SMED30028726

Overview
NameSMED30028726
Smed IDSMED30028726
Length (bp)857
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30028726 (SMED30028726) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30028726 (SMED30028726) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30028726 (SMED30028726) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30028726 (SMED30028726) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028726

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30028726h1SMcG0009360 Contig30742uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028726h1SMcG0009360 Contig30742newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028726h1SMcG0009361 Contig30742uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028726h1SMcG0009361 Contig30742newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30028726h1SMcG0009361 dd_Smed_v4_26394_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30028726 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000621:19930..27366 +4240
Homology
BLAST of SMED30028726 vs. Ensembl Human
Match: FEZF2 (FEZ family zinc finger 2 [Source:HGNC Symbol;Acc:HGNC:13506])

HSP 1 Score: 268.855 bits (686), Expect = 3.750e-87
Identity = 140/272 (51.47%), Postives = 173/272 (63.60%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYF--SMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            L+   +  ++++  ++F    L +     ++A+ + FL++N  L       F   A      +  +  +  P   +  +   L     G KG       S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  175 LDSTAYPPSELLSGHLFPSGLLNAQAPAALAAHPKLFLLENAKLAGLAADKFPHPA-----PYPHKERLPAPLEQVLKENSALTAERGGVKGHSKLPGGSADG-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 440          
BLAST of SMED30028726 vs. Ensembl Human
Match: FEZF2 (FEZ family zinc finger 2 [Source:HGNC Symbol;Acc:HGNC:13506])

HSP 1 Score: 268.855 bits (686), Expect = 3.750e-87
Identity = 140/272 (51.47%), Postives = 173/272 (63.60%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYF--SMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            L+   +  ++++  ++F    L +     ++A+ + FL++N  L       F   A      +  +  +  P   +  +   L     G KG       S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  175 LDSTAYPPSELLSGHLFPSGLLNAQAPAALAAHPKLFLLENAKLAGLAADKFPHPA-----PYPHKERLPAPLEQVLKENSALTAERGGVKGHSKLPGGSADG-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 440          
BLAST of SMED30028726 vs. Ensembl Human
Match: FEZF2 (FEZ family zinc finger 2 [Source:HGNC Symbol;Acc:HGNC:13506])

HSP 1 Score: 268.855 bits (686), Expect = 3.750e-87
Identity = 140/272 (51.47%), Postives = 173/272 (63.60%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYF--SMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            L+   +  ++++  ++F    L +     ++A+ + FL++N  L       F   A      +  +  +  P   +  +   L     G KG       S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  175 LDSTAYPPSELLSGHLFPSGLLNAQAPAALAAHPKLFLLENAKLAGLAADKFPHPA-----PYPHKERLPAPLEQVLKENSALTAERGGVKGHSKLPGGSADG-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 440          
BLAST of SMED30028726 vs. Ensembl Human
Match: FEZF1 (FEZ family zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:22788])

HSP 1 Score: 266.929 bits (681), Expect = 9.097e-87
Identity = 130/190 (68.42%), Postives = 144/190 (75.79%), Query Frame = 2
Query:  278 FQGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH*SS 847
            F+ S   +GS N       K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H SS
Sbjct:  193 FKTSDFSRGSPN------AKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLHDSS 376          
BLAST of SMED30028726 vs. Ensembl Human
Match: FEZF1 (FEZ family zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:22788])

HSP 1 Score: 266.929 bits (681), Expect = 3.613e-86
Identity = 130/190 (68.42%), Postives = 144/190 (75.79%), Query Frame = 2
Query:  278 FQGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH*SS 847
            F+ S   +GS N       K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H SS
Sbjct:  243 FKTSDFSRGSPN------AKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLHDSS 426          
BLAST of SMED30028726 vs. Ensembl Celegans
Match: fezf-1 (FEZ Family zinc finger protein [Source:UniProtKB/TrEMBL;Acc:O62425])

HSP 1 Score: 251.521 bits (641), Expect = 6.070e-84
Identity = 118/171 (69.01%), Postives = 133/171 (77.78%), Query Frame = 2
Query:  326 DKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            D+   +K+ C  C K+F A YNL RH+PVHTG RPF CKVCGK FRQASTLCRHKIIHT  +PH+CK CGK FNRSSTLNTHVRIHQ  K + CE CGKGFHQ GNYKNH+LTH + K+  C +C +AFHQ YNL  HM TH E KPF C +C+KGFCRNFDLKKHLRK H
Sbjct:   45 DENSRKKFPCEICGKQFNAHYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRHKIIHTDSKPHKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLAFHMFTHEEHKPFTCHVCSKGFCRNFDLKKHLRKMH 215          
BLAST of SMED30028726 vs. Ensembl Celegans
Match: pag-3 (Zinc finger protein PAG-3 [Source:UniProtKB/TrEMBL;Acc:G5EDE1])

HSP 1 Score: 132.109 bits (331), Expect = 4.436e-36
Identity = 66/151 (43.71%), Postives = 91/151 (60.26%), Query Frame = 2
Query:  386 YNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            +N     PV   ++PF C+ C K F   + L +H+ +H +++  +CK CGK+F RSSTL+TH+ IH   + Y CE CGK FHQK + K H   H+ EK  KC +CGKAF Q  NL +H   H   KPF C +C + F R  D ++H R+SH
Sbjct:  113 WNRTPTPPVE--IKPFHCQKCTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRH-RESH 260          

HSP 2 Score: 104.76 bits (260), Expect = 6.472e-26
Identity = 46/112 (41.07%), Postives = 71/112 (63.39%), Query Frame = 2
Query:  332 MKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTH 667
            + D++++C  C K F     L+ HL +H+  RP+ C+ CGK F Q S + +H  IHT E+PH+C VCGK+F++SS L TH R H   K + C+ CG+ F +K + + H+ +H
Sbjct:  149 VSDKQFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRESH 260          

HSP 3 Score: 100.908 bits (250), Expect = 1.890e-24
Identity = 56/185 (30.27%), Postives = 83/185 (44.86%), Query Frame = 2
Query:  221 VQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVC 775
            +  N   P  S+W                 N      ++ + + C  C K F+    L +H  VH   + F CK CGK F+++STL  H +IH+  RP+ C+ CGK F++ S +  H  IH   K + C  CGK F Q  N   H   H+  K   C +CG+ F +  +   H  +H+   P  C
Sbjct:  101 IPQNPESPSASVW-----------------NRTPTPPVEIKPFHCQKCTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRESHHPGHPEEC 268          
BLAST of SMED30028726 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 118.627 bits (296), Expect = 1.118e-29
Identity = 63/176 (35.80%), Postives = 88/176 (50.00%), Query Frame = 2
Query:  302 GSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            G  NY    +    +Y C  CNK F    NL  H+  HTG RPF C++C K F Q + L +H ++HT ERPH+C +C K F+ +S L TH+R+H   K Y C+ C   F Q  + + HK  H+NE+   C  CGK +     L +H  T                C+  D+K  +R
Sbjct:  493 GVPNYVQQQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWKTTT--------------CKEEDMKDSMR 654          
BLAST of SMED30028726 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 118.242 bits (295), Expect = 1.304e-29
Identity = 63/176 (35.80%), Postives = 88/176 (50.00%), Query Frame = 2
Query:  302 GSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            G  NY    +    +Y C  CNK F    NL  H+  HTG RPF C++C K F Q + L +H ++HT ERPH+C +C K F+ +S L TH+R+H   K Y C+ C   F Q  + + HK  H+NE+   C  CGK +     L +H  T                C+  D+K  +R
Sbjct:  493 GVPNYVQQQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWKTTT--------------CKEEDMKDSMR 654          
BLAST of SMED30028726 vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 95.1301 bits (235), Expect = 2.900e-23
Identity = 48/116 (41.38%), Postives = 62/116 (53.45%), Query Frame = 2
Query:  320 SMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTH 667
             M +   + ++C  C K F+   NL  H  +HTG +PF C VC + F Q+S+L  H+  HT ERP+ C  C K+F  SSTL  H+R H   K Y C  C   F Q GN   H  TH
Sbjct:   98 PMARSTPKPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 213          

HSP 2 Score: 93.5893 bits (231), Expect = 9.954e-23
Identity = 51/128 (39.84%), Postives = 64/128 (50.00%), Query Frame = 2
Query:  368 KEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTH 751
            +    Q  +AR  P     +PF C+ CGK F QA+ L  HK IHT E+P  C VC + F++SS+L TH R H   + Y C  C K F        H  TH+  K   C +C   F Q  NL  HM TH
Sbjct:   91 EPLPVQRPMARSTP-----KPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 213          

HSP 3 Score: 86.2705 bits (212), Expect = 5.566e-20
Identity = 39/114 (34.21%), Postives = 64/114 (56.14%), Query Frame = 2
Query:  488 KIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
             +  +T +P +C+ CGK+F++++ L  H RIH   K + C  C + F Q  +   H+ TH+ E+   C  C KAF     LT H+ TH   KP+VC +C   F ++ +L +H++
Sbjct:   98 PMARSTPKPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMK 211          

HSP 4 Score: 65.855 bits (159), Expect = 1.330e-12
Identity = 29/83 (34.94%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQ 586
            ++ + C  CN+ F+   +L  H   HTG RP+ C  C K F  +STL +H   HT  +P+ C +C   F +S  L+ H++ H+
Sbjct:  132 EKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTHK 214          
BLAST of SMED30028726 vs. Ensembl Fly
Match: erm (gene:FBgn0031375 transcript:FBtr0330200)

HSP 1 Score: 278.485 bits (711), Expect = 1.293e-89
Identity = 128/186 (68.82%), Postives = 144/186 (77.42%), Query Frame = 2
Query:  281 QGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            QGS+     G   S    K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT+E+PH+C+ CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK  KC +C KAFHQ+YNLT HMHTHN+ KP+ CR+C KGFCRNFDLKKH+RK H
Sbjct:  291 QGSIEDSSPG---SASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLH 473          
BLAST of SMED30028726 vs. Ensembl Fly
Match: erm (gene:FBgn0031375 transcript:FBtr0077870)

HSP 1 Score: 278.1 bits (710), Expect = 2.184e-89
Identity = 128/186 (68.82%), Postives = 144/186 (77.42%), Query Frame = 2
Query:  281 QGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            QGS+     G   S    K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT+E+PH+C+ CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK  KC +C KAFHQ+YNLT HMHTHN+ KP+ CR+C KGFCRNFDLKKH+RK H
Sbjct:  299 QGSIEDSSPG---SASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLH 481          
BLAST of SMED30028726 vs. Ensembl Fly
Match: erm (gene:FBgn0031375 transcript:FBtr0330201)

HSP 1 Score: 278.87 bits (712), Expect = 4.093e-89
Identity = 128/186 (68.82%), Postives = 144/186 (77.42%), Query Frame = 2
Query:  281 QGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            QGS+     G   S    K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT+E+PH+C+ CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK  KC +C KAFHQ+YNLT HMHTHN+ KP+ CR+C KGFCRNFDLKKH+RK H
Sbjct:  299 QGSIEDSSPG---SASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLH 481          
BLAST of SMED30028726 vs. Ensembl Fly
Match: erm (gene:FBgn0031375 transcript:FBtr0330202)

HSP 1 Score: 278.87 bits (712), Expect = 9.697e-89
Identity = 128/186 (68.82%), Postives = 144/186 (77.42%), Query Frame = 2
Query:  281 QGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            QGS+     G   S    K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT+E+PH+C+ CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK  KC +C KAFHQ+YNLT HMHTHN+ KP+ CR+C KGFCRNFDLKKH+RK H
Sbjct:  299 QGSIEDSSPG---SASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLH 481          
BLAST of SMED30028726 vs. Ensembl Fly
Match: sens-2 (gene:FBgn0051632 transcript:FBtr0079341)

HSP 1 Score: 145.206 bits (365), Expect = 7.273e-39
Identity = 72/165 (43.64%), Postives = 95/165 (57.58%), Query Frame = 2
Query:  347 YQCFYCNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            Y C  C K F+  + L  H    H G +P+ C++C K F    +L +H+ +H  E+  +CK CGK F RSSTL+TH+ IH   + Y C  CGK FHQK + K H   H+ EK  KC +CGKAF Q  NL +H   H   KPF C+LC+K F R  DL++H    H
Sbjct:  507 YSCMKCEKMFSTPHGLEVHSRRTHHGKKPYACELCNKTFGHEVSLSQHRAVHNVEKVFECKQCGKRFKRSSTLSTHLLIHSDTRPYPCNYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGYKPFSCKLCHKAFQRKVDLRRHKETQH 671          

HSP 2 Score: 99.3673 bits (246), Expect = 4.785e-23
Identity = 47/116 (40.52%), Postives = 69/116 (59.48%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRC 685
            ++ ++C  C K F     L+ HL +H+  RP+ C  CGK F Q S + +H  IHT E+PH+C+VCGK+F++SS L TH R H   K + C+ C K F +K + + HK T   + R 
Sbjct:  561 EKVFECKQCGKRFKRSSTLSTHLLIHSDTRPYPCNYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGYKPFSCKLCHKAFQRKVDLRRHKETQHTDLRV 676          
BLAST of SMED30028726 vs. Ensembl Zebrafish
Match: fezf1 (FEZ family zinc finger 1 [Source:NCBI gene;Acc:558801])

HSP 1 Score: 271.937 bits (694), Expect = 7.045e-89
Identity = 130/193 (67.36%), Postives = 147/193 (76.17%), Query Frame = 2
Query:  272 RLFQGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH*SSP 850
            +LF+ S  +  SG+     + K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H  SP
Sbjct:  226 KLFKNSAAKVNSGS----PQTKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFICEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHIRKLHDISP 414          
BLAST of SMED30028726 vs. Ensembl Zebrafish
Match: fezf2 (FEZ family zinc finger 2 [Source:NCBI gene;Acc:60634])

HSP 1 Score: 267.314 bits (682), Expect = 4.828e-87
Identity = 123/168 (73.21%), Postives = 136/168 (80.95%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  245 KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCSICSKAFHQIYNLTFHMHTHNDKKPFTCGTCGKGFCRNFDLKKHIRKLH 412          
BLAST of SMED30028726 vs. Ensembl Zebrafish
Match: fezf2 (FEZ family zinc finger 2 [Source:NCBI gene;Acc:60634])

HSP 1 Score: 267.314 bits (682), Expect = 5.269e-87
Identity = 123/168 (73.21%), Postives = 136/168 (80.95%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  253 KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCSICSKAFHQIYNLTFHMHTHNDKKPFTCGTCGKGFCRNFDLKKHIRKLH 420          
BLAST of SMED30028726 vs. Ensembl Zebrafish
Match: gfi1ab (growth factor independent 1A transcription repressor b [Source:ZFIN;Acc:ZDB-GENE-040116-8])

HSP 1 Score: 162.54 bits (410), Expect = 6.707e-47
Identity = 79/165 (47.88%), Postives = 102/165 (61.82%), Query Frame = 2
Query:  347 YQCFYCNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            Y+C  C+K F+  + L  H+   H+G RPF C +CGK F  A +L +H+ +H+ ER   CK+CGKSF RSSTL+TH+ IH   + Y C+ CGK FHQK + K H   H+ EK  KC +CGKAF Q  NL +H   H   KPF C LC KGF R  DL++H    H
Sbjct:  229 YKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACDICGKTFGHAVSLEQHRAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHKETQH 393          

HSP 2 Score: 106.686 bits (265), Expect = 5.095e-26
Identity = 54/141 (38.30%), Postives = 76/141 (53.90%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAK 763
            + + C  C K F    +L +H  VH+  R F CK+CGK F+++STL  H +IH+  RP+ C+ CGK F++ S +  H  IH   K + C+ CGK F Q  N   H   H+  K   C LCGK F +  +L  H  T +  K
Sbjct:  256 RPFACDICGKTFGHAVSLEQHRAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHKETQHGLK 396          

