (65.70%), Query Frame = 3
Query:  183 LKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLV 1109
            L  NL+++ L+ +L + +  G+  A+F  GQL+F++  Y E++  F+   +K  D Q ++QLGV+YYDGLG +A+   G  YM++I +S   P   HL  +AAYNLGRA ++G G+K+SD EAE+ WL AAD+GNP+ SV AQ+ LG FYS KE  +L+KAFFWHSEACGNGS+ESQ  LG++Y YG G+  +  AAL CL  AAERG++YA+G L  Y+YK K FTK    S ++A   E   I +  H +  + E++ KG+++A F   RCL LGLG+  D E A  YYSK+ + +  L  +   L+
Sbjct:   37 LHANLVDTALQ-FLKERIRRGDAMAYFLRGQLYFEEGWYEEALAQFEEIQEK--DHQAIYQLGVMYYDGLGTIANAEKGVNYMRKILDS-SCPQTMHLKFAAAYNLGRAYFEGKGVKRSDEEAERLWLLAADNGNPKASVKAQSILGLFYSMKEPKELEKAFFWHSEACGNGSLESQGALGLMYFYGQGIRQDTDAALHCLREAAERGNVYAQGTLVEYYYKMKFFTKCVSFSKRIADYDEVHDIPMIAHVTDCLPEFIIKGMAMAAFYHGRCLQLGLGIMKDEESAKHYYSKACRLNPTLADELHSLL 341          
BLAST of LRP2-binding protein vs. Ensembl Mouse
Match: Lrp2bp (Lrp2 binding protein [Source:MGI Symbol;Acc:MGI:1914870])

HSP 1 Score: 276.174 bits (705), Expect = 1.368e-89
Identity = 143/309 (46.28%), Postives = 203/309 (65.70%), Query Frame = 3
Query:  183 LKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLV 1109
            L  NL+++ L+ +L + +  G+  A+F  GQL+F++  Y E++  F+   +K  D Q ++QLGV+YYDGLG +A+   G  YM++I +S   P   HL  +AAYNLGRA ++G G+K+SD EAE+ WL AAD+GNP+ SV AQ+ LG FYS KE  +L+KAFFWHSEACGNGS+ESQ  LG++Y YG G+  +  AAL CL  AAERG++YA+G L  Y+YK K FTK    S ++A   E   I +  H +  + E++ KG+++A F   RCL LGLG+  D E A  YYSK+ + +  L  +   L+
Sbjct:   37 LHANLVDTALQ-FLKERIRRGDAMAYFLRGQLYFEEGWYEEALAQFEEIQEK--DHQAIYQLGVMYYDGLGTIANAEKGVNYMRKILDS-SCPQTMHLKFAAAYNLGRAYFEGKGVKRSDEEAERLWLLAADNGNPKASVKAQSILGLFYSMKEPKELEKAFFWHSEACGNGSLESQGALGLMYFYGQGIRQDTDAALHCLREAAERGNVYAQGTLVEYYYKMKFFTKCVSFSKRIADYDEVHDIPMIAHVTDCLPEFIIKGMAMAAFYHGRCLQLGLGIMKDEESAKHYYSKACRLNPTLADELHSLL 341          
BLAST of LRP2-binding protein vs. Ensembl Mouse
Match: Lrp2bp (Lrp2 binding protein [Source:MGI Symbol;Acc:MGI:1914870])

HSP 1 Score: 276.174 bits (705), Expect = 3.293e-89
Identity = 143/309 (46.28%), Postives = 203/309 (65.70%), Query Frame = 3
Query:  183 LKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLV 1109
            L  NL+++ L+ +L + +  G+  A+F  GQL+F++  Y E++  F+   +K  D Q ++QLGV+YYDGLG +A+   G  YM++I +S   P   HL  +AAYNLGRA ++G G+K+SD EAE+ WL AAD+GNP+ SV AQ+ LG FYS KE  +L+KAFFWHSEACGNGS+ESQ  LG++Y YG G+  +  AAL CL  AAERG++YA+G L  Y+YK K FTK    S ++A   E   I +  H +  + E++ KG+++A F   RCL LGLG+  D E A  YYSK+ + +  L  +   L+
Sbjct:   58 LHANLVDTALQ-FLKERIRRGDAMAYFLRGQLYFEEGWYEEALAQFEEIQEK--DHQAIYQLGVMYYDGLGTIANAEKGVNYMRKILDS-SCPQTMHLKFAAAYNLGRAYFEGKGVKRSDEEAERLWLLAADNGNPKASVKAQSILGLFYSMKEPKELEKAFFWHSEACGNGSLESQGALGLMYFYGQGIRQDTDAALHCLREAAERGNVYAQGTLVEYYYKMKFFTKCVSFSKRIADYDEVHDIPMIAHVTDCLPEFIIKGMAMAAFYHGRCLQLGLGIMKDEESAKHYYSKACRLNPTLADELHSLL 362          
BLAST of LRP2-binding protein vs. Ensembl Mouse
Match: Lrp2bp (Lrp2 binding protein [Source:MGI Symbol;Acc:MGI:1914870])

HSP 1 Score: 139.813 bits (351), Expect = 1.048e-38
Identity = 74/161 (45.96%), Postives = 109/161 (67.70%), Query Frame = 3
Query:  183 LKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKA 665
            L  NL+++ L+ +L + +  G+  A+F  GQL+F++  Y E++  F+   +K  D Q ++QLGV+YYDGLG +A+   G  YM++I +S   P   HL  +AAYNLGRA ++G G+K+SD EAE+ WL AAD+GNP+ SV AQ+ LG FYS KE  +L+K 
Sbjct:   37 LHANLVDTALQ-FLKERIRRGDAMAYFLRGQLYFEEGWYEEALAQFEEIQEK--DHQAIYQLGVMYYDGLGTIANAEKGVNYMRKILDS-SCPQTMHLKFAAAYNLGRAYFEGKGVKRSDEEAERLWLLAADNGNPKASVKAQSILGLFYSMKEPKELEKT 193          
