Exportin-7

Overview
NameExportin-7
Smed IDSMED30028720
Length (bp)3782
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Exportin-7 (SMED30028720) t-SNE clustered cells

Violin plots show distribution of expression levels for Exportin-7 (SMED30028720) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Exportin-7 (SMED30028720) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Exportin-7 (SMED30028720) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028720

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028720h1SMcG0020687 SmedASXL_019489SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30028720h1SMcG0020687 Contig38220uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028720h1SMcG0020687 Contig38220newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Exportin-7 vs. Ensembl Human
Match: XPO7 (exportin 7 [Source:HGNC Symbol;Acc:HGNC:14108])

HSP 1 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 446/1190 (37.48%), Postives = 676/1190 (56.81%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNS-NQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE  CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + L+KL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  K++ +VFR  I  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P S   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    LED   V Q+L+ ++ + RC+Y  + + LV LFD++A  +      ++    +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              +   +N+T      RT FY +L RL L+    E+   +  FM PLT A +++ Q       S+NS N+Q A  K  L+ L+RD+RG+A A ++K SF  LF+W+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+  L+G+YVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +      +S +  K + P                             ++  D++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDD-YVFRNAITDVTRFLQDS-VEYCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSASASPMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINNQSNLTDMRC--RTTFYTALGRL-LMVDLGEDEDQYEQFMLPLTAAFEAVAQMF-----STNSFNEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITMYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAALSGSYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFK-----QLSRSTKKRTTP----------------------------LNQESDRFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSAFRREVNDSMK 1074          
BLAST of Exportin-7 vs. Ensembl Human
Match: XPO7 (exportin 7 [Source:HGNC Symbol;Acc:HGNC:14108])

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 446/1190 (37.48%), Postives = 676/1190 (56.81%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNS-NQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE  CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + L+KL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  K++ +VFR  I  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P S   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    