HSP 3 Score: 105.916 bits (263), Expect = 8.853e-26
Identity = 48/110 (43.64%), Postives = 70/110 (63.64%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLT 664
            +++ + C  C K F     L+ HL +H+  RP+ C+ CGK F Q S + +H  IHT E+PH+C+VCGK+F++SS L TH R H   K + C+ CGKGF +K + + HK T
Sbjct:  282 QERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHKET 391          
BLAST of SMED30028726 vs. Ensembl Zebrafish
Match: gfi1ab (growth factor independent 1A transcription repressor b [Source:ZFIN;Acc:ZDB-GENE-040116-8])

HSP 1 Score: 162.54 bits (410), Expect = 7.222e-47
Identity = 79/165 (47.88%), Postives = 102/165 (61.82%), Query Frame = 2
Query:  347 YQCFYCNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            Y+C  C+K F+  + L  H+   H+G RPF C +CGK F  A +L +H+ +H+ ER   CK+CGKSF RSSTL+TH+ IH   + Y C+ CGK FHQK + K H   H+ EK  KC +CGKAF Q  NL +H   H   KPF C LC KGF R  DL++H    H
Sbjct:  229 YKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACDICGKTFGHAVSLEQHRAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHKETQH 393          

HSP 2 Score: 106.686 bits (265), Expect = 5.304e-26
Identity = 54/141 (38.30%), Postives = 76/141 (53.90%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAK 763
            + + C  C K F    +L +H  VH+  R F CK+CGK F+++STL  H +IH+  RP+ C+ CGK F++ S +  H  IH   K + C+ CGK F Q  N   H   H+  K   C LCGK F +  +L  H  T +  K
Sbjct:  256 RPFACDICGKTFGHAVSLEQHRAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHKETQHGLK 396          

HSP 3 Score: 105.916 bits (263), Expect = 8.942e-26
Identity = 48/110 (43.64%), Postives = 70/110 (63.64%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLT 664
            +++ + C  C K F     L+ HL +H+  RP+ C+ CGK F Q S + +H  IHT E+PH+C+VCGK+F++SS L TH R H   K + C+ CGKGF +K + + HK T
Sbjct:  282 QERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHKET 391          
BLAST of SMED30028726 vs. Ensembl Xenopus
Match: yipf6 (Yip1 domain family member 6 [Source:Xenbase;Acc:XB-GENE-1009736])

HSP 1 Score: 266.159 bits (679), Expect = 2.100e-86
Identity = 123/168 (73.21%), Postives = 136/168 (80.95%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  250 KPKIFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQIYNLTFHMHTHNDKKPFTCGTCGKGFCRNFDLKKHVRKLH 417          
BLAST of SMED30028726 vs. Ensembl Xenopus
Match: hdac8 (histone deacetylase 8 [Source:Xenbase;Acc:XB-GENE-5863426])

HSP 1 Score: 265.388 bits (677), Expect = 7.931e-86
Identity = 122/168 (72.62%), Postives = 135/168 (80.36%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            K + + C  C K F A YNL RH+PVHTG RPF CK+CGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  256 KPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKICGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQIYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLH 423          
BLAST of SMED30028726 vs. Ensembl Xenopus
Match: wdr37 (WD repeat domain 37 [Source:Xenbase;Acc:XB-GENE-5740160])

HSP 1 Score: 162.925 bits (411), Expect = 4.332e-47
Identity = 80/170 (47.06%), Postives = 105/170 (61.76%), Query Frame = 2
Query:  332 MKDQKYQCFYCNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            + +  Y+C  C+K F+  + L  H+   H+G RPF C++CGK F  A +L +HK +H+ ER   CK+CGKSF RSSTL+TH+ IH   + Y C+ CGK FHQK + K H   H+ EK  KC +CGKAF Q  NL +H   H   KPF C LC KGF R  DL++H    H
Sbjct:  211 LNNGSYKCLKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH 380          

HSP 2 Score: 105.916 bits (263), Expect = 9.986e-26
Identity = 54/141 (38.30%), Postives = 76/141 (53.90%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAK 763
            + + C  C K F    +L +H  VH+  R F CK+CGK F+++STL  H +IH+  RP+ C+ CGK F++ S +  H  IH   K + C+ CGK F Q  N   H   H+  K   C LCGK F +  +L  H  T +  K
Sbjct:  243 RPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK 383          
BLAST of SMED30028726 vs. Ensembl Xenopus
Match: mocs1 (molybdenum cofactor synthesis 1 [Source:Xenbase;Acc:XB-GENE-997237])

HSP 1 Score: 157.532 bits (397), Expect = 2.149e-45
Identity = 81/177 (45.76%), Postives = 104/177 (58.76%), Query Frame = 2
Query:  311 NYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            NY      K   Y C  C+K F+  + L  H+   H+G RPF C +CGK F  A +L +H  +H+ ER  +CK+CGK+F RSSTL+TH+ IH   + Y C+ CGK FHQK + K H   H+ EK  KC +CGKAF Q  NL +H   H   KPF C LC KGF R  DL++H    H
Sbjct:  164 NYSMSYSPKMDSYHCVKCSKVFSTSHGLEVHVRRSHSGTRPFVCNICGKSFGHAVSLEQHLNVHSQERSFECKMCGKTFKRSSTLSTHLLIHSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFSCDLCGKGFQRKVDLRRHRENQH 340          

HSP 2 Score: 51.6026 bits (122), Expect = 6.032e-7
Identity = 31/102 (30.39%), Postives = 50/102 (49.02%), Query Frame = 2
Query:  530 CGKSFNRSSTLNTHVRIHQSVKM--YHCESCGKGFHQKGNYKNH-KLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHL 826
            C  + +  S    +  +  S KM  YHC  C K F      + H + +HS  +   C +CGK+F    +L  H++ H++ + F C++C K F R+  L  HL
Sbjct:  151 CPPTLDSDSDHPINYSMSYSPKMDSYHCVKCSKVFSTSHGLEVHVRRSHSGTRPFVCNICGKSFGHAVSLEQHLNVHSQERSFECKMCGKTFKRSSTLSTHL 252          
BLAST of SMED30028726 vs. Ensembl Xenopus
Match: ENSXETT00000024787.1 (gastrula zinc finger protein XlCGF57.1-like [Source:NCBI gene;Acc:105945142])

HSP 1 Score: 148.673 bits (374), Expect = 3.668e-40
Identity = 72/164 (43.90%), Postives = 94/164 (57.32%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ Y C  C K F  +Y L  H+ +HTG +P+TC  CGKGF Q  TL  H  IHT ++P+ C  CGK F   ++L +H++IH   K Y C  CGKGF +K N  +H   H+ EKR  C  CGK F +  +L SHM  H   KPF C  C K F R  DL  H++
Sbjct:  125 ERPYTCSECGKGFAQKYTLVSHMKIHTGEKPYTCSECGKGFAQKYTLVSHMKIHTGDKPYTCSGCGKGFAHKNSLVSHLKIHTGEKPYTCSECGKGFARKNNLLSHMKLHTGEKRFTCTECGKGFARKSDLVSHMKLHTGEKPFTCTECGKAFARKSDLVSHMK 288          

HSP 2 Score: 142.51 bits (358), Expect = 5.937e-38
Identity = 72/164 (43.90%), Postives = 92/164 (56.10%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C  C K+FT + +L  H+ +HTG +PFTCK CGKGF Q   L  H  IHT E+P  C  CGK F + + L +H++IH   K + C  CGKGF  K N  +H   H+ EK   C  CGK F +   L SHM  H   KPF C  C KGF    DL  HL+
Sbjct:  405 EKPFTCTECGKDFTQKKHLVSHIKIHTGEKPFTCKECGKGFTQKYVLVSHIKIHTGEKPFTCSECGKGFTQKNHLVSHMKIHTGEKPFTCTECGKGFALKNNLVSHIRIHTGEKPFTCTECGKGFAKKNQLVSHMKIHTGEKPFTCTECGKGFAHKNDLVSHLK 568          

HSP 3 Score: 140.198 bits (352), Expect = 4.271e-37
Identity = 72/164 (43.90%), Postives = 91/164 (55.49%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            +  + C  C K FT + NL  H+ +HTG +PFTC  CGKGF Q + L  H  IHT E+P  C  CGK F +   L +H++IH   K + C+ CGKGF QK    +H   H+ EK   C  CGK F Q  +L SHM  H   KPF C  C KGF    +L  H+R
Sbjct:  349 ENPFTCTECGKGFTKKNNLVSHMKIHTGEKPFTCTECGKGFAQKNNLLSHMKIHTGEKPFTCTECGKDFTQKKHLVSHIKIHTGEKPFTCKECGKGFTQKYVLVSHIKIHTGEKPFTCSECGKGFTQKNHLVSHMKIHTGEKPFTCTECGKGFALKNNLVSHIR 512          

HSP 4 Score: 139.428 bits (350), Expect = 7.381e-37
Identity = 72/164 (43.90%), Postives = 91/164 (55.49%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C  C K FT + +L  H+  H G RP+TC  CGKGF Q  TL  H  IHT E+P+ C  CGK F +  TL +H++IH   K Y C  CGKGF  K +  +H   H+ EK   C  CGK F +  NL SHM  H   K F C  C KGF R  DL  H++
Sbjct:   97 EKPFTCTECGKGFTQKKSLVSHMKKHAGERPYTCSECGKGFAQKYTLVSHMKIHTGEKPYTCSECGKGFAQKYTLVSHMKIHTGDKPYTCSGCGKGFAHKNSLVSHLKIHTGEKPYTCSECGKGFARKNNLLSHMKLHTGEKRFTCTECGKGFARKSDLVSHMK 260          

HSP 5 Score: 138.658 bits (348), Expect = 1.367e-36
Identity = 68/163 (41.72%), Postives = 93/163 (57.06%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHL 826
            ++ Y C  C K F  +Y L  H+ +HTG +P+TC  CGKGF   ++L  H  IHT E+P+ C  CGK F R + L +H+++H   K + C  CGKGF +K +  +H   H+ EK   C  CGKAF +  +L SHM  H   KPF C  C KGF +   L  H+
Sbjct:  153 EKPYTCSECGKGFAQKYTLVSHMKIHTGDKPYTCSGCGKGFAHKNSLVSHLKIHTGEKPYTCSECGKGFARKNNLLSHMKLHTGEKRFTCTECGKGFARKSDLVSHMKLHTGEKPFTCTECGKAFARKSDLVSHMKLHTGEKPFTCTECGKGFTQKKVLVSHM 315          

HSP 6 Score: 138.658 bits (348), Expect = 1.540e-36
Identity = 69/164 (42.07%), Postives = 90/164 (54.88%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C  C K FT +Y L  H+ +HTG +PFTC  CGKGF Q + L  H  IHT E+P  C  CGK F   + L +H+RIH   K + C  CGKGF +K    +H   H+ EK   C  CGK F    +L SH+  H   KPF C  C KGF +   L  H++
Sbjct:  433 EKPFTCKECGKGFTQKYVLVSHIKIHTGEKPFTCSECGKGFTQKNHLVSHMKIHTGEKPFTCTECGKGFALKNNLVSHIRIHTGEKPFTCTECGKGFAKKNQLVSHMKIHTGEKPFTCTECGKGFAHKNDLVSHLKIHTGEKPFTCTECGKGFAKKNQLVSHMK 596          

HSP 7 Score: 136.732 bits (343), Expect = 6.690e-36
Identity = 69/164 (42.07%), Postives = 89/164 (54.27%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C  C K F  + NL  H+ +HTG +PFTC  CGK F Q   L  H  IHT E+P  CK CGK F +   L +H++IH   K + C  CGKGF QK +  +H   H+ EK   C  CGK F    NL SH+  H   KPF C  C KGF +   L  H++
Sbjct:  377 EKPFTCTECGKGFAQKNNLLSHMKIHTGEKPFTCTECGKDFTQKKHLVSHIKIHTGEKPFTCKECGKGFTQKYVLVSHIKIHTGEKPFTCSECGKGFTQKNHLVSHMKIHTGEKPFTCTECGKGFALKNNLVSHIRIHTGEKPFTCTECGKGFAKKNQLVSHMK 540          

HSP 8 Score: 135.576 bits (340), Expect = 1.784e-35
Identity = 68/164 (41.46%), Postives = 91/164 (55.49%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C  C K FT +  L  H+ +HTG +PFTC  C KGF   + L  H  IHT E P  C  CGK F + + L +H++IH   K + C  CGKGF QK N  +H   H+ EK   C  CGK F Q  +L SH+  H   KPF C+ C KGF + + L  H++
Sbjct:  293 EKPFTCTECGKGFTQKKVLVSHMSIHTGEKPFTCTECDKGFAYKNNLVSHMKIHTGENPFTCTECGKGFTKKNNLVSHMKIHTGEKPFTCTECGKGFAQKNNLLSHMKIHTGEKPFTCTECGKDFTQKKHLVSHIKIHTGEKPFTCKECGKGFTQKYVLVSHIK 456          

HSP 9 Score: 133.265 bits (334), Expect = 1.006e-34
Identity = 68/164 (41.46%), Postives = 91/164 (55.49%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C  C+K F  + NL  H+ +HTG  PFTC  CGKGF + + L  H  IHT E+P  C  CGK F + + L +H++IH   K + C  CGK F QK +  +H   H+ EK   C  CGK F Q Y L SH+  H   KPF C  C KGF +   L  H++
Sbjct:  321 EKPFTCTECDKGFAYKNNLVSHMKIHTGENPFTCTECGKGFTKKNNLVSHMKIHTGEKPFTCTECGKGFAQKNNLLSHMKIHTGEKPFTCTECGKDFTQKKHLVSHIKIHTGEKPFTCKECGKGFTQKYVLVSHIKIHTGEKPFTCSECGKGFTQKNHLVSHMK 484          

HSP 10 Score: 131.339 bits (329), Expect = 5.765e-34
Identity = 67/164 (40.85%), Postives = 87/164 (53.05%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C  C K F  + +L  H+ +HTG +PFTC  CGKGF Q   L  H  IHT E+P  C  C K F   + L +H++IH     + C  CGKGF +K N  +H   H+ EK   C  CGK F Q  NL SHM  H   KPF C  C K F +   L  H++
Sbjct:  265 EKPFTCTECGKAFARKSDLVSHMKLHTGEKPFTCTECGKGFTQKKVLVSHMSIHTGEKPFTCTECDKGFAYKNNLVSHMKIHTGENPFTCTECGKGFTKKNNLVSHMKIHTGEKPFTCTECGKGFAQKNNLLSHMKIHTGEKPFTCTECGKDFTQKKHLVSHIK 428          

HSP 11 Score: 130.954 bits (328), Expect = 8.299e-34
Identity = 67/164 (40.85%), Postives = 90/164 (54.88%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            D+ Y C  C K F  + +L  HL +HTG +P+TC  CGKGF + + L  H  +HT E+   C  CGK F R S L +H+++H   K + C  CGK F +K +  +H   H+ EK   C  CGK F Q   L SHM  H   KPF C  C+KGF    +L  H++
Sbjct:  181 DKPYTCSGCGKGFAHKNSLVSHLKIHTGEKPYTCSECGKGFARKNNLLSHMKLHTGEKRFTCTECGKGFARKSDLVSHMKLHTGEKPFTCTECGKAFARKSDLVSHMKLHTGEKPFTCTECGKGFTQKKVLVSHMSIHTGEKPFTCTECDKGFAYKNNLVSHMK 344          

HSP 12 Score: 130.954 bits (328), Expect = 8.464e-34
Identity = 68/164 (41.46%), Postives = 89/164 (54.27%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ Y C  C K F  + NL  H+ +HTG + FTC  CGKGF + S L  H  +HT E+P  C  CGK+F R S L +H+++H   K + C  CGKGF QK    +H   H+ EK   C  C K F    NL SHM  H    PF C  C KGF +  +L  H++
Sbjct:  209 EKPYTCSECGKGFARKNNLLSHMKLHTGEKRFTCTECGKGFARKSDLVSHMKLHTGEKPFTCTECGKAFARKSDLVSHMKLHTGEKPFTCTECGKGFTQKKVLVSHMSIHTGEKPFTCTECDKGFAYKNNLVSHMKIHTGENPFTCTECGKGFTKKNNLVSHMK 372          