BLAST of LRP2-binding protein vs. UniProt/SwissProt
Match: sp|Q569C2|LR2BP_RAT (LRP2-binding protein OS=Rattus norvegicus OX=10116 GN=Lrp2bp PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 8.314e-91
Identity = 146/306 (47.71%), Postives = 205/306 (66.99%), Query Frame = 3
Query:  192 NLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLV 1109
            NL+++ L+ +L + +  G+  A+F  GQL+F++  Y E++  F+   +K  D Q ++QLGV+YYDGLG VAD   G  YMK+I +S   P   HL  +AAYNLGRA ++G G+K+SD EAE+ WL+AAD+GNP+ SV AQ+ LG FYS KE  DL+KAFFWHSEACGNG++ESQ  LG++YLYG G+  +  AAL CL  AAERG++YA+G L  Y+YK K FTK    S ++A   E   I +  H +  + E++ KG+++A F +ARCL LGLG+  D   A  YYSK+ + +  L  +   L+
Sbjct:   40 NLVDTALQ-FLKERIRKGDAMAYFLRGQLYFEEGWYEEALAQFEEIQEK--DHQAIYQLGVMYYDGLGTVADAEKGVGYMKKILDS-SCPQTMHLKFAAAYNLGRAYFEGKGVKRSDEEAERLWLYAADNGNPKASVKAQSILGLFYSMKEPKDLEKAFFWHSEACGNGNLESQGALGLMYLYGQGIRQDTDAALHCLREAAERGNVYAQGILVEYYYKMKFFTKCVSFSKRIADYDEVHDIPMIAHVTDCLPEFISKGMAMASFYYARCLQLGLGITKDEASAKHYYSKACRLNPTLADELHSLL 341          
BLAST of LRP2-binding protein vs. UniProt/SwissProt
Match: sp|Q6IND7|LR2BP_XENLA (LRP2-binding protein OS=Xenopus laevis OX=8355 GN=lrp2bp PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 4.561e-90
Identity = 143/295 (48.47%), Postives = 202/295 (68.47%), Query Frame = 3
Query:  213 EAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDF 1097
            E +L   +  G+ +A F LGQLFF++  Y +++  F+   D+  D Q ++Q GV+YYDGLG   D   G  YM+RI  S   P   HL  +AAYNLGRA ++GYGI  SD EAE++WLFAAD+GNP+ S+ AQ+ LG +YS+  ++DL+KAF WHSEACGNGS+ESQ  LGV+YLYG G+  N  AA+ CL  AAERG++YA+G+L   +Y+RKL+TKA +L+ K+  V+ D  I +  +++  +  Y  KG++IA F FARCLHLGLG++ D   A + YSK+ Q D ++ ++ 
Sbjct:   44 ETFLKSRIKEGDVQANFLLGQLFFEEGWYEDALLQFEKVKDE--DNQALYQAGVMYYDGLGTQEDHRKGVKYMERIVTSDC-PSAKHLKYAAAYNLGRAYFEGYGIPHSDKEAERWWLFAADNGNPKASLKAQSVLGMYYSSPPNVDLQKAFLWHSEACGNGSLESQGALGVMYLYGNGIKKNVQAAIECLKEAAERGNVYAQGHLVSCYYQRKLYTKAVELAKKI--VSHDN-IELLVNTTDCLPSYTVKGVAIATFYFARCLHLGLGIKQDSTAAKQLYSKAAQLDAQVAAEL 332          
BLAST of LRP2-binding protein vs. UniProt/SwissProt
Match: sp|Q9D4C6|LR2BP_MOUSE (LRP2-binding protein OS=Mus musculus OX=10090 GN=Lrp2bp PE=2 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 9.566e-89
Identity = 143/309 (46.28%), Postives = 203/309 (65.70%), Query Frame = 3
Query:  183 LKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLV 1109
            L  NL+++ L+ +L + +  G+  A+F  GQL+F++  Y E++  F+   +K  D Q ++QLGV+YYDGLG +A+   G  YM++I +S   P   HL  +AAYNLGRA ++G G+K+SD EAE+ WL AAD+GNP+ SV AQ+ LG FYS KE  +L+KAFFWHSEACGNGS+ESQ  LG++Y YG G+  +  AAL CL  AAERG++YA+G L  Y+YK K FTK    S ++A   E   I +  H +  + E++ KG+++A F   RCL LGLG+  D E A  YYSK+ + +  L  +   L+
Sbjct:   37 LHANLVDTALQ-FLKERIRRGDAMAYFLRGQLYFEEGWYEEALAQFEEIQEK--DHQAIYQLGVMYYDGLGTIANAEKGVNYMRKILDS-SCPQTMHLKFAAAYNLGRAYFEGKGVKRSDEEAERLWLLAADNGNPKASVKAQSILGLFYSMKEPKELEKAFFWHSEACGNGSLESQGALGLMYFYGQGIRQDTDAALHCLREAAERGNVYAQGTLVEYYYKMKFFTKCVSFSKRIADYDEVHDIPMIAHVTDCLPEFIIKGMAMAAFYHGRCLQLGLGIMKDEESAKHYYSKACRLNPTLADELHSLL 341          
BLAST of LRP2-binding protein vs. UniProt/SwissProt
Match: sp|Q4R3N2|LR2BP_MACFA (LRP2-binding protein OS=Macaca fascicularis OX=9541 GN=LRP2BP PE=2 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 1.449e-86
Identity = 141/306 (46.08%), Postives = 201/306 (65.69%), Query Frame = 3
Query:  192 NLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLV 1109