LED   V Q+L+ ++ + RC+Y  + + LV LFD++A  +      ++    +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              +   +N+T      RT FY +L RL L+    E+   +  FM PLT A +++ Q       S+NS N+Q A  K  L+ L+RD+RG+A A ++K SF  LF+W+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+  L+G+YVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +      +S +  K + P                             ++  D++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    9 LAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDD-YVFRNAITDVTRFLQDS-VEYCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSASASPMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINNQSNLTDMRC--RTTFYTALGRL-LMVDLGEDEDQYEQFMLPLTAAFEAVAQMF-----STNSFNEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITMYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAALSGSYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFK-----QLSRSTKKRTTP----------------------------LNQESDRFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSAFRREVNDSMK 1075          
BLAST of Exportin-7 vs. Ensembl Human
Match: RANBP17 (RAN binding protein 17 [Source:HGNC Symbol;Acc:HGNC:14428])

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 424/1184 (35.81%), Postives = 655/1184 (55.32%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFST-----EGSQNAVT-RLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDT---ECLGSNAHLIQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLGAV-AKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSA---GSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNL 3671
            + ELE+ C + Y   +   R  AE+A L L DS       +LLLE+G + Y+QL+A + LSKL+++    L VEQR++IRN  LNY+  + +LA FV++A++ +I +ITKLGW +  K++ FVFR++I  + + ++ G  +  +I V IL  L  E N     + +R +   RKIA +FR+  L  + + +  LL ++    K LNL D  Q ++V   LKL L+CL++DFIG+   +E +DD+ +VQ+PT WR  FL P    + + LFF LY +LP  L  LAL+CLVQ AS RRS FN+ ER  +LG L+ GV  IL  N   L D   YHE CR + RLK+N+QLGELV +  Y   I L+A FT+ SL+  +  + NS HYLL  WQR+VAS+P+++ ++PHLLDT+ P +  A++ SR+ +      +     L+D  +V Q+LE +  +SRC+Y  + + LV LFD+ A  +        G    +T +   L WLV L+G  + GR+    S+D++D +DGEL  RV QL  ++DT    C             +E+A+L FLDQ R+ Y+ G+   R  ++Y  + + + I DDN +LET + KI+ NL+ W G  +PVISR+L  L++LS+G +  K+L+K+  V  +L+NH+    PFL                +  NHS+                                +    RT FY +LTRL L+    E+   F  FM PLT A +++ Q         N+N +    K  L+ L RD+RG+A A ++K S+  LFDW+YP  L  L  A++ W     C   +  LKL  EL  +R+ RL   V+SP+G L+FR  S+++  YG +I    L S+  ++  Y + +K  + C   L++ L GNYV+ G F LY D+  +  L  F+++++S+  +D++ Y KL++SYY L + LTQDH+ ++   +P +++Y + +I +GLT+    VSSSCC+SLD I ++L +      ++    KP                             R  +++  +    M+ +   L  M+S     L   ++  +C+NQW++SRPLLGLILLN K F +L+   +++      E +   F  LME V  +LS++NRD+FTQNL+ FR ++