HSP 13 Score: 130.183 bits (326), Expect = 1.468e-33
Identity = 65/164 (39.63%), Postives = 88/164 (53.66%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++++ C  C K F  + +L  H+ +HTG +PFTC  CGK F + S L  H  +HT E+P  C  CGK F +   L +H+ IH   K + C  C KGF  K N  +H   H+ E    C  CGK F +  NL SHM  H   KPF C  C KGF +  +L  H++
Sbjct:  237 EKRFTCTECGKGFARKSDLVSHMKLHTGEKPFTCTECGKAFARKSDLVSHMKLHTGEKPFTCTECGKGFTQKKVLVSHMSIHTGEKPFTCTECDKGFAYKNNLVSHMKIHTGENPFTCTECGKGFTKKNNLVSHMKIHTGEKPFTCTECGKGFAQKNNLLSHMK 400          

HSP 14 Score: 124.02 bits (310), Expect = 2.048e-31
Identity = 64/164 (39.02%), Postives = 87/164 (53.05%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++   C  C +  + + +   H  +HTG +PFTC  CGKGF Q  +L  H   H  ERP+ C  CGK F +  TL +H++IH   K Y C  CGKGF QK    +H   H+ +K   C  CGK F    +L SH+  H   KP+ C  C KGF R  +L  H++
Sbjct:   69 ERNITCAQCKETQSFRISRLTHFVIHTGEKPFTCTECGKGFTQKKSLVSHMKKHAGERPYTCSECGKGFAQKYTLVSHMKIHTGEKPYTCSECGKGFAQKYTLVSHMKIHTGDKPYTCSGCGKGFAHKNSLVSHLKIHTGEKPYTCSECGKGFARKNNLLSHMK 232          

HSP 15 Score: 122.094 bits (305), Expect = 1.219e-30
Identity = 61/146 (41.78%), Postives = 81/146 (55.48%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVC 775
            ++ + C  C K FT + +L  H+ +HTG +PFTC  CGKGF   + L  H  IHT E+P  C  CGK F + + L +H++IH   K + C  CGKGF  K +  +H   H+ EK   C  CGK F +   L SHM  H   KPF C
Sbjct:  461 EKPFTCSECGKGFTQKNHLVSHMKIHTGEKPFTCTECGKGFALKNNLVSHIRIHTGEKPFTCTECGKGFAKKNQLVSHMKIHTGEKPFTCTECGKGFAHKNDLVSHLKIHTGEKPFTCTECGKGFAKKNQLVSHMKIHTGEKPFTC 606          

HSP 16 Score: 78.5666 bits (192), Expect = 9.015e-16
Identity = 48/133 (36.09%), Postives = 64/133 (48.12%), Query Frame = 2
Query:  431 FTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            F C  CGK   Q +        +T ER   C  C ++ +   +  TH  IH   K + C  CGKGF QK +  +H   H+ E+   C  CGK F Q Y L SHM  H   KP+ C  C KGF + + L  H++
Sbjct:   52 FVCAECGKTSPQNA--------NTGERNITCAQCKETQSFRISRLTHFVIHTGEKPFTCTECGKGFTQKKSLVSHMKKHAGERPYTCSECGKGFAQKYTLVSHMKIHTGEKPYTCSECGKGFAQKYTLVSHMK 176          
BLAST of SMED30028726 vs. Ensembl Mouse
Match: Fezf2 (Fez family zinc finger 2 [Source:MGI Symbol;Acc:MGI:1859823])

HSP 1 Score: 275.018 bits (702), Expect = 9.095e-90
Identity = 140/272 (51.47%), Postives = 174/272 (63.97%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLF--QGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            L+   +  ++++  ++F    L +     ++A+ + FL++N  L       F   AS     +  +  +  P   +  +   L   +G V         S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  170 LDSTAYPPSELLGGHLFPSGLLNAQAPTSLAAHPKLFLLENAKLASLAADKFPHPAS-----YPHKERLHAPLEQVLKENSALTAERGGVKSHSKLPGGSTDS-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 435          
BLAST of SMED30028726 vs. Ensembl Mouse
Match: Fezf2 (Fez family zinc finger 2 [Source:MGI Symbol;Acc:MGI:1859823])

HSP 1 Score: 275.018 bits (702), Expect = 9.095e-90
Identity = 140/272 (51.47%), Postives = 174/272 (63.97%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLF--QGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            L+   +  ++++  ++F    L +     ++A+ + FL++N  L       F   AS     +  +  +  P   +  +   L   +G V         S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  170 LDSTAYPPSELLGGHLFPSGLLNAQAPTSLAAHPKLFLLENAKLASLAADKFPHPAS-----YPHKERLHAPLEQVLKENSALTAERGGVKSHSKLPGGSTDS-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 435          
BLAST of SMED30028726 vs. Ensembl Mouse
Match: Fezf1 (Fez family zinc finger 1 [Source:MGI Symbol;Acc:MGI:1920441])

HSP 1 Score: 267.314 bits (682), Expect = 1.719e-86
Identity = 130/190 (68.42%), Postives = 144/190 (75.79%), Query Frame = 2
Query:  278 FQGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH*SS 847
            F+ S   +GS N       K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H SS
Sbjct:  243 FKTSDFSRGSPN------AKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLHDSS 426          
BLAST of SMED30028726 vs. Ensembl Mouse
Match: Fezf2 (Fez family zinc finger 2 [Source:MGI Symbol;Acc:MGI:1859823])

HSP 1 Score: 169.088 bits (427), Expect = 1.352e-49
Identity = 90/206 (43.69%), Postives = 119/206 (57.77%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLF--QGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKG 640
            L+   +  ++++  ++F    L +     ++A+ + FL++N  L       F   AS     +  +  +  P   +  +   L   +G V         S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKG
Sbjct:  170 LDSTAYPPSELLGGHLFPSGLLNAQAPTSLAAHPKLFLLENAKLASLAADKFPHPAS-----YPHKERLHAPLEQVLKENSALTAERGGVKSHSKLPGGSTDS-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKG 369          

HSP 2 Score: 87.8113 bits (216), Expect = 2.653e-19
Identity = 41/92 (44.57%), Postives = 53/92 (57.61%), Query Frame = 2
Query:  521 CKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGF 796
            C+VCGK FN    L  H+ +H   + + C+ CGKGF Q      HK+ H+ EK  KC  CGKAF++   L +H+  H   KPFVC  C KGF
Sbjct:  274 CEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGF 365          

HSP 3 Score: 56.9954 bits (136), Expect = 7.782e-9
Identity = 36/125 (28.80%), Postives = 56/125 (44.80%), Query Frame = 2
Query:  461 RQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKL----THSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 823
            +  ++L  H  +   E      +    F   ++     R+H  ++    E+      + G   + KL    T S  K   C +CGK F+  YNLT HM  H  A+PFVC++C KGF +   L +H
Sbjct:  194 QAPTSLAAHPKLFLLENAKLASLAADKFPHPASYPHKERLHAPLEQVLKENSALTAERGGVKSHSKLPGGSTDSKPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRH 318          
BLAST of SMED30028726 vs. Ensembl Mouse
Match: Gfi1 (growth factor independent 1 transcription repressor [Source:MGI Symbol;Acc:MGI:103170])

HSP 1 Score: 162.925 bits (411), Expect = 9.156e-47
Identity = 80/165 (48.48%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  347 YQCFYCNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            Y+C  C+K F+  + L  H+   H+G RPF C++CGK F  A +L +HK +H+ ER   CK+CGKSF RSSTL+TH+ IH   + Y C+ CGK FHQK + K H   H+ EK  KC +CGKAF Q  NL +H   H   KPF C LC KGF R  DL++H    H
Sbjct:  256 YKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH 420          

HSP 2 Score: 105.916 bits (263), Expect = 1.517e-25
Identity = 54/141 (38.30%), Postives = 76/141 (53.90%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAK 763
            + + C  C K F    +L +H  VH+  R F CK+CGK F+++STL  H +IH+  RP+ C+ CGK F++ S +  H  IH   K + C+ CGK F Q  N   H   H+  K   C LCGK F +  +L  H  T +  K
Sbjct:  283 RPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK 423          

HSP 3 Score: 104.375 bits (259), Expect = 5.006e-25
Identity = 47/110 (42.73%), Postives = 70/110 (63.64%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLT 664
            +++ + C  C K F     L+ HL +H+  RP+ C+ CGK F Q S + +H  IHT E+PH+C+VCGK+F++SS L TH R H   K + C+ CGKGF +K + + H+ T
Sbjct:  309 QERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRET 418          
BLAST of SMED30028726 vs. UniProt/SwissProt
Match: sp|Q2VWH6|FEZF2_BOVIN (Fez family zinc finger protein 2 OS=Bos taurus OX=9913 GN=FEZF2 PE=2 SV=2)

HSP 1 Score: 280.796 bits (717), Expect = 4.069e-91
Identity = 142/272 (52.21%), Postives = 176/272 (64.71%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYF--SMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            L+ A + S++++  ++F    L +     ++A+ + FL++N  L       F   A      ++ +  +  P   +  +   L     G KG       S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  174 LDSATYPSSELLGGHLFPSGLLNTQAPAALAAHPKLFLLENAKLAGLTADKFAHPA-----PYAHKERLPAPLEQVLKENSALTAERGGVKGHSKLPGGSADG-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 439          
BLAST of SMED30028726 vs. UniProt/SwissProt
Match: sp|Q9ESP5|FEZF2_MOUSE (Fez family zinc finger protein 2 OS=Mus musculus OX=10090 GN=Fezf2 PE=1 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 6.362e-89
Identity = 140/272 (51.47%), Postives = 174/272 (63.97%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLF--QGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            L+   +  ++++  ++F    L +     ++A+ + FL++N  L       F   AS     +  +  +  P   +  +   L   +G V         S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  170 LDSTAYPPSELLGGHLFPSGLLNAQAPTSLAAHPKLFLLENAKLASLAADKFPHPAS-----YPHKERLHAPLEQVLKENSALTAERGGVKSHSKLPGGSTDS-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 435          
BLAST of SMED30028726 vs. UniProt/SwissProt
Match: sp|Q9VQ56|ERM_DROME (Fez family zinc finger protein erm OS=Drosophila melanogaster OX=7227 GN=erm PE=1 SV=2)

HSP 1 Score: 278.1 bits (710), Expect = 2.190e-88
Identity = 128/186 (68.82%), Postives = 144/186 (77.42%), Query Frame = 2
Query:  281 QGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            QGS+     G   S    K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT+E+PH+C+ CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK  KC +C KAFHQ+YNLT HMHTHN+ KP+ CR+C KGFCRNFDLKKH+RK H
Sbjct:  299 QGSIEDSSPG---SASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLH 481          
BLAST of SMED30028726 vs. UniProt/SwissProt
Match: sp|Q25C93|FEZF1_DANRE (Fez family zinc finger protein 1 OS=Danio rerio OX=7955 GN=fezf1 PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 5.318e-88
Identity = 130/193 (67.36%), Postives = 147/193 (76.17%), Query Frame = 2
Query:  272 RLFQGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH*SSP 850
            +LF+ S  +  SG+     + K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H  SP
Sbjct:  226 KLFKNSAAKVNSGS----PQTKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFICEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHIRKLHDISP 414          
BLAST of SMED30028726 vs. UniProt/SwissProt
Match: sp|Q8TBJ5|FEZF2_HUMAN (Fez family zinc finger protein 2 OS=Homo sapiens OX=9606 GN=FEZF2 PE=2 SV=2)

HSP 1 Score: 268.855 bits (686), Expect = 1.801e-86
Identity = 140/272 (51.47%), Postives = 173/272 (63.60%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYF--SMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            L+   +  ++++  ++F    L +     ++A+ + FL++N  L       F   A      +  +  +  P   +  +   L     G KG       S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  175 LDSTAYPPSELLSGHLFPSGLLNAQAPAALAAHPKLFLLENAKLAGLAADKFPHPA-----PYPHKERLPAPLEQVLKENSALTAERGGVKGHSKLPGGSADG-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 440          
BLAST of SMED30028726 vs. TrEMBL
Match: A0A4W2BPA9 (FEZ family zinc finger 2 OS=Bos indicus x Bos taurus OX=30522 GN=FEZF2 PE=4 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 1.241e-88
Identity = 142/272 (52.21%), Postives = 176/272 (64.71%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYF--SMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            L+ A + S++++  ++F    L +     ++A+ + FL++N  L       F   A      ++ +  +  P   +  +   L     G KG       S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  175 LDSATYPSSELLGGHLFPSGLLNTQAPAALAAHPKLFLLENAKLAGLTADKFAHPA-----PYAHKERLPAPLEQVLKENSALTAERGGVKGHSKLPGGSADG-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 440          
BLAST of SMED30028726 vs. TrEMBL
Match: L8ITA1 (Fez family zinc finger protein 2 (Fragment) OS=Bos mutus OX=72004 GN=M91_02401 PE=4 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 1.696e-88
Identity = 141/272 (51.84%), Postives = 175/272 (64.34%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYF--SMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            L+ A +  ++++  ++F    L +     ++A+ + FL++N  L       F   A      ++ +  +  P   +  +   L     G KG       S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  142 LDSATYPPSELLGGHLFPSGLLNTQAPAALAAHPKLFLLENAKLAGLTADKFAHPA-----PYAHKERLPAPLEQVLKENSALTAERGGVKGHSKLPGGSADG-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 407          
BLAST of SMED30028726 vs. TrEMBL
Match: A0A5N3WF33 (Uncharacterized protein OS=Muntiacus muntjak OX=9888 GN=FD754_004515 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 1.784e-88
Identity = 141/272 (51.84%), Postives = 175/272 (64.34%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYF--SMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            L+ A +  ++++  ++F    L +     ++A+ + FL++N  L       F   A      ++ +  +  P   +  +   L     G KG       S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  167 LDSATYPPSELLGGHLFPSGLLNTQAPAALAAHPKLFLLENAKLAGLTADKFAHPA-----PYAHKERLPAPLEQVLKENSALTAERGGVKGHSKLPGGSADG-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 432          
BLAST of SMED30028726 vs. TrEMBL
Match: A0A5N3Y0X5 (Uncharacterized protein OS=Muntiacus reevesi OX=9886 GN=FD755_010716 PE=4 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 3.906e-88
Identity = 141/272 (51.84%), Postives = 175/272 (64.34%), Query Frame = 2
Query:   29 LNDADHWSAQIMLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYF--SMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            L+ A +  ++++  ++F    L +     ++A+ + FL++N  L       F   A      ++ +  +  P   +  +   L     G KG       S D  K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH+RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  177 LDSATYPPSELLGGHLFPSGLLNTQAPAALAAHPKLFLLENAKLAGLTADKFAHPA-----PYAHKERLPAPLEQVLKENSALTAERGGVKGHSKLPGGSADG-KPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 442          
BLAST of SMED30028726 vs. TrEMBL
Match: B0X0B0 (Zinc finger protein OS=Culex quinquefasciatus OX=7176 GN=6045781 PE=4 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 4.526e-88
Identity = 134/219 (61.19%), Postives = 156/219 (71.23%), Query Frame = 2
Query:  185 TEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYFSMDKMKDQK-YQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            T  +++ S++ S  S   HP  +           S    GS N  S   +  QK + C  C K F A YNL RH+PVHTG RPF CK+CGKGFRQASTLCRHKIIHT+E+PH+C+ CGK+FNRSSTLNTH RIH   K Y CE CGKGFHQKGNYKNHKLTHS +K  KC +C KAFHQ+YNLT HMHTHN+ KPF C++C KGFCRNFDLKKH+RK H
Sbjct:  187 TAASALRSLESSAVSPTQHPAAT-------ELNSSTNSAGSTNPGSAAALAKQKTFACPECGKVFNAHYNLTRHMPVHTGARPFICKICGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHTRIHAGYKPYICEYCGKGFHQKGNYKNHKLTHSGDKAYKCNICNKAFHQVYNLTFHMHTHNDKKPFTCKICAKGFCRNFDLKKHMRKLH 398          
BLAST of SMED30028726 vs. Ensembl Cavefish
Match: fezf2 (FEZ family zinc finger 2 [Source:NCBI gene;Acc:60634])