            NL++  L+  L   +  G+  A+F  GQL+F++  Y E++  F+   +K  D Q  +QLGV+YYDGLG + +   G  YMK+I +S   P   HL  +AAYNLGRA Y+G G+K+S+ EAE+ WLFAAD+GNP+ SV AQ+ LG +YSTKE  +L+KAF+WHSEACGNG++ESQ  LG++YLYG G+  +  AAL CL  AAERG++YA+GNL  Y+YK K FTK    S ++A   E   I +    +  + E++ +G+++A F  ARCL LGLG+  D   A  YYSK+ + +  L  + + L+
Sbjct:   42 NLVDKALQ-LLKKRILKGDTLAYFLRGQLYFEEGWYEEALEQFEEIEEK--DHQATYQLGVMYYDGLGTILNSEKGVDYMKKILDSPC-PKARHLKFAAAYNLGRAYYEGKGVKRSNEEAERLWLFAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSEACGNGNLESQGALGLMYLYGQGIRQDTEAALHCLREAAERGNVYAQGNLVEYYYKMKFFTKCVAFSKRIADYDEVHDIPMIAQVTDCLPEFISRGMAMASFYHARCLQLGLGITRDEATAKHYYSKACRLNPALADELRSLL 343          
BLAST of LRP2-binding protein vs. UniProt/SwissProt
Match: sp|Q9P2M1|LR2BP_HUMAN (LRP2-binding protein OS=Homo sapiens OX=9606 GN=LRP2BP PE=1 SV=2)

HSP 1 Score: 269.626 bits (688), Expect = 3.555e-86
Identity = 142/314 (45.22%), Postives = 201/314 (64.01%), Query Frame = 3
Query:  168 DTKDKLKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLV 1109
            +  D    NL++  L+  L + +  G+  A+F  GQL+F++  Y E++  F+   +K  D Q  +QLGV+YYDGLG   D   G  YMK+I +S   P   HL  +AAYNLGRA Y+G G+K+S+ EAE+ WL AAD+GNP+ SV AQ+ LG +YSTKE  +L+KAF+WHSEACGNG++ESQ  LG++YLYG G+  +  AAL CL  AAERG++YA+GNL  Y+YK K FTK    S ++A   E   I +    +  + E++ +G+++A F  ARCL LGLG+  D   A  YYSK+ + +  L  +   L+
Sbjct:   33 EKTDYTHANLVDKALQ-LLKERILKGDTLAYFLRGQLYFEEGWYEEALEQFEEIKEK--DHQATYQLGVMYYDGLGTTLDAEKGVDYMKKILDSPC-PKARHLKFAAAYNLGRAYYEGKGVKRSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSEACGNGNLESQGALGLMYLYGQGIRQDTEAALQCLREAAERGNVYAQGNLVEYYYKMKFFTKCVAFSKRIADYDEVHDIPMIAQVTDCLPEFIGRGMAMASFYHARCLQLGLGITRDETTAKHYYSKACRLNPALADELHSLL 342          
BLAST of LRP2-binding protein vs. TrEMBL
Match: A0A1I8GWY5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 6.050e-99
Identity = 156/319 (48.90%), Postives = 219/319 (68.65%), Query Frame = 3
Query:  153 EKGIIDTKDKLKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGV-DVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKL 1106
            E  +++   +L    L S+LE  L   +  G+++A FQLGQL F++  Y ES   F+  V K  D Q MFQLGVI+YDGL   A+P  G  YM  + + +       L  +AAYN+GRA +QGYG++Q+D +AE++WL AADDGNP+ SV+AQT LG+FYS  +H DL+KAFFWHSEACGNGS+ESQ  LGV+YLYG+GV   +  +A  CL  AAERG++YA+GN+ YY+Y +KLFTKAA+L+++V Q   D+I  +++ +      ++ KG+++A FIFARCL  GLGVQ D ++A  +YS S+Q+D + C+  Q L
Sbjct:   22 EVELLEDHQRLSETELVSRLERVLRLRMERGDSQAAFQLGQLLFEQSRYDESRRLFEIAVSKFEDTQAMFQLGVIHYDGLVGEANPERGIRYMMEVCKRKDQLPSKQLYFAAAYNIGRAYFQGYGVRQNDEKAEEWWLAAADDGNPRASVLAQTTLGYFYSHADHRDLQKAFFWHSEACGNGSLESQGALGVMYLYGLGVRRRDSESAFECLREAAERGNVYAQGNMVYYYYSKKLFTKAAELAARVVQY--DDIAALAEETQCQA-RFVSKGVALASFIFARCLQQGLGVQKDLDKAKHFYSLSFQFDPDTCARLQNL 337          
BLAST of LRP2-binding protein vs. TrEMBL
Match: A0A267GK49 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010278g2 PE=4 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 6.098e-99
Identity = 156/319 (48.90%), Postives = 219/319 (68.65%), Query Frame = 3
Query:  153 EKGIIDTKDKLKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGV-DVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKL 1106
            E  +++   +L    L S+LE  L   +  G+++A FQLGQL F++  Y ES   F+  V K  D Q MFQLGVI+YDGL   A+P  G  YM  + + +       L  +AAYN+GRA +QGYG++Q+D +AE++WL AADDGNP+ SV+AQT LG+FYS  +H DL+KAFFWHSEACGNGS+ESQ  LGV+YLYG+GV   +  +A  CL  AAERG++YA+GN+ YY+Y +KLFTKAA+L+++V Q   D+I  +++ +      ++ KG+++A FIFARCL  GLGVQ D ++A  +YS S+Q+D + C+  Q L