Sbjct:    8 LAELEVLCTHLYIGTDLTQRIEAEKALLELIDSPECLSKCQLLLEQGTTSYAQLLAATCLSKLVSRVS-PLPVEQRMDIRNYILNYVASQPKLAPFVIQALIQVIAKITKLGWFEVQKDQ-FVFREIIADVKKFLQ-GTVEHCIIGVIILSELTQEMNLV---DYSRPSAKHRKIATSFRDTSLKDVLVLACSLLKEVF--AKPLNLQDQCQQNLVMQVLKLVLNCLNFDFIGS-SADESADDLCTVQIPTTWRTIFLEP----ETLDLFFNLYHSLPPLLSQLALSCLVQFASTRRSLFNSPERAKYLGNLIKGVKRIL-ENPQGLSDPGNYHEFCRFLARLKTNYQLGELVMVKEYPEVIRLIANFTITSLQHWEF-APNSVHYLLTLWQRMVASVPFVKSTEPHLLDTYAPEITKAFITSRLDSVAIVVRDHLDDPLDDTATVFQQLEQLCTVSRCEYEKTCALLVQLFDQNAQNYQKLLHPYSGVTVDITIQEGRLAWLVYLVGTVVGGRLTYT-STDEHDAMDGELSCRVFQLISLMDTGLPRCCNEK---------IELAILWFLDQFRKTYV-GDQLQRTSKVYARMSEVLGITDDNHVLETFMTKIVTNLKYW-GRYEPVISRTLQFLNDLSVGYILLKKLVKIDAVKFMLKNHTSEHFPFL---------------GISDNHSL--------------------------------SDFRCRTTFYTALTRL-LMVDLGEDEDEFENFMLPLTVAFETVLQIF-------NNNFKQEDVKRMLIGLARDLRGIAFALNTKTSYTMLFDWMYPTYLPLLQNAVERWYGEPTCTTPI--LKLMAELMQNRSQRLNFDVSSPNGILLFREASKMVCTYGNQILS--LGSLSKDQI-YPMKLKGISICYSALKSALCGNYVSFGVFKLYGDNHFDNVLQAFVKMLLSVSHSDLLQYRKLSQSYYPLLECLTQDHMSFIINLEPPVLMYVLTSISEGLTTLDTVVSSSCCTSLDYIVTYLFKH-----IAKEGKKPLR--------------------------CREATQAGQRLLHFMQQNPDVLQQMMSV----LMNTIVFEDCRNQWSVSRPLLGLILLNEKYFSELRASLINSQPLPKQEVLAQCFRNLMEGVEQNLSVKNRDRFTQNLSVFRRDV 1069          
BLAST of Exportin-7 vs. Ensembl Human
Match: RANBP17 (RAN binding protein 17 [Source:HGNC Symbol;Acc:HGNC:14428])

HSP 1 Score: 392.119 bits (1006), Expect = 3.707e-122
Identity = 231/579 (39.90%), Postives = 344/579 (59.41%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFST-----EGSQNAVT-RLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDT---ECLGSNAHLIQALAGLEVAVLAFLDQIRRVYL 1868
            + ELE+ C + Y   +   R  AE+A L L DS       +LLLE+G + Y+QL+A + LSKL+++    L VEQR++IRN  LNY+  + +LA FV++A++ +I +ITKLGW +  K++ FVFR++I  + + ++ G  +  +I V IL  L  E N     + +R +   RKIA +FR+  L  + + +  LL ++    K LNL D  Q ++V   LKL L+CL++DFIG+   +E +DD+ +VQ+PT WR  FL P    + + LFF LY +LP  L  LAL+CLVQ AS RRS FN+ ER  +LG L+ GV  IL  N   L D   YHE CR + RLK+N+QLGELV +  Y   I L+A FT+ SL+  +  + NS HYLL  WQR+VAS+P+++ ++PHLLDT+ P +  A++ SR+ +      +     L+D  +V Q+LE +  +SRC+Y  + + LV LFD+ A  +        G    +T +   L WLV L+G  + GR+    S+D++D +DGEL  RV QL  ++DT    C             +E+A+L FLDQ R+ Y+
Sbjct:    8 LAELEVLCTHLYIGTDLTQRIEAEKALLELIDSPECLSKCQLLLEQGTTSYAQLLAATCLSKLVSRVS-PLPVEQRMDIRNYILNYVASQPKLAPFVIQALIQVIAKITKLGWFEVQKDQ-FVFREIIADVKKFLQ-GTVEHCIIGVIILSELTQEMNLV---DYSRPSAKHRKIATSFRDTSLKDVLVLACSLLKEVFA--KPLNLQDQCQQNLVMQVLKLVLNCLNFDFIGS-SADESADDLCTVQIPTTWRTIFLEP----ETLDLFFNLYHSLPPLLSQLALSCLVQFASTRRSLFNSPERAKYLGNLIKGVKRIL-ENPQGLSDPGNYHEFCRFLARLKTNYQLGELVMVKEYPEVIRLIANFTITSLQHWEF-APNSVHYLLTLWQRMVASVPFVKSTEPHLLDTYAPEITKAFITSRLDSVAIVVRDHLDDPLDDTATVFQQLEQLCTVSRCEYEKTCALLVQLFDQNAQNYQKLLHPYSGVTVDITIQEGRLAWLVYLVGTVVGGRLT-YTSTDEHDAMDGELSCRVFQLISLMDTGLPRCCNEK---------IELAILWFLDQFRKTYV 561          
BLAST of Exportin-7 vs. Ensembl Human
Match: RANBP17 (RAN binding protein 17 [Source:HGNC Symbol;Acc:HGNC:14428])