HSP 1 Score: 268.085 bits (684), Expect = 3.369e-87
Identity = 124/168 (73.81%), Postives = 136/168 (80.95%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTHVRIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  260 KPKSFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHVRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCSICSKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLH 427          
BLAST of SMED30028726 vs. Ensembl Cavefish
Match: fezf1 (FEZ family zinc finger 1 [Source:NCBI gene;Acc:103028855])

HSP 1 Score: 264.233 bits (674), Expect = 3.097e-86
Identity = 125/180 (69.44%), Postives = 137/180 (76.11%), Query Frame = 2
Query:  299 KGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            K S         K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  212 KNSAKIGGAPHSKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCTQCGKAFNRSSTLNTHARIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHIRKLH 391          
BLAST of SMED30028726 vs. Ensembl Cavefish
Match: gfi1ab (zinc finger protein Gfi-1-like [Source:NCBI gene;Acc:103028167])

HSP 1 Score: 161.384 bits (407), Expect = 9.645e-47
Identity = 78/170 (45.88%), Postives = 104/170 (61.18%), Query Frame = 2
Query:  332 MKDQKYQCFYCNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            M +  ++C  C+K F+  + L  H+   H+G RP+ C +CGK F  A +L +H+ +H+ ER   CK+CGKSF RSSTL+TH+ IH   + Y C+ CGK FHQK + K H   H+ EK  KC +CGKAF Q  NL +H   H   KPF C LC KGF R  DL++H    H
Sbjct:  207 MLNGAFKCIKCSKVFSTPHGLEVHVRRSHSGTRPYACDICGKTFGHAVSLEQHRAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACELCGKGFQRKVDLRRHKETQH 376          

HSP 2 Score: 107.842 bits (268), Expect = 1.333e-26
Identity = 55/141 (39.01%), Postives = 76/141 (53.90%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAK 763
            + Y C  C K F    +L +H  VH+  R F CK+CGK F+++STL  H +IH+  RP+ C+ CGK F++ S +  H  IH   K + C+ CGK F Q  N   H   H+  K   C LCGK F +  +L  H  T +  K
Sbjct:  239 RPYACDICGKTFGHAVSLEQHRAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACELCGKGFQRKVDLRRHKETQHGLK 379          
BLAST of SMED30028726 vs. Ensembl Cavefish
Match: GFI1 (growth factor independent 1 transcriptional repressor [Source:HGNC Symbol;Acc:HGNC:4237])

HSP 1 Score: 157.532 bits (397), Expect = 6.640e-46
Identity = 79/165 (47.88%), Postives = 100/165 (60.61%), Query Frame = 2
Query:  347 YQCFYCNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            Y+C  C K F+  + L  H+   H+G RPF C+ CGK F  A +L +H+ +H+ ER   CK+CGKSF RSSTL+THV IH   + + C  CGK FHQK + K H   H+ EK  KC +CGKAF Q  NL +H   H   KPF C LC KGF R  DL++H    H
Sbjct:  145 YKCVKCTKAFSTPHGLEVHVRRSHSGSRPFACETCGKTFGHAVSLEQHRAVHSQERIFSCKICGKSFKRSSTLSTHVLIHSDTRPFACPYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCAKGFQRKVDLRRHREAQH 309          

HSP 2 Score: 100.138 bits (248), Expect = 3.261e-24
Identity = 51/133 (38.35%), Postives = 71/133 (53.38%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSH 739
            + + C  C K F    +L +H  VH+  R F+CK+CGK F+++STL  H +IH+  RP  C  CGK F++ S +  H  IH   K + C+ CGK F Q  N   H   H+  K   C LC K F +  +L  H
Sbjct:  172 RPFACETCGKTFGHAVSLEQHRAVHSQERIFSCKICGKSFKRSSTLSTHVLIHSDTRPFACPYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCAKGFQRKVDLRRH 304          

HSP 3 Score: 99.7525 bits (247), Expect = 4.080e-24
Identity = 45/108 (41.67%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHK 658
            +++ + C  C K F     L+ H+ +H+  RPF C  CGK F Q S + +H  IHT E+PH+C+VCGK+F++SS L TH R H   K + C+ C KGF +K + + H+
Sbjct:  198 QERIFSCKICGKSFKRSSTLSTHVLIHSDTRPFACPYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCAKGFQRKVDLRRHR 305          
BLAST of SMED30028726 vs. Ensembl Cavefish
Match: GFI1B (growth factor independent 1B transcriptional repressor [Source:NCBI gene;Acc:103023716])

HSP 1 Score: 152.525 bits (384), Expect = 8.049e-44
Identity = 76/165 (46.06%), Postives = 101/165 (61.21%), Query Frame = 2
Query:  347 YQCFYCNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            Y C  C+K F+  + L  H+   H+G RPF C +C K F  A +L +H  +H+ ER  +CK+CGK+F RSSTL+TH+ IH   + Y C+ CGK FHQK + K H   H+ EK  KC +CGKAF Q  NL +H   H   KPF C +C+KGF R  DL++H    H
Sbjct:  167 YHCITCDKVFSTPHGLEVHVRRSHSGTRPFGCSICRKTFGHAVSLEQHMNVHSQERSFECKMCGKTFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCEICSKGFQRKVDLRRHHESQH 331          

HSP 2 Score: 104.76 bits (260), Expect = 8.096e-26
Identity = 53/133 (39.85%), Postives = 80/133 (60.15%), Query Frame = 2
Query:  272 RLFQGSVGRKGSGNYFSMDK-----MKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNH 655
            R F  S+ RK  G+  S+++      +++ ++C  C K F     L+ HL +H+  RP+ C+ CGK F Q S + +H  IHT E+PH+C+VCGK+F++SS L TH R H   K + CE C KGF +K + + H
Sbjct:  194 RPFGCSICRKTFGHAVSLEQHMNVHSQERSFECKMCGKTFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCEICSKGFQRKVDLRRH 326          

HSP 3 Score: 99.3673 bits (246), Expect = 7.912e-24
Identity = 50/133 (37.59%), Postives = 73/133 (54.89%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSH 739
            + + C  C K F    +L +H+ VH+  R F CK+CGK F+++STL  H +IH+  RP+ C+ CGK F++ S +  H  IH   K + C+ CGK F Q  N   H   H+  K   C +C K F +  +L  H
Sbjct:  194 RPFGCSICRKTFGHAVSLEQHMNVHSQERSFECKMCGKTFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCEICSKGFQRKVDLRRH 326          
BLAST of SMED30028726 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001428.1 (pep scaffold:Pmarinus_7.0:GL481113:143068:144258:1 gene:ENSPMAG00000001294.1 transcript:ENSPMAT00000001428.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.961 bits (341), Expect = 9.022e-38
Identity = 67/167 (40.12%), Postives = 93/167 (55.69%), Query Frame = 2
Query:  323 MDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 823
            M    ++ Y+C+ C   F    NL  H+ +H G +P+ C VCGKGF ++STL  H  IH TE+PH C VCGK F+R   L  HV IH     + C  CGK F ++   ++H   H+ E   +C +CGK F + + L +HM TH   +P  C +C KGF R   L+ H
Sbjct:   24 MSHTGEKPYKCYMCENAFVTASNLKNHMSIHNGEKPYRCSVCGKGFNRSSTLATHATIHATEKPHICPVCGKGFSRPFALKCHVVIHSGDCPHKCALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSRSFVLKTHMMTHTGERPHKCPVCGKGFGRLSTLQNH 190          

HSP 2 Score: 134.42 bits (337), Expect = 3.125e-37
Identity = 72/163 (44.17%), Postives = 93/163 (57.06%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHL 826
            +  ++C  C K F+  + L  H+  HTG RP  C VCGKGF + STL  H  +HT E+ H+C VCGK F+RS  L  H+R H     + C  C KGF +    KNH +TH+ E+  KC +CGKAF Q   L SHM TH   +P  C LC K F +   LK H+
Sbjct:  141 EWSHRCSVCGKGFSRSFVLKTHMMTHTGERPHKCPVCGKGFGRLSTLQNHATMHTGEKVHKCLVCGKGFSRSVQLKRHMRNHTGEWRHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSHMKTHTGERPHKCSLCEKDFKQCTGLKSHM 303          

HSP 3 Score: 127.872 bits (320), Expect = 8.891e-35
Identity = 69/163 (42.33%), Postives = 91/163 (55.83%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHL 826
            ++ ++C  C+K F    +L  H+  HTG +P+ C +C   F  AS L  H  IH  E+P++C VCGK FNRSSTL TH  IH + K + C  CGKGF +    K H + HS +   KC LCGK F +   L  HM  H       C +C KGF R+F LK H+
Sbjct:    1 ERPHKCSVCSKSFVRPSDLKNHVMSHTGEKPYKCYMCENAFVTASNLKNHMSIHNGEKPYRCSVCGKGFNRSSTLATHATIHATEKPHICPVCGKGFSRPFALKCHVVIHSGDCPHKCALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSRSFVLKTHM 163          

HSP 4 Score: 120.939 bits (302), Expect = 2.977e-32
Identity = 65/164 (39.63%), Postives = 92/164 (56.10%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ ++C  C K F+    L RH+  HTG     C VC KGF + S L  H + HT ERPH+C VCGK+F + + L +H++ H   + + C  C K F Q    K+H LTH+ E+  KC +C K F    +L SHM TH+  KP+ C  C K F  +  LK H++
Sbjct:  197 EKVHKCLVCGKGFSRSVQLKRHMRNHTGEWRHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSHMKTHTGERPHKCSLCEKDFKQCTGLKSHMLTHTGERAYKCSVCEKDFIHSTSLKSHMKTHSGEKPYKCSACKKDFRHSTTLKNHMK 360          

HSP 5 Score: 111.694 bits (278), Expect = 7.925e-29
Identity = 65/169 (38.46%), Postives = 86/169 (50.89%), Query Frame = 2
Query:  323 MDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            M    ++ ++C  C K F     L  H  +HTG +   C VCGKGF ++  L RH   HT E  H+C VC K F R S L  H+  H   + + C  CGK F Q    K+H  TH+ E+  KC LC K F Q   L SHM TH   + + C +C K F  +  LK H++
Sbjct:  164 MTHTGERPHKCPVCGKGFGRLSTLQNHATMHTGEKVHKCLVCGKGFSRSVQLKRHMRNHTGEWRHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSHMKTHTGERPHKCSLCEKDFKQCTGLKSHMLTHTGERAYKCSVCEKDFIHSTSLKSHMK 332          

HSP 6 Score: 107.071 bits (266), Expect = 3.663e-27
Identity = 58/145 (40.00%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFV 772
            + +++C  C K F     L  H+  HTG RP  C VCGK F+Q + L  H   HT ERPH+C +C K F + + L +H+  H   + Y C  C K F    + K+H  THS EK  KC  C K F     L +HM TH   KP V
Sbjct:  225 EWRHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSHMKTHTGERPHKCSLCEKDFKQCTGLKSHMLTHTGERAYKCSVCEKDFIHSTSLKSHMKTHSGEKPYKCSACKKDFRHSTTLKNHMKTHTGEKPHV 369          

HSP 7 Score: 95.1301 bits (235), Expect = 8.003e-23
Identity = 51/135 (37.78%), Postives = 71/135 (52.59%), Query Frame = 2
Query:  425 RPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            RP  C VC K F + S L  H + HT E+P++C +C  +F  +S L  H+ IH   K Y C  CGKGF++      H   H+ EK   C +CGK F + + L  H+  H+   P  C LC K F +   L+ H+R
Sbjct:    2 RPHKCSVCSKSFVRPSDLKNHVMSHTGEKPYKCYMCENAFVTASNLKNHMSIHNGEKPYRCSVCGKGFNRSSTLATHATIHATEKPHICPVCGKGFSRPFALKCHVVIHSGDCPHKCALCGKEFRKEMQLQDHMR 136          
BLAST of SMED30028726 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002487.1 (pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1 gene:ENSPMAG00000002270.1 transcript:ENSPMAT00000002487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 9.510e-38
Identity = 73/164 (44.51%), Postives = 96/164 (58.54%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ Y C  C + F+   +L  H   HTG RPF C  CGK F QASTL  H  IHT ERP+ CK CGKSF+ SS +  H + H   K + C+ CG+GF QK + K H+  H+ EK   C +CGK+F   YNL +H  TH + +P++C LC K F     L  H+R
Sbjct:   99 ERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMR 262          

HSP 2 Score: 134.806 bits (338), Expect = 1.757e-36
Identity = 71/164 (43.29%), Postives = 93/164 (56.71%), Query Frame = 2
Query:  332 MKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 823
            +K++ Y C  C K F+ +  L  H+  HTGV+P+ C  CG  F Q   L  HK IHT ERP  CK+CGK F   STL TH   H   K + C+ CGKG+  K   KNH++ HS EK   C  CGK F Q  +L +H  TH+  +PF+C+ C + F +   LK H
Sbjct:  237 LKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTH 400          

HSP 3 Score: 128.642 bits (322), Expect = 3.654e-34
Identity = 67/164 (40.85%), Postives = 94/164 (57.32%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C +C K ++ +  L  H  VH+G +PF CK CGKGF Q S+L  HK+ H  E+P  C+ CG+ F+++S+L TH  +H   K + C  CGK F    + K H+  HS+E+   C  CGK+F    NL  H  TH   KPF C LC +GF +   LK H R
Sbjct:  323 EKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQQMHSSERPFICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSHQR 486          

HSP 4 Score: 128.257 bits (321), Expect = 3.842e-34
Identity = 69/161 (42.86%), Postives = 91/161 (56.52%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 823
            + Y C +C  +F+   +L  H  +HTG RPF CK+CGKGF   STL  H+  H+ E+P  CK CGK ++  STL  H  +H   K + C+ CGKGF Q  + KNHKLTH  E+   C  CG+ F Q  +L +H   H   K F+C  C K F     LK+H
Sbjct:  268 KPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQH 428          

HSP 5 Score: 122.094 bits (305), Expect = 7.964e-32
Identity = 67/164 (40.85%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C  C K F     L  H  +HTG RP+ CK CGK F  +S +  H+  HT E+P  CK CG+ F +   L TH RIH   K Y C  CGK F    N K H+ TH  E+   C LCGK F     L  HM TH   KP++C  C   F +   LK H R
Sbjct:  127 ERPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKR 290          

HSP 6 Score: 119.783 bits (299), Expect = 5.307e-31
Identity = 64/162 (39.51%), Postives = 85/162 (52.47%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 823
            ++ Y C  C K F+    +  H   HTG +PF CK CG+GF Q   L  H+ IHT E+P+ C +CGKSF+ +  L  H + H   + Y CE CGK F  K     H  TH+  K   C  CG  F Q  +L +H   H   +PF+C++C KGF     LK H
Sbjct:  155 ERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTH 316          

HSP 7 Score: 118.242 bits (295), Expect = 1.691e-30
Identity = 62/162 (38.27%), Postives = 87/162 (53.70%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 823
            ++ + C  C + F  + +L  H  +HTG +P+ C +CGK F     L  H+  H  ERP+ C++CGK F+   TL  H+R H  VK Y C  CG  F Q  + K HK  H+ E+   C +CGK F     L +H  TH+  KPF+C+ C KG+     LK H
Sbjct:  183 EKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNH 344          

HSP 8 Score: 118.242 bits (295), Expect = 1.885e-30
Identity = 62/164 (37.80%), Postives = 89/164 (54.27%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C  C K F+ +  L  H   H+  +PF C  CGKGF +AS +  H++ HT ERP+ C+ CG+ F++ S+L TH   H   + + C  CGK F Q    K H   H+ E+   C  CGK+F     +T H  TH   KPF+C+ C +GF +   LK H R
Sbjct:   43 EKPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQR 206          