Sbjct:   37 EVELLEDHQRLSETELVSRLERVLRLRMERGDSQAAFQLGQLLFEQSRYDESRRLFEIAVSKFEDTQAMFQLGVIHYDGLVGEANPERGIRYMMEVCKRKDQLPSKQLYFAAAYNIGRAYFQGYGVRQNDEKAEEWWLAAADDGNPRASVLAQTTLGYFYSHADHRDLQKAFFWHSEACGNGSLESQGALGVMYLYGLGVRRRDSESAFECLREAAERGNVYAQGNMVYYYYSKKLFTKAAELAARVVQY--DDIAALAEETQCQA-RFVSKGVALASFIFARCLQQGLGVQKDLDKAKHFYSLSFQFDPDTCARLQNL 352          
BLAST of LRP2-binding protein vs. TrEMBL
Match: R7THG8 (TPR_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_223760 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 6.382e-99
Identity = 152/316 (48.10%), Postives = 223/316 (70.57%), Query Frame = 3
Query:  177 DKLKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLVQANLL 1124
            ++++ + L  KLE  L++ +++G+ +A FQLGQL+F+   Y ++  +F+   +   D+Q +FQLGVIYYDGL   +D A    YM+RI E+     V HL ++A YN+GRA  QGYG KQSD  AEK+WL AADDGNP  S+ AQ+ALG FYS ++HLDLKKAF+WHSEACGN ++ESQ  LGV+Y  G+GV  +  AA +CL  AA RG++YA GNL  ++YKRK +TK  +L+++VA    D++ +++K +   +  ++ KGIS+A F +ARCLHLGLGVQ +  EA KYYS+S+++D+++C+  Q + Q  ++
Sbjct:   40 EEMEDDELTEKLETVLLEKIHNGDRQALFQLGQLYFELGKYEKARTFFERAAEND-DYQAIFQLGVIYYDGLHGHSDCAKALGYMQRIIEADPKK-VDHLTHAACYNIGRAYLQGYGCKQSDELAEKFWLIAADDGNPNASIKAQSALGLFYSREDHLDLKKAFYWHSEACGNNNLESQGALGVMYQNGLGVKQDASAAFVCLREAASRGNVYAMGNLVSHYYKRKFYTKCMELAARVAMF--DDVDQIAKETD-CLPCFISKGISMAAFYYARCLHLGLGVQKNEAEAKKYYSRSFEFDSDVCAKLQNITQHGII 350          
BLAST of LRP2-binding protein vs. TrEMBL
Match: A0A1S3I3V1 (LRP2-binding protein OS=Lingula unguis OX=7574 GN=LOC106160433 PE=4 SV=2)

HSP 1 Score: 305.834 bits (782), Expect = 9.604e-98
Identity = 151/304 (49.67%), Postives = 214/304 (70.39%), Query Frame = 3
Query:  198 LNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLV 1109
            L  K+E+ L+D + +G+ +A FQLGQL+F++  + +++ YF+    K  DFQ ++QLGV+YYDGLG   DP +G   M ++  S       HL++ A YN+GRA YQG+G+ QSD EAE++WL AADDGNP GS++AQ+ LG FYS  E LDLKKA+FWHSEACGNGS+ESQ  LGV+   G+G   +  A+  C   AA+RG++YA G+L  Y+Y RKL+TKAADL+++VA +  D+I +++  ++  I  Y+ KGIS+ACF +ARCLH G GV+ + EEA KYYSKS+  D ++C+  Q + 
Sbjct:   43 LTGKVESMLLDKIKNGDKQAVFQLGQLYFEQGVFDKAVNYFERA--KEYDFQALYQLGVMYYDGLGCEQDPKIGSGCMLQVATSTAKQ-AQHLVHVAQYNVGRAFYQGFGLTQSDEEAERWWLLAADDGNPNGSILAQSMLGMFYSRPETLDLKKAYFWHSEACGNGSLESQGALGVMLELGLGCKKDTNASFECFKEAADRGNVYAMGHLVKYYYMRKLYTKAADLAARVAML--DDIYQIAAETT-CIPGYIAKGISMACFFYARCLHKGHGVEANEEEAGKYYSKSHDLDPDMCATLQGIT 340          
BLAST of LRP2-binding protein vs. TrEMBL
Match: A0A210PPF6 (LRP2-binding protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17279 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 4.173e-94
Identity = 150/315 (47.62%), Postives = 216/315 (68.57%), Query Frame = 3
Query:  183 LKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGI-KQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLVQANLL 1124
            L  N L  K+E  L++ + +G+  A+FQLG  ++++    ++  YF+   D   DFQ +F L V+ +DG+G   +      Y+K+I ES       HL+ +A +N+GRA +QGYG+ +QSD  AEKYWL AADDGNP GSV AQ+ALG FYS K+ +DLKKAFFWHSEACGNGS+ESQ  LG++Y +GIGV V+  AA  CL  AAERG++YA G+L   +Y+RKLFTKA+DL+++V+Q +  +I +++K +   +  Y+RKGI + CF +ARCL  G GV+ D EEA K YSKS+++D ++C+  Q + Q  ++
Sbjct:   36 LTENELMEKVENILLERIKNGDKRAYFQLGLFYYEQALQDKARIYFERAKD--FDFQALFMLAVMLFDGVGGDTNTEQAIEYLKKI-ESSNAKHAKHLVRAAQFNIGRAYFQGYGVHRQSDEMAEKYWLLAADDGNPNGSVKAQSALGMFYSLKDTMDLKKAFFWHSEACGNGSLESQGALGIMYEHGIGVKVDLDAANACLKEAAERGNVYAMGHLVAQYYRRKLFTKASDLAARVSQFS--DIDQIAKETD-CLPNYIRKGIGLGCFYYARCLEEGHGVKQDKEEAGKCYSKSFEYDPDVCATLQNITQHGVI 344          