HSP 1 Score: 391.734 bits (1005), Expect = 4.000e-122
Identity = 231/579 (39.90%), Postives = 344/579 (59.41%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFST-----EGSQNAVT-RLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDT---ECLGSNAHLIQALAGLEVAVLAFLDQIRRVYL 1868
            + ELE+ C + Y   +   R  AE+A L L DS       +LLLE+G + Y+QL+A + LSKL+++    L VEQR++IRN  LNY+  + +LA FV++A++ +I +ITKLGW +  K++ FVFR++I  + + ++ G  +  +I V IL  L  E N     + +R +   RKIA +FR+  L  + + +  LL ++    K LNL D  Q ++V   LKL L+CL++DFIG+   +E +DD+ +VQ+PT WR  FL P    + + LFF LY +LP  L  LAL+CLVQ AS RRS FN+ ER  +LG L+ GV  IL  N   L D   YHE CR + RLK+N+QLGELV +  Y   I L+A FT+ SL+  +  + NS HYLL  WQR+VAS+P+++ ++PHLLDT+ P +  A++ SR+ +      +     L+D  +V Q+LE +  +SRC+Y  + + LV LFD+ A  +        G    +T +   L WLV L+G  + GR+    S+D++D +DGEL  RV QL  ++DT    C             +E+A+L FLDQ R+ Y+
Sbjct:    8 LAELEVLCTHLYIGTDLTQRIEAEKALLELIDSPECLSKCQLLLEQGTTSYAQLLAATCLSKLVSRVS-PLPVEQRMDIRNYILNYVASQPKLAPFVIQALIQVIAKITKLGWFEVQKDQ-FVFREIIADVKKFLQ-GTVEHCIIGVIILSELTQEMNLV---DYSRPSAKHRKIATSFRDTSLKDVLVLACSLLKEVFA--KPLNLQDQCQQNLVMQVLKLVLNCLNFDFIGS-SADESADDLCTVQIPTTWRTIFLEP----ETLDLFFNLYHSLPPLLSQLALSCLVQFASTRRSLFNSPERAKYLGNLIKGVKRIL-ENPQGLSDPGNYHEFCRFLARLKTNYQLGELVMVKEYPEVIRLIANFTITSLQHWEF-APNSVHYLLTLWQRMVASVPFVKSTEPHLLDTYAPEITKAFITSRLDSVAIVVRDHLDDPLDDTATVFQQLEQLCTVSRCEYEKTCALLVQLFDQNAQNYQKLLHPYSGVTVDITIQEGRLAWLVYLVGTVVGGRLT-YTSTDEHDAMDGELSCRVFQLISLMDTGLPRCCNEK---------IELAILWFLDQFRKTYV 561          
BLAST of Exportin-7 vs. Ensembl Celegans
Match: C35A5.8 (pep chromosome:WBcel235:V:10521992:10525908:-1 gene:WBGene00007952.1 transcript:C35A5.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C35A5.8)

HSP 1 Score: 479.945 bits (1234), Expect = 1.836e-149
Identity = 363/1186 (30.61%), Postives = 590/1186 (49.75%), Query Frame = 3
Query:  180 CKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQ-REELADFVVRAIVGLICRITKLGWLDTNKEEN--------FVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFSTEGSQNAVTRLRE--LCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTEC-LGSNAHLIQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITH-ERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLL-RLAQSQVVSNN-AIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDL------QQCYLSAGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNL 3671
            CK+ YES + + R RAE     LS+S    +   LL  RG+  Y  +VA +TL KLL   +  ++  Q+LE+    L  L Q   +   ++V ++  L  R+TK  W   N  EN        + FR  ++ +++ I     +  ++AVQ+L  LV + N +   +   S    RK  + FR++ LY IF  S+ +L    N  ++LN   + Q  ++   L L L CL +D+IG+   +E S+D  +VQ+PT WR +F         V L F+L   LP       +  + Q AS RR+ FN  ERQ ++ +LV GV  ++  N G L D + +HE CRL+ RLK+N+QL EL+ +  YS  + LLA+FTV+SL   +  S+NS ++L+  WQR+V S+PY+R +  HLL+ +CP ++ A+V SR++   S    G    L+D  +  Q +E +A++ RC+Y  +   L   FD+ A  +      +A T + E  L WL+ L+G  + G+   A SSD +D++DGEL+AR + +    D    L +N   ++    LEV+ +  L+Q RR Y+  +   RA  +Y+ L+  + I +++ +L  ++QKIL NL+ W   +  ++  SL+L  +LSLG +  ++L +LP V  LL NH+     F                                                 L  NI   +   RT FY +LTRL L + ++++  +   F+ PLT   + +   + N        Q     K  +  L RD+RGVA A  +K  FQ LF+W+YP + + +  +++ W       +V   L+L  E+  +R  RL+ +++S S  L+F+  S+I+  YGE++     ++  R  K +Y    K       IL+N L G YV  G F LY D  L+  L  F++L  SIP  D  +Y K+A+++Y L + + QD++ ++     ++    + +I  GL+S    V +S CSSLD I ++L  RL +S   +N   + P           DN+  +I       QH                         +L++ ++ +   +M  E K QW++SRPLLGLIL+    + D+      QQ Y      + +   F +LM +V  +L+++N+D FTQNL  FR ++
Sbjct:   11 CKDLYESVDPQARHRAESNLAELSESPECLQRCMLLFARGDYPYGPMVASTTLMKLLG-GKTSITSVQKLELAKYLLEMLGQGAPQFPPYLVTSLCQLFARLTKQEWTYQNPTENQTEDTKIEYPFRDPVDSLVKTINMDNIEESMLAVQLLTLLVADMNSASGMD---SVNKHRKNLSQFRDDFLYEIFSVSLNVLN--DNVDRNLN---DRQLGLLHAVLNLNLQCLLFDYIGSLT-DETSEDNCNVQIPTAWRASFTDGK----IVQLMFKLLNVLPQESSEKVMTIIAQLASIRRTLFNGTERQAYVQKLVEGVVSVI-MNPGKLSDQAAFHEFCRLIARLKTNYQLCELIAVPCYSHMLRLLAEFTVQSLRMMEF-SANSTYFLMTFWQRMVTSVPYVRNNDEHLLNVYCPEIMTAFVESRLQHVESIVREGAENPLDDQGATLQVMEHLAIICRCEYENTCKLLTQHFDQNANIWMNGSENDANTAIAEGRLVWLITLIGTAVFGKT-TATSSDVHDKMDGELIARCITVMRFNDNRLQLSNNTVPLKGNLRLEVSFIHMLEQFRRAYIM-DQITRASAVYDTLEAELRITEESDMLGVIVQKILTNLKFWPS-NSDLLDLSLSLFKDLSLGYSAVRKLFRLPEVQLLLNNHTADHFMF-------------------------------------------------LGPNIDYQTMKQRTTFYEALTRL-LTTDYSDDEEMLQRFLRPLTDTVEGICTVIQNNCQGVEEEQL----KKIITGLCRDLRGVAIASTTKTIFQILFEWMYPEVFNIMQFSVEKWPGC--ADVVTPILRLLSEMVQNRQQRLKFEMSSCSAVLLFKETSKIVSIYGERLLQLPEVSKDRVYKERY----KNIGVIFLILKNALIGAYVPFGVFRLYGDSCLQDALTTFVKLFTSIPQDDFHSYTKIAQNHYNLLEHVVQDNMPFVTNLSVDVFCALLRSIHSGLSSVDAIVITSACSSLDTILNYLYRRLTRSTPPTNKVGMDPE---------GDNILIAI------KQHPD-----------------------ILAKMLQAVITLMMFGEVKCQWSLSRPLLGLILIQEDVYSDMKRELTSQQTYDRQADFDML---FTQLMSNVEMNLTVKNKDTFTQNLTRFRRDI 1076          
BLAST of Exportin-7 vs. Ensembl Fly
Match: Ranbp16 (gene:FBgn0053180 transcript:FBtr0303647)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 426/1203 (35.41%), Postives = 652/1203 (54.20%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAA---VSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFS------TEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQA-LAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPA-MLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQ---CYLSAGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRH---NLNGSNKLNIDYHSSN 3713