HSP 9 Score: 117.857 bits (294), Expect = 2.253e-30
Identity = 64/162 (39.51%), Postives = 84/162 (51.85%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 823
            ++ Y C  C K F+  YNL  H   H   RP+ C++CGK F    TL  H   HT  +P+ C  CG  F++   L  H RIH   + + C+ CGKGF  K   K H+ THS EK   C  CGK +     L +H   H+  KPF+C+ C KGF +   LK H
Sbjct:  211 EKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNH 372          

HSP 10 Score: 116.316 bits (290), Expect = 8.719e-30
Identity = 65/167 (38.92%), Postives = 95/167 (56.89%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            ++ + C  C K F+   +L  H   H G +PF C+ CG+ F Q S+L  H+++HT E+   C  CGK F+  S+L  H ++H S + + C+ CGK F    N K H+ TH+ +K   C LCG+ F Q  +L SH  TH   KP+ C+ C K F  N +LK H +K+H
Sbjct:  351 EKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQQMHSSERPFICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVH-KKTH 516          

HSP 11 Score: 115.161 bits (287), Expect = 2.407e-29
Identity = 61/164 (37.20%), Postives = 89/164 (54.27%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C  C K F  +  L  H   H+  +PF CK CGKG+   STL  H+I+H+ E+P  CK CGK F++ S+L  H   H   + + C+ CG+ F Q  + K H+L H+ EK   C  CGK F    +L  H   H+  +PF+C+ C K F    +LK H +
Sbjct:  295 ERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQQMHSSERPFICKECGKSFSYYSNLKVHQK 458          

HSP 12 Score: 113.62 bits (283), Expect = 8.071e-29
Identity = 59/157 (37.58%), Postives = 84/157 (53.50%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVH----TGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGF 796
            ++ Y C  C K F+++  L +HL  H    TG +PF C+ CGK F   STL  H + H+ E+P  C  CGK F+++S +  H   H   + Y C+ CG+ F Q  + K H+ TH+ E+   C  CGK F Q   L  H   H   +P+VC+ C K F
Sbjct:   11 EKMYMCEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSF 167          

HSP 13 Score: 69.707 bits (169), Expect = 8.461e-14
Identity = 33/83 (39.76%), Postives = 49/83 (59.04%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQ 586
            ++ + C  C K F+   NL  H   HTG +PFTC +CG+GF Q   L  H+  HT E+P++C+ CGK F+ +  L  H + H+
Sbjct:  435 ERPFICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVHKKTHK 517          
BLAST of SMED30028726 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000449.1 (pep scaffold:Pmarinus_7.0:GL478964:311851:312750:-1 gene:ENSPMAG00000000404.1 transcript:ENSPMAT00000000449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 3.908e-34
Identity = 68/163 (41.72%), Postives = 90/163 (55.21%), Query Frame = 2
Query:  350 QCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            +C  C + F+       H  +H    P  CKVC K F  A  L  H+ IH  ++P  CK CGK+F++ + LN H RIH   K YHC+ C K F Q  N  NH  TH+ EK  +C +CGKAF Q+ NL +H  TH   KPF C++C+K F +  +L  H R  H
Sbjct:   80 RCEKCGEAFSKVTKRNSHQCIHRQETPHCCKVCNKVFSHAKHLNNHQHIHMRDKPFICKECGKAFSQVTQLNNHWRIHTGEKPYHCKMCDKAFSQVTNLNNHYRTHTGEKPYRCQICGKAFTQVTNLNNHYRTHTGEKPFRCKMCDKAFSQVANLNSHQRIHH 242          

HSP 2 Score: 92.0485 bits (227), Expect = 1.877e-22
Identity = 43/112 (38.39%), Postives = 64/112 (57.14%), Query Frame = 2
Query:  332 MKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTH 667
            M+D+ + C  C K F+    L  H  +HTG +P+ CK+C K F Q + L  H   HT E+P++C++CGK+F + + LN H R H   K + C+ C K F Q  N  +H+  H
Sbjct:  130 MRDKPFICKECGKAFSQVTQLNNHWRIHTGEKPYHCKMCDKAFSQVTNLNNHYRTHTGEKPYRCQICGKAFTQVTNLNNHYRTHTGEKPFRCKMCDKAFSQVANLNSHQRIH 241          

HSP 3 Score: 51.6026 bits (122), Expect = 4.853e-8
Identity = 35/122 (28.69%), Postives = 53/122 (43.44%), Query Frame = 2
Query:  509 RPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHS-------------------NEKRC-------KCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGF 796
            +P+  K+ G +F +   L          + YHCE CG+GF Q G +K H+  H+                   NE+R        +C  CG+AF ++    SH   H +  P  C++CNK F
Sbjct:    3 KPYSVKLTGDAFKKHKALGE--------RAYHCERCGRGFLQNGAFKRHRRMHTRGNLYGCDFHERMFRSYLKNEQRIHRGENCRRCEKCGEAFSKVTKRNSHQCIHRQETPHCCKVCNKVF 116          
BLAST of SMED30028726 vs. Ensembl Sea Lamprey
Match: ZNF436 (zinc finger protein 436 [Source:HGNC Symbol;Acc:HGNC:20814])

HSP 1 Score: 119.013 bits (297), Expect = 5.958e-32
Identity = 61/172 (35.47%), Postives = 92/172 (53.49%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQS-------VKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRK 832
            ++ Y C  C + F+   +L +H  VHTG RP+ C  CG+ F Q ++L +H+  H+ E+PH C  CGK+F+  + L  H + H          + + CE C   F    + + H+ TH+ E+   C LCGKAF     L  H  TH+  +P VC LC K F    +LK+HL++
Sbjct:   29 ERPYACAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQGRHSAEKPHACATCGKAFSHRAFLRKHEKTHAERVAGLVKERRFACERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKHQSTHSGDRPHVCELCGKAFPHATNLKQHLKR 200          

HSP 2 Score: 114.39 bits (285), Expect = 3.345e-30
Identity = 58/169 (34.32%), Postives = 91/169 (53.85%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSN-------EKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 823
            ++++ C  C + F  + +L +H   HTG RP+ C  CG+ F  AS+L +H+ +HT ERP+ C  CG++F++ ++L  H   H + K + C +CGK F  +   + H+ TH+        E+R  C  C   F    +   H  TH   +PFVC LC K F  +  L+KH
Sbjct:    1 EKRHACPQCGRCFALRSSLTKHARTHTGERPYACAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQGRHSAEKPHACATCGKAFSHRAFLRKHEKTHAERVAGLVKERRFACERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKH 169          

HSP 3 Score: 112.464 bits (280), Expect = 1.769e-29
Identity = 59/168 (35.12%), Postives = 89/168 (52.98%), Query Frame = 2
Query:  332 MKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSV--KMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            +K++++ C  C   F    +  RH   HTG RPF C++CGK F   STL +H+  H+ +RPH C++CGK+F  ++ L  H++ H     K + C  CG+ F        H  TH+ E+   C  CG+AF  +  L  H  TH   +P VC  C + F  + +L+ H R
Sbjct:  118 VKERRFACERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKHQSTHSGDRPHVCELCGKAFPHATNLKQHLKRHTEDKNKPHACSECGRRFLSVRELAQHARTHTGERPHVCAECGRAFAAVSTLRKHARTHTGERPHVCPQCGRAFTSSSNLRAHAR 285          

HSP 4 Score: 84.7297 bits (208), Expect = 2.450e-19
Identity = 44/113 (38.94%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIH--QSVKMYHCESCGKGFHQKGNYKNHKLTH 667
            K++ + C  C + F +   LA+H   HTG RP  C  CG+ F   STL +H   HT ERPH C  CG++F  SS L  H R H  Q    + C  CG  F + G  + H+ +H
Sbjct:  205 KNKPHACSECGRRFLSVRELAQHARTHTGERPHVCAECGRAFAAVSTLRKHARTHTGERPHVCPQCGRAFTSSSNLRAHARAHAGQRRPQHACTQCGCRFARAGALRKHQSSH 317          

HSP 5 Score: 83.9593 bits (206), Expect = 5.846e-19
Identity = 49/142 (34.51%), Postives = 67/142 (47.18%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVR--PFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCK--CFLCGKAFHQLYNLTSHMHTH 751
            D+ + C  C K F    NL +HL  HT  +  P  C  CG+ F     L +H   HT ERPH C  CG++F   STL  H R H   + + C  CG+ F    N + H   H+ ++R +  C  CG  F +   L  H  +H
Sbjct:  176 DRPHVCELCGKAFPHATNLKQHLKRHTEDKNKPHACSECGRRFLSVRELAQHARTHTGERPHVCAECGRAFAAVSTLRKHARTHTGERPHVCPQCGRAFTSSSNLRAHARAHAGQRRPQHACTQCGCRFARAGALRKHQSSH 317          
BLAST of SMED30028726 vs. Ensembl Sea Lamprey
Match: ZNF436 (zinc finger protein 436 [Source:HGNC Symbol;Acc:HGNC:20814])

HSP 1 Score: 119.398 bits (298), Expect = 8.851e-32
Identity = 61/172 (35.47%), Postives = 92/172 (53.49%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQS-------VKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRK 832
            ++ Y C  C + F+   +L +H  VHTG RP+ C  CG+ F Q ++L +H+  H+ E+PH C  CGK+F+  + L  H + H          + + CE C   F    + + H+ TH+ E+   C LCGKAF     L  H  TH+  +P VC LC K F    +LK+HL++
Sbjct:   28 ERPYACAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQGRHSAEKPHACATCGKAFSHRAFLRKHEKTHAERVAGLVKERRFACERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKHQSTHSGDRPHVCELCGKAFPHATNLKQHLKR 199          

HSP 2 Score: 107.842 bits (268), Expect = 1.382e-27
Identity = 59/165 (35.76%), Postives = 86/165 (52.12%), Query Frame = 2
Query:  350 QCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSN-------EKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 823
            QC  C  E +    L +H   HTG RP+ C  CG+ F  AS+L +H+ +HT ERP+ C  CG++F++ ++L  H   H + K + C +CGK F  +   + H+ TH+        E+R  C  C   F    +   H  TH   +PFVC LC K F  +  L+KH
Sbjct:    5 QCGRCFAE-SRDLRLTKHARTHTGERPYACAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQGRHSAEKPHACATCGKAFSHRAFLRKHEKTHAERVAGLVKERRFACERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKH 168          

HSP 3 Score: 102.834 bits (255), Expect = 1.266e-25
Identity = 59/195 (30.26%), Postives = 89/195 (45.64%), Query Frame = 2
Query:  332 MKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSV-----------------------------KMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            +K++++ C  C   F    +  RH   HTG RPF C++CGK F   STL +H+  H+ +RPH C++CGK+F  ++ L  H++ H                                K + C  CG+ F        H  TH+ E+   C  CG+AF  +  L  H  TH   +P VC  C + F  + +L+ H R
Sbjct:  117 VKERRFACERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKHQSTHSGDRPHVCELCGKAFPHATNLKQHLKRHTGERSAAAACCLFSACCNVIKHLRADTAKDKNKPHACSECGRRFLSVRELAQHARTHTGERPHVCAECGRAFAAVSTLRKHARTHTGERPHVCPQCGRAFTSSSNLRAHAR 311          

HSP 4 Score: 85.8853 bits (211), Expect = 1.285e-19
Identity = 45/115 (39.13%), Postives = 60/115 (52.17%), Query Frame = 2
Query:  329 KMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIH--QSVKMYHCESCGKGFHQKGNYKNHKLTH 667
            K K++ + C  C + F +   LA+H   HTG RP  C  CG+ F   STL +H   HT ERPH C  CG++F  SS L  H R H  Q    + C  CG  F + G  + H+ +H
Sbjct:  229 KDKNKPHACSECGRRFLSVRELAQHARTHTGERPHVCAECGRAFAAVSTLRKHARTHTGERPHVCPQCGRAFTSSSNLRAHARAHAGQRRPQHACTQCGCRFARAGALRKHQSSH 343          

HSP 5 Score: 78.5666 bits (192), Expect = 5.172e-17
Identity = 51/169 (30.18%), Postives = 68/169 (40.24%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVR-----------------------------PFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCK--CFLCGKAFHQLYNLTSHMHTH 751
            D+ + C  C K F    NL +HL  HTG R                             P  C  CG+ F     L +H   HT ERPH C  CG++F   STL  H R H   + + C  CG+ F    N + H   H+ ++R +  C  CG  F +   L  H  +H
Sbjct:  175 DRPHVCELCGKAFPHATNLKQHLKRHTGERSAAAACCLFSACCNVIKHLRADTAKDKNKPHACSECGRRFLSVRELAQHARTHTGERPHVCAECGRAFAAVSTLRKHARTHTGERPHVCPQCGRAFTSSSNLRAHARAHAGQRRPQHACTQCGCRFARAGALRKHQSSH 343          
BLAST of SMED30028726 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 98.9821 bits (245), Expect = 9.983e-24
Identity = 51/133 (38.35%), Postives = 74/133 (55.64%), Query Frame = 2
Query:  344 KYQCFY--CNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTS 736
            +YQC +  C++ F  +  L RHL VH+  +P+ CK C + F    TL +H   H+ E+P++C +C K F  SS+L  H+R H   K   C+ CGK F++  N   H  TH  +K+ KC  C K+F  L  L S
Sbjct:  737 EYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTH--QKKYKCSDCSKSFDDLGKLNS 867          

HSP 2 Score: 87.8113 bits (216), Expect = 5.253e-20
Identity = 48/124 (38.71%), Postives = 69/124 (55.65%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAF 712
            + Y+C  C + F+++  L +H   H+G +P+ C +C K F  +S+L  H   HT E+P QCK+CGK FN SS L+ H++ HQ  K Y C  C K F   G     KL   N ++ KC L  K +
Sbjct:  766 KPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQ--KKYKCSDCSKSFDDLG-----KL---NSQKVKCALERKPY 879          

HSP 3 Score: 70.0922 bits (170), Expect = 5.544e-14
Identity = 44/133 (33.08%), Postives = 67/133 (50.38%), Query Frame = 2
Query:  446 CGKGFRQASTLCRH-KIIHTT--ERPHQC--KVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            C K F  A  L  H + +H T  +  +QC    C ++F +   L  H+++H   K Y C++C + F  +     H  THS EK  KC +C K F    +L  H+ TH   KP  C++C K F  + +L KH++
Sbjct:  712 CNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIK 844          

HSP 4 Score: 53.9138 bits (128), Expect = 1.078e-8
Identity = 37/109 (33.94%), Postives = 49/109 (44.95%), Query Frame = 2
Query:  518 QCKVCGKSFNRSSTLNTH---VRIHQSVKMYHC--ESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            Q   C KSF+ +  LN H   V + +    Y C    C + F Q+     H   HS  K  KC  C + F     L  H  TH+  KP+ C +CNK F  +  LK H+R
Sbjct:  708 QWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIR 816          
BLAST of SMED30028726 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 88.1965 bits (217), Expect = 4.320e-20
Identity = 49/137 (35.77%), Postives = 72/137 (52.55%), Query Frame = 2
Query:  254 IWCQIGRLFQGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHC--ESCGKGFHQKGNYKNHK 658
            I      L  G    KG+ N  ++     +K++C YC++ F+   +L  H+  H G +PF C  CGK F Q   L  H+ +HT E+P+ C +C K F+R   L  H+  HQ +K + C  E+C K F Q GN K H+
Sbjct:  567 ILPPKSELVGGVEKPKGTQNTRAV-----KKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQ 698          

HSP 2 Score: 85.5001 bits (210), Expect = 4.061e-19
Identity = 44/110 (40.00%), Postives = 65/110 (59.09%), Query Frame = 2
Query:  515 HQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRL--CNKGFCRNFDLKKHLRKSH 838
            H+C  C + F++++ L  HVR H   K + C+ CGK F Q GN + H+  H+ EK   C +C K F +  NL +H+ TH + KPFVC+L  CNK F +  ++K H  + H
Sbjct:  593 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFH 702          

HSP 3 Score: 69.707 bits (169), Expect = 8.406e-14
Identity = 41/105 (39.05%), Postives = 52/105 (49.52%), Query Frame = 2
Query:  437 CKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKR--CKCFLCGKAFHQLYNLTSHMH 745
            C  C + F QA+ L  H   H   +P  C  CGK F +   L TH R+H   K Y C+ C K F +KGN   H +TH   K   CK   C K F QL N+ +H +
Sbjct:  595 CPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQN 699          