BLAST of LRP2-binding protein vs. Ensembl Cavefish
Match: lrp2bp (LRP2 binding protein [Source:NCBI gene;Acc:103026521])

HSP 1 Score: 264.233 bits (674), Expect = 6.666e-85
Identity = 140/303 (46.20%), Postives = 195/303 (64.36%), Query Frame = 3
Query:  192 NLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQ 1100
            +LL  + E  L     +G+ +A F +GQL++++  Y E+   F G  DK  +   ++QL V+YYDGLG   +      YM+R+     +P+      SA YNLGRA  QGYG++ S SEAE+Y+L AAD GNP  SV AQ+ LG FYS+ E  DL+KA+FWHSEACGNGS+ESQ  LG++YL+G GV  +  AAL CL  AAERG++YA+ +L  ++Y +KL+TKAA L+ ++ Q    E I     S+  + EY+ KGI+IA F +ARCL LG GV +D E A +YY+K+   + E+C D Q
Sbjct:   51 SLLVKRAERLLKSRAETGDTQASFLIGQLYYEEGRYTEAEAIFDGIKDK--EPCALYQLAVMYYDGLGTSVNQVKAVDYMRRVAAWDSSPIK----YSALYNLGRAYLQGYGVQASSSEAERYFLLAADGGNPNASVKAQSYLGLFYSSPETQDLQKAYFWHSEACGNGSLESQGALGIMYLHGYGVPKDLQAALCCLKEAAERGNVYAQSHLAAHYYHQKLYTKAAALAQRICQY---EDISAIAKSTGCLPEYISKGIAIALFYYARCLQLGRGVPLDMETAQQYYAKAALMNPEVCKDLQ 344          
BLAST of LRP2-binding protein vs. Ensembl Cavefish
Match: lrp2bp (LRP2 binding protein [Source:NCBI gene;Acc:103026521])

HSP 1 Score: 254.218 bits (648), Expect = 8.885e-81
Identity = 137/297 (46.13%), Postives = 190/297 (63.97%), Query Frame = 3
Query:  192 NLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTE 1082
            +LL  + E  L     +G+ +A F +GQL++++  Y E+   F G  DK  +   ++QL V+YYDGLG   +      YM+R+     +P+      SA YNLGRA  QGYG++ S SEAE+Y+L AAD GNP  SV AQ+ LG FYS+ E  DL+KA+FWHSEACGNGS+ESQ  LG++YL+G GV  +  AAL CL  AAERG++YA+ +L  ++Y +KL+TKAA L+ ++ Q    E I     S+  + EY+ KGI+IA F +ARCL LG GV +D E A +YY+K +    E
Sbjct:   51 SLLVKRAERLLKSRAETGDTQASFLIGQLYYEEGRYTEAEAIFDGIKDK--EPCALYQLAVMYYDGLGTSVNQVKAVDYMRRVAAWDSSPIK----YSALYNLGRAYLQGYGVQASSSEAERYFLLAADGGNPNASVKAQSYLGLFYSSPETQDLQKAYFWHSEACGNGSLESQGALGIMYLHGYGVPKDLQAALCCLKEAAERGNVYAQSHLAAHYYHQKLYTKAAALAQRICQY---EDISAIAKSTGCLPEYISKGIAIALFYYARCLQLGRGVPLDMETAQQYYAKVFIQTAE 338          
BLAST of LRP2-binding protein vs. Ensembl Sea Lamprey
Match: lrp2bp (LRP2 binding protein [Source:NCBI gene;Acc:100073340])

HSP 1 Score: 251.136 bits (640), Expect = 3.850e-81
Identity = 133/300 (44.33%), Postives = 196/300 (65.33%), Query Frame = 3
Query:  204 SKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAA-YNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQ 1100
            S+ E  L+  + +G+ +A F LGQL+F K  +  +  +F+  V    D + ++QLGV+YYD LG+ AD   G   M  + + +G    + L+  AA +N+G+A + G+G KQSD+EAE++WL AADDGNP  SV AQ+ LG FYS  E L LKKAFFWHSEACGNGS+ESQ  LG++Y  G+GV  +  +AL CLD AA+RG++YA+  L    + R+L+ +AA+L+++VA     ++ RV++ +   +  Y+ KGI++A F + RCL LG GV  D   A  YYSK++Q D ++  +FQ
Sbjct:    5 SEEERELLARVSAGDQDARFLLGQLYFHKGCFASARLHFE--VVSHTDARALYQLGVMYYDTLGMPADLEKGVDCMLGVTKMEGGR--ARLVKYAAMFNIGQAHFSGFGAKQSDTEAERWWLLAADDGNPLASVKAQSMLGMFYSRPESLHLKKAFFWHSEACGNGSVESQGALGLMYKLGLGVRRDADSALECLDEAAQRGNLYAQAQLMALLHARRLYVRAAELAARVADAM--DVARVARETD-CLPTYISKGIAMAAFYYGRCLELGQGVARDPVRARHYYSKAFQCDPDITEEFQ 297          
BLAST of LRP2-binding protein vs. Ensembl Nematostella
Match: EDO42764 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0M8])

HSP 1 Score: 280.411 bits (716), Expect = 8.636e-92
Identity = 143/309 (46.28%), Postives = 205/309 (66.34%), Query Frame = 3
Query:  165 IDTKDKLKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCS 1091
            I  ++ +    L+S+LE  LI     G+  A FQLGQ +F++  + ++I  F+    K  DFQ  +QLGV+YYDGLG  A P  G   +K I  S  +P  SHL+  A YN+GRA Y+GYG+KQSD EAE+++L AA DG+P GS+ +QT LG FYS   + +L KA+FWH EA GNGSIESQ  LGV++ YGIGV +N  +A  CL  AA RG++YA+GNL  ++YKRKLF KAAD++  VA +  D+++ +++ +   + +Y+ KGIS+  F++ARCLH G GV  D + A  +YS++ Q+D +  +
Sbjct:   33 IIPQEDISQEALDSELEETLIKRAKDGDRLAKFQLGQFYFERGIFEKAIVAFE--RIKSTDFQAKYQLGVMYYDGLGTQAKPDKGVELLKEIAMS-AHPDASHLVPHAQYNIGRAYYEGYGVKQSDKEAERWFLMAARDGDPSGSLRSQTVLGMFYSRPGNENLSKAYFWHQEATGNGSIESQGALGVMFEYGIGVPMNIQSAFECLKGAAIRGNVYAQGNLAVHYYKRKLFNKAADVAKSVADL--DDVMAIARETE-CLPKYVAKGISLGSFVYARCLHHGFGVDKDEKNALMFYSRAAQFDMDTAA 335          
BLAST of LRP2-binding protein vs. Ensembl Nematostella
Match: EDO40221 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7M3])

HSP 1 Score: 51.2174 bits (121), Expect = 5.361e-7
Identity = 54/179 (30.17%), Postives = 87/179 (48.60%), Query Frame = 3
Query:  309 IFYFKGGVDKICDFQCMFQLGVIYYDG-LGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGI-KQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLD--LKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLC 833
            I Y++   DK  D Q    LG +Y+ G  GV  D      Y ++  E+ GN       N+ A+ LG+   +G  + KQ +  A K++  AAD GNP G    Q+ LG  Y   + +D   +KAF +   A   G ++    +G +Y +G+GV  ++  A+   + A++ G + A  NL 
Sbjct:  137 IQYYQFLADK-GDVQAQVGLGQLYFQGGRGVELDHQRANRYFQQAAEA-GNS------NAMAF-LGKMYSEGSEVVKQDNKTAFKWFKKAADMGNPIG----QSGLGLMYMFGKGVDKNYEKAFQYFKMAAEQGWVDGHLQIGTMYYHGLGVRRDYKMAIKFFNLASQSGHVLAFYNLA 302          
BLAST of LRP2-binding protein vs. Planmine SMEST
Match: SMESG000050759.1 (SMESG000050759.1)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 350/353 (99.15%), Postives = 351/353 (99.43%), Query Frame = 3
Query:   66 MLNSPIVNKNFNVKVEKCEFKFNIIDELVEKGIIDTKDKLKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLVQANLL 1124
            MLNSPIVNKNFNVKVEKCEFKFNIIDELVEKGIIDTKDK KPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKI DFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIR+SKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLVQANLL
Sbjct:    1 MLNSPIVNKNFNVKVEKCEFKFNIIDELVEKGIIDTKDKSKPNLLNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKIGDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRLSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLVQANLL 353          
BLAST of LRP2-binding protein vs. Planmine SMEST
Match: SMESG000066814.1 (SMESG000066814.1)

HSP 1 Score: 317.775 bits (813), Expect = 5.673e-106
Identity = 167/338 (49.41%), Postives = 220/338 (65.09%), Query Frame = 3
Query:   99 NVKVEKCEFKFNIIDELVEKGIIDTKDKLKPNL-LNSKLEAYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQLGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASYQGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKAFFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIYAKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRKGISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLV 1109
            N+ +E+  F   +I EL    II    K    L +N+ LE  L D +  G  EA FQ GQL F  + Y ++I+YF  G  K  D QCM+Q+GV+YYDGL V  D  L C YMK+I   +  P   HL+ +AA+NLGRA Y G+G+KQS  +A +YWLFAADDG+P  SV AQT LGFFY  +EHLD+ KA FWHSEAC NGS +SQA LGV+Y  GIG  V++GAAL+CL +A+ERG IYA+G LC+Y+Y RKL+  AADL+++V     D I   S        + +RKG+++A FI+ARCL+LG GVQ +   +  Y  KSY W+ E+   F++LV