HSP 4 Score: 51.6026 bits (122), Expect = 5.805e-8
Identity = 34/105 (32.38%), Postives = 49/105 (46.67%), Query Frame = 2
Query:  512 PHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHL 826
            P + ++ G       T NT     ++VK + C  C + F Q  + + H  +H   K   C  CGK F Q  NL +H   H   KP+ C +C+K F R  +L  HL
Sbjct:  569 PPKSELVGGVEKPKGTQNT-----RAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668          
BLAST of SMED30028726 vs. Ensembl Yeast
Match: PZF1 (Transcription factor IIIA (TFIIIA); essential DNA binding protein required for transcription of 5S rRNA by RNA polymerase III; not involved in transcription of other RNAP III genes; nine conserved zinc fingers; may also bind 5S rRNA [Source:SGD;Acc:S000006390])

HSP 1 Score: 69.707 bits (169), Expect = 4.494e-14
Identity = 54/174 (31.03%), Postives = 78/174 (44.83%), Query Frame = 2
Query:  347 YQCFY--CNKEFTAQYNLARH-LPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAK---PFVCRLCNKGFCRNF----DLKKHLRKSH 838
            Y C Y  C+K FT    L  H L VH G+R F C  C K F + S L RH   H+  +P QC  CGK       L  H   H    +   E C   F++    + H L+  +  +  C  C K+F + Y L +H+  H++ +   P+ C     G C+ F     L+ H++  H
Sbjct:   49 YFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEVTHTKSFICPEEGCNLRFYKHPQLRAHILS-VHLHKLTCPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFA--GCCKEFRIWSQLQSHIKNDH 219          
BLAST of SMED30028726 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 64.3142 bits (155), Expect = 4.047e-12
Identity = 33/88 (37.50%), Postives = 43/88 (48.86%), Query Frame = 2
Query:  347 YQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCK---------VCGKSFNRSSTLNTHVRIH 583
            + C  C K+FT  YNL  HL  HT  RPF C +CGK F +     RH+ +HT ++ + C           CGK F RS  L  H +  
Sbjct:  569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTE 656          

HSP 2 Score: 56.9954 bits (136), Expect = 1.024e-9
Identity = 22/45 (48.89%), Postives = 29/45 (64.44%), Query Frame = 2
Query:  689 CFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 823
            C +CGK F + YNL SH+ TH   +PF+C +C K F R  D K+H
Sbjct:  571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRH 615          

HSP 3 Score: 53.5286 bits (127), Expect = 1.416e-8
Identity = 36/102 (35.29%), Postives = 43/102 (42.16%), Query Frame = 2
Query:  431 FTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCE---------SCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKA 709
            F C VCGK F +   L  H   HT ERP  C +CGK+F R      H  +H   K Y C           CGK F +      H  T S  +RC   L  +A
Sbjct:  569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESG-RRCITPLYEEA 669          

HSP 4 Score: 51.2174 bits (121), Expect = 8.216e-8
Identity = 29/86 (33.72%), Postives = 42/86 (48.84%), Query Frame = 2
Query:  521 CKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKC---------FLCGKAFHQLYNLTSHMHTH 751
            C VCGK F R   L +H+R H + + + C  CGK F ++ + K H+  H+ +KR  C         + CGK F +   L  H  T 
Sbjct:  571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTE 656          

HSP 5 Score: 50.447 bits (119), Expect = 1.448e-7
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 2
Query:  599 YHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVC--RL-------CNKGFCRNFDLKKHLR 829
            + C+ CGK F +  N K+H  TH+NE+   C +CGKAF + ++   H   H   K +VC  +L       C K F R+  L +H +
Sbjct:  569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFK 654          
BLAST of SMED30028726 vs. Ensembl Yeast
Match: ACE2 (Transcription factor required for septum destruction after cytokinesis; phosphorylation by Cbk1p blocks nuclear exit during M/G1 transition, causing localization to daughter cell nuclei, and also increases Ace2p activity; phosphorylation by Cdc28p and Pho85p prevents nuclear import during cell cycle phases other than cytokinesis; part of RAM network that regulates cellular polarity and morphogenesis; ACE2 has a paralog, SWI5, that arose from the whole genome duplication [Source:SGD;Acc:S000004121])

HSP 1 Score: 56.9954 bits (136), Expect = 1.176e-9
Identity = 32/85 (37.65%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  329 KMKDQKYQCFY--CNKEFTAQYNLARHLPVHTGVRPFTCKV--CGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTH 571
            ++ D+ ++C Y  CNK F  +YN+  H+  H   RP++C    C K F +   L RHKI H  ++ + C  CGK FNR   L  H
Sbjct:  597 ELPDKLFECLYPNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAKK-YICP-CGKRFNREDALMVH 679          
BLAST of SMED30028726 vs. Ensembl Nematostella
Match: EDO33478 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS19])

HSP 1 Score: 238.81 bits (608), Expect = 4.142e-80
Identity = 110/145 (75.86%), Postives = 124/145 (85.52%), Query Frame = 2
Query:  404 LPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            +PVHTG RPF CK+CGKGFRQASTLCRHKIIHT E+PH+C +CGK+FNRSSTLNTH+RIH   K + C+ CGKGFHQKGNYKNH+LTH+ EK  KC +CGKAFHQ+YNLT HMHTHNE KPF C  C KGFCRNFDLKKH+RK H
Sbjct:    1 MPVHTGARPFKCKICGKGFRQASTLCRHKIIHTKEKPHKCNICGKAFNRSSTLNTHIRIHAGYKPFQCDICGKGFHQKGNYKNHRLTHTGEKPFKCHICGKAFHQVYNLTFHMHTHNEKKPFTCLECGKGFCRNFDLKKHVRKLH 145          

HSP 2 Score: 85.8853 bits (211), Expect = 9.294e-21
Identity = 40/107 (37.38%), Postives = 60/107 (56.07%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNH 655
            K++ ++C  C K F     L  H+ +H G +PF C +CGKGF Q      H++ HT E+P +C +CGK+F++   L  H+  H   K + C  CGKGF +  + K H
Sbjct:   34 KEKPHKCNICGKAFNRSSTLNTHIRIHAGYKPFQCDICGKGFHQKGNYKNHRLTHTGEKPFKCHICGKAFHQVYNLTFHMHTHNEKKPFTCLECGKGFCRNFDLKKH 140          
BLAST of SMED30028726 vs. Ensembl Nematostella
Match: EDO45330 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT54])

HSP 1 Score: 187.578 bits (475), Expect = 3.730e-60
Identity = 89/145 (61.38%), Postives = 104/145 (71.72%), Query Frame = 2
Query:  404 LPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            +P HTG RPF C VCGKGFR +STLCRHKIIHTT+RPH+C +C K+FNRSSTL TH+R H  VK Y CE CGKGFHQKGN +NH L H+ EK  KC LC KAF++L NL  HMH H +  P+ C+ C   F R  DLK H+   H
Sbjct:    1 MPSHTGTRPFVCGVCGKGFRLSSTLCRHKIIHTTDRPHKCHICNKAFNRSSTLKTHIRTHSEVKEYICEVCGKGFHQKGNLRNHSLIHTGEKPYKCALCEKAFNKLSNLKFHMHVHTDNSPYRCKYCKVSFSRRCDLKSHIANVH 145          

HSP 2 Score: 85.8853 bits (211), Expect = 8.625e-21
Identity = 40/106 (37.74%), Postives = 62/106 (58.49%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNH 655
            D+ ++C  CNK F     L  H+  H+ V+ + C+VCGKGF Q   L  H +IHT E+P++C +C K+FN+ S L  H+ +H     Y C+ C   F ++ + K+H
Sbjct:   35 DRPHKCHICNKAFNRSSTLKTHIRTHSEVKEYICEVCGKGFHQKGNLRNHSLIHTGEKPYKCALCEKAFNKLSNLKFHMHVHTDNSPYRCKYCKVSFSRRCDLKSH 140          

HSP 3 Score: 82.4185 bits (202), Expect = 1.762e-19
Identity = 50/118 (42.37%), Postives = 62/118 (52.54%), Query Frame = 2
Query:  497 HTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH*SSP 850
            HT  RP  C VCGK F  SSTL  H  IH + + + C  C K F++    K H  THS  K   C +CGK FHQ  NL +H   H   KP+ C LC K F +  +LK H+     +SP
Sbjct:    4 HTGTRPFVCGVCGKGFRLSSTLCRHKIIHTTDRPHKCHICNKAFNRSSTLKTHIRTHSEVKEYICEVCGKGFHQKGNLRNHSLIHTGEKPYKCALCEKAFNKLSNLKFHMHVHTDNSP 121          

HSP 4 Score: 60.4622 bits (145), Expect = 1.627e-11
Identity = 30/78 (38.46%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHV 574
            ++Y C  C K F  + NL  H  +HTG +P+ C +C K F + S L  H  +HT   P++CK C  SF+R   L +H+
Sbjct:   64 KEYICEVCGKGFHQKGNLRNHSLIHTGEKPYKCALCEKAFNKLSNLKFHMHVHTDNSPYRCKYCKVSFSRRCDLKSHI 141          
BLAST of SMED30028726 vs. Ensembl Nematostella
Match: EDO49432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGI1])

HSP 1 Score: 174.481 bits (441), Expect = 4.671e-55
Identity = 84/141 (59.57%), Postives = 100/141 (70.92%), Query Frame = 2
Query:  404 LPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHL 826
            +P HTG RPF C +CGKGFR +STLCRHKIIHT+ +PHQC  CGK+FNRSSTL TH R H +VK + C  C KGFHQKGN +NH L H+ EK  KC +C KAF++L NL  H H H + +P+ CR C   F R  DLK HL
Sbjct:    1 MPSHTGARPFVCAICGKGFRLSSTLCRHKIIHTSHKPHQCTTCGKAFNRSSTLKTHQRTHSTVKEFVCHICEKGFHQKGNLRNHLLIHTGEKPYKCTVCKKAFNKLSNLKFHSHVHTDNRPYRCRYCKVAFSRRCDLKLHL 141          

HSP 2 Score: 62.003 bits (149), Expect = 4.509e-12
Identity = 30/78 (38.46%), Postives = 45/78 (57.69%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHV 574
            +++ C  C K F  + NL  HL +HTG +P+ C VC K F + S L  H  +HT  RP++C+ C  +F+R   L  H+
Sbjct:   64 KEFVCHICEKGFHQKGNLRNHLLIHTGEKPYKCTVCKKAFNKLSNLKFHSHVHTDNRPYRCRYCKVAFSRRCDLKLHL 141          
BLAST of SMED30028726 vs. Ensembl Nematostella
Match: EDO47708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLK7])

HSP 1 Score: 169.859 bits (429), Expect = 3.685e-53
Identity = 80/140 (57.14%), Postives = 102/140 (72.86%), Query Frame = 2
Query:  404 LPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 823
            +P HT  RPF C +CGKGFR +STLCRHKIIHT ++PH+C+VC KSFNRSSTL THVR H   K + C+ CGKGFHQKGN +NH + H+ EK  +C  C +AF+++ NL  HMHTH +  P+ C+ C K F +  DLK+H
Sbjct:    1 MPDHTESRPFVCNICGKGFRLSSTLCRHKIIHTQKKPHKCEVCNKSFNRSSTLKTHVRTHSEEKAFVCDICGKGFHQKGNLRNHIMIHTGEKPFQCTKCHRAFNKMSNLKFHMHTHTDNLPYQCKTCRKKFEKKTDLKQH 140          
BLAST of SMED30028726 vs. Ensembl Nematostella
Match: EDO44302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWE6])

HSP 1 Score: 139.043 bits (349), Expect = 6.220e-41
Identity = 71/156 (45.51%), Postives = 96/156 (61.54%), Query Frame = 2
Query:  362 CNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHL 826
            C K F+  + L  H+   H+G RPF C  CGK F  + +L +HK IHT E+  +CK CGK+F RSSTL+TH+ IH   + + C+ C K FHQK + K H   H+ EK  KC  CGKAF Q  NL +H   H+  KPF C++C + F R  DL++H+
Sbjct:    3 CKKVFSTPHGLEVHVRRSHSGRRPFECLTCGKTFGHSVSLEQHKSIHTNEKSFECKECGKAFKRSSTLSTHMLIHSDTRPFPCQYCPKRFHQKSDMKKHTYIHTGEKPHKCLECGKAFSQSSNLITHSRKHSGFKPFSCQVCRRSFYRKVDLRRHM 158          

HSP 2 Score: 100.908 bits (250), Expect = 2.443e-26
Identity = 51/138 (36.96%), Postives = 75/138 (54.35%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHN 754
            + ++C  C K F    +L +H  +HT  + F CK CGK F+++STL  H +IH+  RP  C+ C K F++ S +  H  IH   K + C  CGK F Q  N   H   HS  K   C +C ++F++  +L  HM+TH 
Sbjct:   25 RPFECLTCGKTFGHSVSLEQHKSIHTNEKSFECKECGKAFKRSSTLSTHMLIHSDTRPFPCQYCPKRFHQKSDMKKHTYIHTGEKPHKCLECGKAFSQSSNLITHSRKHSGFKPFSCQVCRRSFYRKVDLRRHMYTHE 162          

HSP 3 Score: 94.7449 bits (234), Expect = 5.331e-24
Identity = 50/140 (35.71%), Postives = 79/140 (56.43%), Query Frame = 2
Query:  272 RLFQGSVGRKGSGNYFSMDKMK-----DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNE 676
            R F+     K  G+  S+++ K     ++ ++C  C K F     L+ H+ +H+  RPF C+ C K F Q S + +H  IHT E+PH+C  CGK+F++SS L TH R H   K + C+ C + F++K + + H  TH +E
Sbjct:   25 RPFECLTCGKTFGHSVSLEQHKSIHTNEKSFECKECGKAFKRSSTLSTHMLIHSDTRPFPCQYCPKRFHQKSDMKKHTYIHTGEKPHKCLECGKAFSQSSNLITHSRKHSGFKPFSCQVCRRSFYRKVDLRRHMYTHESE 164          
BLAST of SMED30028726 vs. Ensembl Medaka
Match: fezf1 (fez family zinc finger protein 1 [Source:NCBI gene;Acc:101169677])

HSP 1 Score: 266.159 bits (679), Expect = 9.921e-87
Identity = 123/168 (73.21%), Postives = 135/168 (80.36%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            K + + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT E+PH+C  CGK+FNRSSTLNTH RIH   K + CE CGKGFHQKGNYKNHKLTHS EK+ KC +C KAFHQ+YNLT HMHTHN+ KPF C  C KGFCRNFDLKKH+RK H
Sbjct:  245 KPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCSICSKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLH 412          
BLAST of SMED30028726 vs. Ensembl Medaka
Match: gfi1ab (growth factor independent 1 transcriptional repressor [Source:NCBI gene;Acc:110015008])

HSP 1 Score: 161.384 bits (407), Expect = 8.909e-47
Identity = 80/181 (44.20%), Postives = 107/181 (59.12%), Query Frame = 2
Query:  299 KGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            K   +    + +    Y+C  C+K F+  + L  H+   H+G RPF C++CGK F  A +L +HK +H+ ER   CK+CGK+F RSSTL+TH+ IH   + Y C+ CGK FHQK + K H   H+ EK  KC +CGKAF Q  NL +H   H   KPF C LC KGF R  DL++H    H
Sbjct:  197 KAQPDLLGPNLLLSGAYKCVKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKTFKRSSTLSTHLLIHSDTRPYPCQFCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGYKPFGCDLCGKGFQRKVDLRRHKETQH 377          