Sbjct:   14 NIPIEQVSFDAALIKELKVLDIIKPHRKCVHMLKINNNLEIILRDRIKKGIKEACFQYGQLLFLNKMYEDAIYYFNLGATKFKDLQCMYQIGVLYYDGLKVQIDAELACGYMKQILYFKELPEARHLIYAAAFNLGRAYYMGFGVKQSVEKALEYWLFAADDGSPVASVYAQTMLGFFYCHEEHLDIAKAIFWHSEACSNGSAQSQAVLGVMYFLGIGKKVDFGAALLCLRHASERGVIYAQGMLCFYYYSRKLYFNAADLAARVISAAPDSIGDSS--------DSMRKGLALAYFIYARCLNLGFGVQKNACLSQLYSKKSYAWNVEISLYFKQLV 343          
The following BLAST results are available for this feature:
BLAST of LRP2-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
LRP2BP4.246e-8745.66LRP2 binding protein [Source:HGNC Symbol;Acc:HGNC:... [more]
LRP2BP7.403e-8745.22LRP2 binding protein [Source:HGNC Symbol;Acc:HGNC:... [more]
LRP2BP7.403e-8745.22LRP2 binding protein [Source:HGNC Symbol;Acc:HGNC:... [more]
LRP2BP1.694e-1942.74LRP2 binding protein [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of LRP2-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LRP2-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hrd31.971e-625.58gene:FBgn0028475 transcript:FBtr0084467[more]
Hrd31.971e-625.58gene:FBgn0028475 transcript:FBtr0321255[more]
back to top
BLAST of LRP2-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lrp2bp1.324e-8243.56LRP2 binding protein [Source:NCBI gene;Acc:1000733... [more]
back to top
BLAST of LRP2-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lrp2bp1.430e-8846.96LRP2 binding protein [Source:NCBI gene;Acc:1001450... [more]
lrp2bp8.388e-8748.41LRP2 binding protein [Source:NCBI gene;Acc:1001450... [more]
back to top
BLAST of LRP2-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Lrp2bp1.368e-8946.28Lrp2 binding protein [Source:MGI Symbol;Acc:MGI:19... [more]
Lrp2bp1.368e-8946.28Lrp2 binding protein [Source:MGI Symbol;Acc:MGI:19... [more]
Lrp2bp3.293e-8946.28Lrp2 binding protein [Source:MGI Symbol;Acc:MGI:19... [more]
Lrp2bp1.048e-3845.96Lrp2 binding protein [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of LRP2-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q569C2|LR2BP_RAT8.314e-9147.71LRP2-binding protein OS=Rattus norvegicus OX=10116... [more]
sp|Q6IND7|LR2BP_XENLA4.561e-9048.47LRP2-binding protein OS=Xenopus laevis OX=8355 GN=... [more]
sp|Q9D4C6|LR2BP_MOUSE9.566e-8946.28LRP2-binding protein OS=Mus musculus OX=10090 GN=L... [more]
sp|Q4R3N2|LR2BP_MACFA1.449e-8646.08LRP2-binding protein OS=Macaca fascicularis OX=954... [more]
sp|Q9P2M1|LR2BP_HUMAN3.555e-8645.22LRP2-binding protein OS=Homo sapiens OX=9606 GN=LR... [more]
back to top
BLAST of LRP2-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GWY56.050e-9948.90Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GK496.098e-9948.90Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
R7THG86.382e-9948.10TPR_REGION domain-containing protein OS=Capitella ... [more]
A0A1S3I3V19.604e-9849.67LRP2-binding protein OS=Lingula unguis OX=7574 GN=... [more]
A0A210PPF64.173e-9447.62LRP2-binding protein OS=Mizuhopecten yessoensis OX... [more]
back to top
BLAST of LRP2-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lrp2bp6.666e-8546.20LRP2 binding protein [Source:NCBI gene;Acc:1030265... [more]
lrp2bp8.885e-8146.13LRP2 binding protein [Source:NCBI gene;Acc:1030265... [more]
back to top
BLAST of LRP2-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lrp2bp3.850e-8144.33LRP2 binding protein [Source:NCBI gene;Acc:1000733... [more]
back to top