HSP 2 Score: 106.301 bits (264), Expect = 4.696e-26
Identity = 54/141 (38.30%), Postives = 76/141 (53.90%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAK 763
            + + C  C K F    +L +H  VH+  R F CK+CGK F+++STL  H +IH+  RP+ C+ CGK F++ S +  H  IH   K + C+ CGK F Q  N   H   H+  K   C LCGK F +  +L  H  T +  K
Sbjct:  240 RPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKTFKRSSTLSTHLLIHSDTRPYPCQFCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGYKPFGCDLCGKGFQRKVDLRRHKETQHGLK 380          
BLAST of SMED30028726 vs. Ensembl Medaka
Match: GFI1 (zinc finger protein Gfi-1 [Source:NCBI gene;Acc:101159532])

HSP 1 Score: 159.458 bits (402), Expect = 5.630e-46
Identity = 79/165 (47.88%), Postives = 101/165 (61.21%), Query Frame = 2
Query:  347 YQCFYCNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            Y+C  C K F+  + L  H+   H+G RPF C +CGK F  A +L +H+ +H+ ER   CK+CGKSF RSSTL+TH+ IH   + Y C+ CGK FHQK + K H   H+ EK  KC +CGKAF Q  NL +H   H   KPF C LC KGF R  DL++H    H
Sbjct:  216 YKCIKCIKVFSTPHGLEVHVRRSHSGTRPFECGICGKTFGHAVSLDQHRAVHSQERSFSCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHKETQH 380          

HSP 2 Score: 110.923 bits (276), Expect = 9.816e-28
Identity = 55/141 (39.01%), Postives = 79/141 (56.03%), Query Frame = 2
Query:  341 QKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAK 763
            + ++C  C K F    +L +H  VH+  R F+CK+CGK F+++STL  H +IH+  RP+ C+ CGK F++ S +  H  IH   K + C+ CGK F Q  N   H   H+  K   C LCGK F +  +L  H  T +E K
Sbjct:  243 RPFECGICGKTFGHAVSLDQHRAVHSQERSFSCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHKETQHELK 383          

HSP 3 Score: 106.686 bits (265), Expect = 3.390e-26
Identity = 54/136 (39.71%), Postives = 81/136 (59.56%), Query Frame = 2
Query:  272 RLFQGSVGRKGSGNYFSMDK-----MKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLT 664
            R F+  +  K  G+  S+D+      +++ + C  C K F     L+ HL +H+  RP+ C+ CGK F Q S + +H  IHT E+PH+C+VCGK+F++SS L TH R H   K + C+ CGKGF +K + + HK T
Sbjct:  243 RPFECGICGKTFGHAVSLDQHRAVHSQERSFSCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHKET 378          
BLAST of SMED30028726 vs. Ensembl Medaka
Match: ENSORLT00000028476.1 (pep primary_assembly:ASM223467v1:17:10987274:10993813:-1 gene:ENSORLG00000007009.2 transcript:ENSORLT00000028476.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.288 bits (373), Expect = 1.067e-41
Identity = 70/163 (42.94%), Postives = 98/163 (60.12%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHL 826
            ++ + C  C K FT    L  H+  HTG +PF+CK+CGK F Q   L  H   HT ERP  C++CGKSF R+S+L  H++ H   + + C+ CGKGF +  + + H  TH+ E+   C +CGK+F Q  NLT+HM TH    P+ C+LC K F R+F L  H+
Sbjct:  193 EKPFSCKTCGKAFTQNSTLQHHMRTHTGEKPFSCKICGKAFFQPYILTNHMRKHTGERPFSCEICGKSFIRNSSLKDHMKSHTGERPFTCKMCGKGFKRNASLEAHVRTHTGERPFSCDMCGKSFTQSGNLTAHMRTHTGETPYSCQLCGKSFGRSFSLSAHM 355          

HSP 2 Score: 145.206 bits (365), Expect = 1.554e-40
Identity = 69/166 (41.57%), Postives = 97/166 (58.43%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRK 832
            +++ Y C  C K+FT    L  H+  HTG RPF CK+CGK F+ + +L  H   HT E+P  C++CGKS  ++S+L  H+R H   + + CE C KGF +  + ++H   H+ EK   C  CGKAF Q   L  HM TH   KPF C++C K F + + L  H+RK
Sbjct:   80 EEKNYSCEICGKDFTVSSRLTVHMRTHTGERPFLCKLCGKTFKHSGSLKAHTRTHTGEKPFSCEICGKSLMKNSSLKDHMRTHTGERPFSCEICAKGFVKNSSLRDHMRIHTGEKPFSCKTCGKAFTQNSTLQHHMRTHTGEKPFSCKICGKAFFQPYILTNHMRK 245          

HSP 3 Score: 144.436 bits (363), Expect = 2.545e-40
Identity = 69/164 (42.07%), Postives = 97/164 (59.15%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C  C K F    +L  H   HTG +PF+C++CGK   + S+L  H   HT ERP  C++C K F ++S+L  H+RIH   K + C++CGK F Q    ++H  TH+ EK   C +CGKAF Q Y LT+HM  H   +PF C +C K F RN  LK H++
Sbjct:  109 ERPFLCKLCGKTFKHSGSLKAHTRTHTGEKPFSCEICGKSLMKNSSLKDHMRTHTGERPFSCEICAKGFVKNSSLRDHMRIHTGEKPFSCKTCGKAFTQNSTLQHHMRTHTGEKPFSCKICGKAFFQPYILTNHMRKHTGERPFSCEICGKSFIRNSSLKDHMK 272          

HSP 4 Score: 142.51 bits (358), Expect = 1.528e-39
Identity = 78/213 (36.62%), Postives = 116/213 (54.46%), Query Frame = 2
Query:  212 DFSVQSNVS------HPQYSIWCQI-GRLFQGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            DF+V S ++        +    C++ G+ F+ S    GS    +     ++ + C  C K      +L  H+  HTG RPF+C++C KGF + S+L  H  IHT E+P  CK CGK+F ++STL  H+R H   K + C+ CGK F Q     NH   H+ E+   C +CGK+F +  +L  HM +H   +PF C++C KGF RN  L+ H+R
Sbjct:   92 DFTVSSRLTVHMRTHTGERPFLCKLCGKTFKHS----GSLKAHTRTHTGEKPFSCEICGKSLMKNSSLKDHMRTHTGERPFSCEICAKGFVKNSSLRDHMRIHTGEKPFSCKTCGKAFTQNSTLQHHMRTHTGEKPFSCKICGKAFFQPYILTNHMRKHTGERPFSCEICGKSFIRNSSLKDHMKSHTGERPFTCKMCGKGFKRNASLEAHVR 300          

HSP 5 Score: 135.576 bits (340), Expect = 5.723e-37
Identity = 64/164 (39.02%), Postives = 96/164 (58.54%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            ++ + C  C K F    +L  H+ +HTG +PF+CK CGK F Q STL  H   HT E+P  CK+CGK+F +   L  H+R H   + + CE CGK F +  + K+H  +H+ E+   C +CGK F +  +L +H+ TH   +PF C +C K F ++ +L  H+R
Sbjct:  165 ERPFSCEICAKGFVKNSSLRDHMRIHTGEKPFSCKTCGKAFTQNSTLQHHMRTHTGEKPFSCKICGKAFFQPYILTNHMRKHTGERPFSCEICGKSFIRNSSLKDHMKSHTGERPFTCKMCGKGFKRNASLEAHVRTHTGERPFSCDMCGKSFTQSGNLTAHMR 328          

HSP 6 Score: 127.872 bits (320), Expect = 5.272e-34
Identity = 62/142 (43.66%), Postives = 85/142 (59.86%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAK 763
            ++ + C  C K F   Y L  H+  HTG RPF+C++CGK F + S+L  H   HT ERP  CK+CGK F R+++L  HVR H   + + C+ CGK F Q GN   H  TH+ E    C LCGK+F + ++L++HM TH   K
Sbjct:  221 EKPFSCKICGKAFFQPYILTNHMRKHTGERPFSCEICGKSFIRNSSLKDHMKSHTGERPFTCKMCGKGFKRNASLEAHVRTHTGERPFSCDMCGKSFTQSGNLTAHMRTHTGETPYSCQLCGKSFGRSFSLSAHMMTHTGTK 362          

HSP 7 Score: 115.931 bits (289), Expect = 1.536e-29
Identity = 57/147 (38.78%), Postives = 81/147 (55.10%), Query Frame = 2
Query:  389 NLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            N +  +  HT  + ++C++CGK F  +S L  H   HT ERP  CK+CGK+F  S +L  H R H   K + CE CGK   +  + K+H  TH+ E+   C +C K F +  +L  HM  H   KPF C+ C K F +N  L+ H+R
Sbjct:   70 NFSTQMKKHTEEKNYSCEICGKDFTVSSRLTVHMRTHTGERPFLCKLCGKTFKHSGSLKAHTRTHTGEKPFSCEICGKSLMKNSSLKDHMRTHTGERPFSCEICAKGFVKNSSLRDHMRIHTGEKPFSCKTCGKAFTQNSTLQHHMR 216          

HSP 8 Score: 101.293 bits (251), Expect = 2.699e-24
Identity = 52/140 (37.14%), Postives = 74/140 (52.86%), Query Frame = 2
Query:  410 VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            + T V P    + G+   Q S        HT E+ + C++CGK F  SS L  H+R H   + + C+ CGK F   G+ K H  TH+ EK   C +CGK+  +  +L  HM TH   +PF C +C KGF +N  L+ H+R
Sbjct:   52 IVTDVSP---DISGEALNQCSNFSTQMKKHTEEKNYSCEICGKDFTVSSRLTVHMRTHTGERPFLCKLCGKTFKHSGSLKAHTRTHTGEKPFSCEICGKSLMKNSSLKDHMRTHTGERPFSCEICAKGFVKNSSLRDHMR 188          

HSP 9 Score: 79.7221 bits (195), Expect = 1.283e-16
Identity = 36/87 (41.38%), Postives = 51/87 (58.62%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKM 598
            ++ + C  C K F    +L  H+  HTG RPF+C +CGK F Q+  L  H   HT E P+ C++CGKSF RS +L+ H+  H   K+
Sbjct:  277 ERPFTCKMCGKGFKRNASLEAHVRTHTGERPFSCDMCGKSFTQSGNLTAHMRTHTGETPYSCQLCGKSFGRSFSLSAHMMTHTGTKL 363          
BLAST of SMED30028726 vs. Ensembl Medaka
Match: ENSORLT00000041554.1 (zinc finger protein 616 [Source:NCBI gene;Acc:101174938])

HSP 1 Score: 149.443 bits (376), Expect = 1.436e-41
Identity = 72/164 (43.90%), Postives = 98/164 (59.76%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            D+ + C  C+K F     L +H+  HTG +PF+C+VCGKGF + STL +H   HT E+P+ CK CGKSF+ S+ L  H+R H   K + C  CGK F Q    KNH  +H+ EK   C  CGK+F Q  NL  HM TH   K F C++C++ F +   L +HL+
Sbjct:  272 DRPFSCTLCDKSFPENSTLTKHMRTHTGEKPFSCEVCGKGFPENSTLTKHMRTHTGEKPYSCKECGKSFSLSTNLTKHIRTHTGEKPFSCVLCGKSFSQSVTLKNHMRSHTGEKPFSCGECGKSFKQRGNLRVHMLTHTGGKLFSCQVCSQNFGKRDTLTEHLQ 435          

HSP 2 Score: 137.502 bits (345), Expect = 4.024e-37
Identity = 70/164 (42.68%), Postives = 91/164 (55.49%), Query Frame = 2
Query:  335 KDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHL 826
            K +++ C  C K F     L  H+  HTG RPF+C +C K F + STL +H   HT E+P  C+VCGK F  +STL  H+R H   K Y C+ CGK F    N   H  TH+ EK   C LCGK+F Q   L +HM +H   KPF C  C K F +  +L+ H+
Sbjct:  243 KPKRHTCKECGKCFRDNCILMSHMRTHTGDRPFSCTLCDKSFPENSTLTKHMRTHTGEKPFSCEVCGKGFPENSTLTKHMRTHTGEKPYSCKECGKSFSLSTNLTKHIRTHTGEKPFSCVLCGKSFSQSVTLKNHMRSHTGEKPFSCGECGKSFKQRGNLRVHM 406          

HSP 3 Score: 119.398 bits (298), Expect = 1.906e-30
Identity = 56/142 (39.44%), Postives = 82/142 (57.75%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAK 763
            ++ + C  C K F     L +H+  HTG +P++CK CGK F  ++ L +H   HT E+P  C +CGKSF++S TL  H+R H   K + C  CGK F Q+GN + H LTH+  K   C +C + F +   LT H+ +H E +
Sbjct:  300 EKPFSCEVCGKGFPENSTLTKHMRTHTGEKPYSCKECGKSFSLSTNLTKHIRTHTGEKPFSCVLCGKSFSQSVTLKNHMRSHTGEKPFSCGECGKSFKQRGNLRVHMLTHTGGKLFSCQVCSQNFGKRDTLTEHLQSHAETQ 441          

HSP 4 Score: 119.013 bits (297), Expect = 2.108e-30
Identity = 61/132 (46.21%), Postives = 73/132 (55.30%), Query Frame = 2
Query:  434 TCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            TCK CGK FR    L  H   HT +RP  C +C KSF  +STL  H+R H   K + CE CGKGF +      H  TH+ EK   C  CGK+F    NLT H+ TH   KPF C LC K F ++  LK H+R
Sbjct:  248 TCKECGKCFRDNCILMSHMRTHTGDRPFSCTLCDKSFPENSTLTKHMRTHTGEKPFSCEVCGKGFPENSTLTKHMRTHTGEKPYSCKECGKSFSLSTNLTKHIRTHTGEKPFSCVLCGKSFSQSVTLKNHMR 379          
BLAST of SMED30028726 vs. Planmine SMEST
Match: SMESG000079499.1 (SMESG000079499.1)

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 259/259 (100.00%), Postives = 259/259 (100.00%), Query Frame = 2
Query:   62 MLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            MLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH
Sbjct:    1 MLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSVDFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYFSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 259          
BLAST of SMED30028726 vs. Planmine SMEST
Match: SMESG000079499.1 (SMESG000079499.1)

HSP 1 Score: 272.322 bits (695), Expect = 1.983e-93
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 2
Query:  443 VCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            VCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH
Sbjct:    2 VCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 133          

HSP 2 Score: 70.8626 bits (172), Expect = 4.631e-15
Identity = 36/106 (33.96%), Postives = 57/106 (53.77%), Query Frame = 2
Query:  338 DQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNH 655
            ++ +QC  C K F     L  H+ +H  V+ + C+ CGKGF Q      HK+ H+ E+  +C +CGK+F++   L +H+  H   K + C  C KGF +  + K H
Sbjct:   23 ERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 128          

HSP 3 Score: 46.9802 bits (110), Expect = 1.772e-6
Identity = 26/77 (33.77%), Postives = 35/77 (45.45%), Query Frame = 2
Query:  347 YQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVR 577
            Y C  C K F  + N   H   H+  +   C +CGK F Q   L  H   H   +P  C++C K F R+  L  H+R
Sbjct:   54 YHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 130          

HSP 4 Score: 45.4394 bits (106), Expect = 4.760e-6
Identity = 20/53 (37.74%), Postives = 29/53 (54.72%), Query Frame = 2
Query:  308 GNY--FSMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGF 460
            GNY    +    +++ +CF C K F   YNL  H+  H   +PF C++C KGF
Sbjct:   67 GNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGF 119          
BLAST of SMED30028726 vs. Planmine SMEST
Match: SMESG000058261.1 (SMESG000058261.1)

HSP 1 Score: 268.47 bits (685), Expect = 3.034e-88
Identity = 124/164 (75.61%), Postives = 137/164 (83.54%), Query Frame = 2
Query:  347 YQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            + C  C K F A YNL RH+PVHTG RPF CKVCGKGFRQASTLCRHKIIHT+ERPH CK C KSFNRSSTLNTH+RIHQ  K Y CE CGKGFHQKGNYKNHKLTH+ EK+ KC +C KAFHQ+YNLT HMHTH + KP+VC+ C+KGFCRNFDLKKH+RK H
Sbjct:   84 FSCPDCGKTFNAHYNLTRHMPVHTGARPFICKVCGKGFRQASTLCRHKIIHTSERPHICKTCNKSFNRSSTLNTHMRIHQGYKPYKCEICGKGFHQKGNYKNHKLTHNIEKQFKCPICTKAFHQIYNLTFHMHTHTDKKPYVCQHCSKGFCRNFDLKKHIRKLH 247          