BLAST of LRP2-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LRP2-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO427648.636e-9246.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402215.361e-730.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LRP2-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LRP2-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000050759.10.000e+099.15SMESG000050759.1[more]
SMESG000066814.15.673e-10649.41SMESG000066814.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028730 ID=SMED30028730|Name=LRP2-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1281bp
AACAACACTAAAAATATTTCAATTTAAATATATTATGAACATATAAATTA
TATCTAAGTTTGAAAATGTTGAATAGCCCAATTGTTAATAAAAACTTTAA
TGTTAAAGTCGAAAAATGTGAATTCAAGTTTAACATTATTGATGAATTGG
TTGAAAAAGGAATAATTGACACAAAAGATAAATTAAAACCAAATCTTCTA
AATAGCAAATTAGAAGCTTATCTCATTGATCACTTATATAGCGGCAACAA
TGAAGCATTTTTCCAACTCGGCCAATTGTTTTTCGATAAAGAAGATTACC
ACGAAAGTATATTTTACTTTAAAGGCGGTGTGGACAAAATTTGCGATTTT
CAATGCATGTTTCAATTGGGAGTAATTTATTATGACGGACTTGGAGTTGT
AGCTGATCCTGCTCTCGGATGCGCGTACATGAAAAGGATATTCGAATCAC
AGGGGAATCCTTTGGTTTCTCATTTACTTAACAGCGCAGCTTACAATCTC
GGTAGAGCATCTTACCAGGGTTACGGAATCAAACAGTCGGATTCAGAAGC
AGAAAAGTATTGGTTATTTGCTGCAGATGATGGAAATCCACAAGGAAGTG
TAATGGCACAAACGGCACTTGGATTCTTTTATTCAACAAAAGAACATTTG
GATTTGAAAAAAGCATTTTTTTGGCATTCTGAAGCTTGTGGAAATGGCAG
TATTGAATCCCAAGCCTGTCTTGGAGTTTTATATCTTTACGGAATTGGTG
TTGATGTCAACTGGGGAGCTGCATTGATCTGTCTGGATAATGCGGCCGAG
CGAGGAAGCATTTATGCGAAAGGAAATCTATGTTATTATTTTTATAAGAG
GAAATTATTTACGAAAGCTGCTGATTTATCATCAAAAGTTGCTCAAGTTA
CTGAAGATGAAATAATAAGAGTCTCAAAACATTCGAGCATAATAATTGAG
GAATATCTGAGAAAAGGGATTTCTATTGCTTGCTTCATTTTTGCCCGCTG
TCTGCATTTGGGATTAGGCGTTCAAATGGATTGCGAAGAAGCCTTTAAAT
ATTACTCAAAGTCATATCAATGGGATACTGAACTTTGTTCTGACTTTCAA
AAGCTGGTTCAAGCAAATCTTCTGTAGAAAATCTACAAGATTTATCAATG
AAATTACTAATTTATTCTTATTTTCCTTGTATAAACTTTATTAGATGTTA
TGACCGCAATTTTCTTTTCAACATTTACTACATAAAATGTATAAATGTAG
ATGTATTTTTATTTGAATTTATTGCCAATTC
back to top

protein sequence of SMED30028730-orf-1

>SMED30028730-orf-1 ID=SMED30028730-orf-1|Name=SMED30028730-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=354bp
MLNSPIVNKNFNVKVEKCEFKFNIIDELVEKGIIDTKDKLKPNLLNSKLE
AYLIDHLYSGNNEAFFQLGQLFFDKEDYHESIFYFKGGVDKICDFQCMFQ
LGVIYYDGLGVVADPALGCAYMKRIFESQGNPLVSHLLNSAAYNLGRASY
QGYGIKQSDSEAEKYWLFAADDGNPQGSVMAQTALGFFYSTKEHLDLKKA
FFWHSEACGNGSIESQACLGVLYLYGIGVDVNWGAALICLDNAAERGSIY
AKGNLCYYFYKRKLFTKAADLSSKVAQVTEDEIIRVSKHSSIIIEEYLRK
GISIACFIFARCLHLGLGVQMDCEEAFKYYSKSYQWDTELCSDFQKLVQA
NLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000032dorsal midline
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000461lateral branch
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006597Sel1-like
IPR011990TPR-like_helical_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006597Sel1-like repeatSMARTSM00671sel1coord: 139..174
e-value: 0.0066
score: 25.7
coord: 303..338
e-value: 0.03
score: 23.5
coord: 179..212
e-value: 0.0024
score: 27.1
coord: 213..248
e-value: 0.011
score: 24.9
coord: 95..130
e-value: 6.7
score: 15.2
IPR006597Sel1-like repeatPFAMPF08238Sel1coord: 97..124
e-value: 0.069
score: 13.9
coord: 140..174
e-value: 5.2E-4
score: 20.6
coord: 181..211
e-value: 36.0
score: 5.2
coord: 215..248
e-value: 5.1
score: 7.9
coord: 310..333
e-value: 4.3
score: 8.2
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 51..339
e-value: 9.1E-46
score: 158.2
NoneNo IPR availablePANTHERPTHR44554FAMILY NOT NAMEDcoord: 35..350
NoneNo IPR availableSUPERFAMILYSSF81901HCP-likecoord: 298..337
NoneNo IPR availableSUPERFAMILYSSF81901HCP-likecoord: 63..277