HSP 2 Score: 82.0333 bits (201), Expect = 1.765e-17
Identity = 41/110 (37.27%), Postives = 60/110 (54.55%), Query Frame = 2
Query:  353 CFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNH-KLTHSNEK 679
            C  CNK F     L  H+ +H G +P+ C++CGKGF Q      HK+ H  E+  +C +C K+F++   L  H+  H   K Y C+ C KGF +  + K H +  H+NEK
Sbjct:  142 CKTCNKSFNRSSTLNTHMRIHQGYKPYKCEICGKGFHQKGNYKNHKLTHNIEKQFKCPICTKAFHQIYNLTFHMHTHTDKKPYVCQHCSKGFCRNFDLKKHIRKLHANEK 251          

HSP 3 Score: 77.7962 bits (190), Expect = 4.948e-16
Identity = 40/140 (28.57%), Postives = 68/140 (48.57%), Query Frame = 2
Query:  404 LPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKH 823
            L ++  +R     + G   + +     +++     +   C  CGK+FN    L  H+ +H   + + C+ CGKGF Q      HK+ H++E+   C  C K+F++   L +HM  H   KP+ C +C KGF +  + K H
Sbjct:   47 LDINKTLRKINSPILGFTNKNSYLNSNNEVAEKVAKVFSCPDCGKTFNAHYNLTRHMPVHTGARPFICKVCGKGFRQASTLCRHKIIHTSERPHICKTCNKSFNRSSTLNTHMRIHQGYKPYKCEICGKGFHQKGNYKNH 186          

HSP 4 Score: 62.3882 bits (150), Expect = 7.183e-11
Identity = 37/113 (32.74%), Postives = 57/113 (50.44%), Query Frame = 2
Query:  494 IHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSV-KMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLR 829
            I+ T R     + G + N++S LN++  + + V K++ C  CGK F+   N   H   H+  +   C +CGK F Q   L  H   H   +P +C+ CNK F R+  L  H+R
Sbjct:   49 INKTLRKINSPILGFT-NKNSYLNSNNEVAEKVAKVFSCPDCGKTFNAHYNLTRHMPVHTGARPFICKVCGKGFRQASTLCRHKIIHTSERPHICKTCNKSFNRSSTLNTHMR 160          
BLAST of SMED30028726 vs. Planmine SMEST
Match: SMESG000042630.1 (SMESG000042630.1)

HSP 1 Score: 148.673 bits (374), Expect = 3.192e-42
Identity = 72/165 (43.64%), Postives = 100/165 (60.61%), Query Frame = 2
Query:  347 YQCFYCNKEFTAQYNLARHLP-VHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 838
            ++C  C K F   + L  H+   H+G RP+ C +C K F  + +L +H++ HT E+  QC  CGK F RSSTL+TH+ IH   + + C  C K FHQK + K H  TH+ EK  KC +CGKAF Q  NL +H   H+  KPF C  C++GF RN DL++H++  H
Sbjct:  134 FKCMRCKKYFPNSHGLEVHVRRSHSGRRPYECDICPKSFGHSVSLSQHRVTHTQEKQFQCPQCGKRFKRSSTLSTHLLIHTGNRPFPCPYCSKSFHQKSDMKKHTYTHTGEKPYKCVVCGKAFSQSSNLITHSRKHSGEKPFWCHKCSRGFQRNVDLRRHIQSQH 298          
BLAST of SMED30028726 vs. Planmine SMEST
Match: SMESG000005754.1 (SMESG000005754.1)

HSP 1 Score: 110.153 bits (274), Expect = 5.051e-27
Identity = 58/152 (38.16%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  293 GRKGSGNYFSMDKMKDQ---KYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSH 739
              K +G++ S   +K     KY C  C K F    NL  H   HTG RPF C+ CGKGF Q + L +H ++HT E+PH+C VC K F+ +S L TH+R+H+  K + CE C   F Q  + + H   H+NE+   C  C K +  +  + +H
Sbjct:  339 NEKINGHHLSYTLIKTDGKSKYNCSVCKKIFGQLSNLKVHQRTHTGERPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNERPFICPRCNKCYISISGIRTH 490          

HSP 2 Score: 93.5893 bits (231), Expect = 2.666e-21
Identity = 51/139 (36.69%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  419 GVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKS 835
            G   + C VC K F Q S L  H+  HT ERP  C+ CGK F + + L  H  +H   K + C  C K F    N K H   H  EK  KC  C   F QL +L  H+  H   +PF+C  CNK +     ++ H   S
Sbjct:  356 GKSKYNCSVCKKIFGQLSNLKVHQRTHTGERPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNERPFICPRCNKCYISISGIRTHWSNS 494          
The following BLAST results are available for this feature:
BLAST of SMED30028726 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FEZF23.750e-8751.47FEZ family zinc finger 2 [Source:HGNC Symbol;Acc:H... [more]
FEZF23.750e-8751.47FEZ family zinc finger 2 [Source:HGNC Symbol;Acc:H... [more]
FEZF23.750e-8751.47FEZ family zinc finger 2 [Source:HGNC Symbol;Acc:H... [more]
FEZF19.097e-8768.42FEZ family zinc finger 1 [Source:HGNC Symbol;Acc:H... [more]
FEZF13.613e-8668.42FEZ family zinc finger 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SMED30028726 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fezf-16.070e-8469.01FEZ Family zinc finger protein [Source:UniProtKB/... [more]
pag-34.436e-3643.71Zinc finger protein PAG-3 [Source:UniProtKB/TrEMB... [more]
blmp-11.118e-2935.80B lymphocyte-induced maturation protein 1 homolog ... [more]
blmp-11.304e-2935.80B lymphocyte-induced maturation protein 1 homolog ... [more]
che-12.900e-2341.38Transcription factor che-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of SMED30028726 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erm1.293e-8968.82gene:FBgn0031375 transcript:FBtr0330200[more]
erm2.184e-8968.82gene:FBgn0031375 transcript:FBtr0077870[more]
erm4.093e-8968.82gene:FBgn0031375 transcript:FBtr0330201[more]
erm9.697e-8968.82gene:FBgn0031375 transcript:FBtr0330202[more]
sens-27.273e-3943.64gene:FBgn0051632 transcript:FBtr0079341[more]
back to top
BLAST of SMED30028726 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fezf17.045e-8967.36FEZ family zinc finger 1 [Source:NCBI gene;Acc:558... [more]
fezf24.828e-8773.21FEZ family zinc finger 2 [Source:NCBI gene;Acc:606... [more]
fezf25.269e-8773.21FEZ family zinc finger 2 [Source:NCBI gene;Acc:606... [more]
gfi1ab6.707e-4747.88growth factor independent 1A transcription repress... [more]
gfi1ab7.222e-4747.88growth factor independent 1A transcription repress... [more]
back to top
BLAST of SMED30028726 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yipf62.100e-8673.21Yip1 domain family member 6 [Source:Xenbase;Acc:XB... [more]
hdac87.931e-8672.62histone deacetylase 8 [Source:Xenbase;Acc:XB-GENE-... [more]
wdr374.332e-4747.06WD repeat domain 37 [Source:Xenbase;Acc:XB-GENE-57... [more]
mocs12.149e-4545.76molybdenum cofactor synthesis 1 [Source:Xenbase;Ac... [more]
ENSXETT00000024787.13.668e-4043.90gastrula zinc finger protein XlCGF57.1-like [Sourc... [more]
back to top
BLAST of SMED30028726 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fezf29.095e-9051.47Fez family zinc finger 2 [Source:MGI Symbol;Acc:MG... [more]
Fezf29.095e-9051.47Fez family zinc finger 2 [Source:MGI Symbol;Acc:MG... [more]
Fezf11.719e-8668.42Fez family zinc finger 1 [Source:MGI Symbol;Acc:MG... [more]
Fezf21.352e-4943.69Fez family zinc finger 2 [Source:MGI Symbol;Acc:MG... [more]
Gfi19.156e-4748.48growth factor independent 1 transcription represso... [more]
back to top
BLAST of SMED30028726 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2VWH6|FEZF2_BOVIN4.069e-9152.21Fez family zinc finger protein 2 OS=Bos taurus OX=... [more]
sp|Q9ESP5|FEZF2_MOUSE6.362e-8951.47Fez family zinc finger protein 2 OS=Mus musculus O... [more]
sp|Q9VQ56|ERM_DROME2.190e-8868.82Fez family zinc finger protein erm OS=Drosophila m... [more]
sp|Q25C93|FEZF1_DANRE5.318e-8867.36Fez family zinc finger protein 1 OS=Danio rerio OX... [more]
sp|Q8TBJ5|FEZF2_HUMAN1.801e-8651.47Fez family zinc finger protein 2 OS=Homo sapiens O... [more]
back to top
BLAST of SMED30028726 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W2BPA91.241e-8852.21FEZ family zinc finger 2 OS=Bos indicus x Bos taur... [more]
L8ITA11.696e-8851.84Fez family zinc finger protein 2 (Fragment) OS=Bos... [more]
A0A5N3WF331.784e-8851.84Uncharacterized protein OS=Muntiacus muntjak OX=98... [more]
A0A5N3Y0X53.906e-8851.84Uncharacterized protein OS=Muntiacus reevesi OX=98... [more]
B0X0B04.526e-8861.19Zinc finger protein OS=Culex quinquefasciatus OX=7... [more]
back to top
BLAST of SMED30028726 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fezf23.369e-8773.81FEZ family zinc finger 2 [Source:NCBI gene;Acc:606... [more]
fezf13.097e-8669.44FEZ family zinc finger 1 [Source:NCBI gene;Acc:103... [more]
gfi1ab9.645e-4745.88zinc finger protein Gfi-1-like [Source:NCBI gene;A... [more]
GFI16.640e-4647.88growth factor independent 1 transcriptional repres... [more]
GFI1B8.049e-4446.06growth factor independent 1B transcriptional repre... [more]
back to top
BLAST of SMED30028726 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001428.19.022e-3840.12pep scaffold:Pmarinus_7.0:GL481113:143068:144258:1... [more]
ENSPMAT00000002487.19.510e-3844.51pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1... [more]
ENSPMAT00000000449.13.908e-3441.72pep scaffold:Pmarinus_7.0:GL478964:311851:312750:-... [more]
ZNF4365.958e-3235.47zinc finger protein 436 [Source:HGNC Symbol;Acc:HG... [more]
ZNF4368.851e-3235.47zinc finger protein 436 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SMED30028726 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP19.983e-2438.35Zinc-regulated transcription factor; binds to zinc... [more]
AZF14.320e-2035.77Zinc-finger transcription factor; involved in diau... [more]
PZF14.494e-1431.03Transcription factor IIIA (TFIIIA); essential DNA ... [more]
CRZ14.047e-1237.50Transcription factor, activates transcription of s... [more]
ACE21.176e-937.65Transcription factor required for septum destructi... [more]
back to top
BLAST of SMED30028726 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO334784.142e-8075.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453303.730e-6061.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494324.671e-5559.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477083.685e-5357.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443026.220e-4145.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30028726 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fezf19.921e-8773.21fez family zinc finger protein 1 [Source:NCBI gene... [more]
gfi1ab8.909e-4744.20growth factor independent 1 transcriptional repres... [more]
GFI15.630e-4647.88zinc finger protein Gfi-1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000028476.11.067e-4142.94pep primary_assembly:ASM223467v1:17:10987274:10993... [more]
ENSORLT00000041554.11.436e-4143.90zinc finger protein 616 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of SMED30028726 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079499.10.000e+0100.00SMESG000079499.1[more]
SMESG000079499.11.983e-93100.00SMESG000079499.1[more]
SMESG000058261.13.034e-8875.61SMESG000058261.1[more]
SMESG000042630.13.192e-4243.64SMESG000042630.1[more]
SMESG000005754.15.051e-2738.16SMESG000005754.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028726 ID=SMED30028726|Name=SMED30028726|organism=Schmidtea mediterranea sexual|type=transcript|length=857bp
GTTCAATCTGGCAATCAGTTTGCACTAATTGAATGATGCCGATCATTGGT
CAGCTCAAATAATGTTGCCGTATATATTCATTGTCAATTATTTAGCCAGT
GATAGAACTGATCAAATGAGTGCAAACGCTCAAAGATTTCTGATTAAAAA
TCTCATATTAAATGATAGAGAAATCACTTCTTTCACCGAGATGGCGTCAA
TGAATTCCGTTGATTTTTCCGTTCAGTCAAACGTATCACATCCTCAATAT
TCAATTTGGTGTCAAATCGGCAGATTGTTCCAGGGCTCCGTTGGTAGGAA
AGGATCTGGGAATTATTTCTCTATGGACAAAATGAAAGATCAAAAATATC
AATGCTTTTATTGCAATAAAGAATTCACTGCACAATACAATCTAGCAAGA
CATTTACCAGTACATACAGGAGTTCGTCCATTCACCTGCAAGGTTTGTGG
GAAAGGATTCAGACAAGCCAGCACTTTATGTCGCCATAAGATTATTCACA
CTACTGAAAGACCTCATCAGTGCAAAGTCTGTGGCAAGTCATTCAACAGA
AGTTCAACGCTCAATACACATGTGAGAATCCATCAAAGTGTTAAAATGTA
TCATTGTGAAAGCTGTGGCAAGGGTTTCCACCAGAAAGGCAATTACAAAA
ATCACAAATTGACACATTCAAATGAGAAACGCTGTAAATGTTTCCTATGC
GGCAAAGCTTTCCATCAGCTCTACAACCTGACGTCTCATATGCATACCCA
CAATGAGGCCAAACCGTTTGTCTGCCGACTTTGCAATAAAGGATTTTGTA
GGAATTTCGACTTGAAAAAACATTTGCGGAAATCACATTAAAGTTCTCCA
ATGGGCA
back to top

protein sequence of SMED30028726-orf-1

>SMED30028726-orf-1 ID=SMED30028726-orf-1|Name=SMED30028726-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
MLPYIFIVNYLASDRTDQMSANAQRFLIKNLILNDREITSFTEMASMNSV
DFSVQSNVSHPQYSIWCQIGRLFQGSVGRKGSGNYFSMDKMKDQKYQCFY
CNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTER
PHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKL
THSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFD
LKKHLRKSH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
IPR003656Znf_BED
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 124..146
e-value: 0.0036
score: 26.5
coord: 96..118
e-value: 0.026
score: 23.7
coord: 180..202
e-value: 0.037
score: 23.2
coord: 208..230
e-value: 1.2
score: 18.2
coord: 152..174
e-value: 1.9E-4
score: 30.8
coord: 236..259
e-value: 0.0075
score: 25.5
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 124..146
e-value: 1.1E-4
score: 22.5
coord: 236..259
e-value: 3.3E-4
score: 20.9
coord: 96..115
e-value: 7.4E-5
score: 23.0
coord: 152..174
e-value: 3.7E-6
score: 27.1
coord: 209..230
e-value: 0.0072
score: 16.7
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 238..259
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 154..174
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 208..230
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 182..202
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 98..118
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 126..146
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 96..123
score: 14.108
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 152..179
score: 13.38
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 236..259
score: 11.78
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 180..207
score: 13.526
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 206..235
score: 12.404
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 124..151
score: 15.168
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 148..173
e-value: 3.7E-12
score: 47.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 231..259
e-value: 3.9E-6
score: 28.7
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 123..147
e-value: 5.3E-13
score: 50.5
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 204..230
e-value: 7.8E-8
score: 34.0
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 94..122
e-value: 3.5E-9
score: 38.4
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 174..203
e-value: 6.0E-8
score: 34.5
NoneNo IPR availablePANTHERPTHR24388:SF74FEZ FAMILY ZINC FINGER PROTEIN 2coord: 19..259
NoneNo IPR availablePANTHERPTHR24388FAMILY NOT NAMEDcoord: 19..259
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 133..189
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 189..245
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 95..146