            I++LE+ CK  YE+ +  +RS AE+A ++   S +     +LLL+R +S Y+QL+A STL+KL+      LS+++R++IR+  LNYL     L  FVV+A+V L+ ++TK GW D+ KEE  VF+ ++E + + ++ G  +   I VQIL  LV E N   E ++  S   MRKIA +FR+ QL   F+ S  LL    +N K+++  D  Q +++ + L+LT +CLS+DFIG+   +E +DDM +VQ+PT WR AFL      + + LFF LY+ LP  L   +++CLVQ  S RRS FNN+ER  FL  LV GV DIL+   G L D   YHE CRL+ RLKSN+QLGEL+ +  Y   I+L+A+FTV SL      + NS HYLL  WQR+VAS+PY++   PHLL T+ P V+ AY+ SR+ A    +  + + P   L+D   V Q+LE ++V+ RC+Y  + + LV  FD+ A  +          S +      +L WLV ++G+ I GR+  A +SD++D +D ELV RVLQL  + D       A L QA    LE+A+L+FLDQ+R+++   ++  +   L + L +   + D+  LL  + +KI+ NL+ W G S+ +I+++L LL ELS+     ++L +L  V  +L +H+    PF                                                 L TN + +    RT FY SL RL +     E+   F  F+ PLT+  +SL   + +    SN       +K  ++ L RD+RG+A   +++  +  LF+WLY A  L  LL A+DLW   +P  +    LKL  EL   R  RL   V+SP G L+FR  S+++  YG +I H+ +   R     Y + +K    C  IL+N L GNYVN G F LY DD+L+  L I  +L+++I   D++ YPKL+ +YY L + L+QDH+ +L   +P   +Y + ++  GL +       SCC+ LD+I S++ +  Q +V        + PN                         R  ++   ++  ++E ++  L +M+S  + N    ++Q +C+NQW+MSRPLL LILL    +  L+    C       +TM   F+ LM  +  ++S +N++KFTQN++TFR    NL  S     DY ++N
Sbjct:    3 IQQLEVLCKQLYEATDIRIRSEAEKALVTFVSSQDALPKCQLLLQRADSSYAQLLAASTLTKLIQG----LSLQERIDIRSYALNYLATVPNLQHFVVQALVSLLAKLTKYGWFDSYKEE-MVFQNLLEDVKKFLQ-GSVEHCTIGVQILSQLVCEMNSVVEMDVQVSFSKMRKIATSFRDQQLLETFLLSCSLLVSARDNSKNISFMDESQQALISHVLRLTKNCLSFDFIGS-STDESADDMNNVQIPTAWRPAFLD----SNTLKLFFDLYQILPNGLASYSISCLVQITSVRRSLFNNSERTKFLTHLVEGVKDILTTLHG-LSDPDNYHEFCRLLARLKSNYQLGELIAVPCYPEAIQLIAKFTVESLHLW-LFAPNSVHYLLTLWQRMVASVPYVKSPDPHLLGTYTPEVIKAYIESRLDAVPVIIRDNLDDP---LDDFCMVQQQLEQLSVIERCEYNKTCNLLVQHFDQKAREYENLLQTPNANSIDITIHELQLTWLVYIIGSAIVGRLTVA-TSDEHDTMDAELVIRVLQLMTLTD-------ARLPQAGCEKLELAILSFLDQVRKMHSSEQA--QKANLNKRLSEVFGLTDEQMLLSFINRKIITNLKFW-GRSESIITKTLMLLSELSVHFNSVRKLARLEEVQFMLTHHTSEHFPF-------------------------------------------------LGTNSSLSEMRCRTMFYTSLGRLLMFDL-GEDEERFYNFLEPLTNQFESLGSVMMDNNIFSNEE-----AKKVIIGLARDLRGLALPLNARIQYTMLFEWLYYADYLPILLRAMDLWA-HDP-AVTTPILKLFAELVHCRTQRLAGNVSSPMGILLFREASKLICIYGNRILHQEVPRER----LYPMRLKGIAICFLILKNSLGGNYVNCGVFKLYGDDTLDSVLNIIAKLILTIEQRDLIEYPKLSTAYYNLLNCLSQDHVSYLAALEPAAFVYILKSLTKGLAALDSATYISCCTILDSIVSYIFKQLQMKV-------STFPNKK----------------------LRSLNQENVQFLKVVEMNSELLQSMMSSLLNN----VLQEDCRNQWSMSRPLLVLILLYEDYYRSLKDRIICAQPIEKQQTMAQWFDDLMVGIERNVSSKNKEKFTQNMSTFRRDVVNLPKSTAGGADYIATN 1084          
BLAST of Exportin-7 vs. Ensembl Fly
Match: Ranbp16 (gene:FBgn0053180 transcript:FBtr0303645)

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 419/1183 (35.42%), Postives = 643/1183 (54.35%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFS------TEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQA-LAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPA-MLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQ---CYLSAGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNL 3671
            I++LE+ CK  YE+ +  +RS AE+A ++   S +     +LLL+R +S Y+QL+A STL+KL+      LS+++R++IR+  LNYL     L  FVV+A+V L+ ++TK GW D+ KEE  VF+ ++E + + ++ G  +   I VQIL  LV E N   E ++  S   MRKIA +FR+ QL   F+ S  LL    +N K+++  D  Q +++ + L+LT +CLS+DFIG+   +E +DDM +VQ+PT WR AFL      + + LFF LY+ LP  L   +++CLVQ  S RRS FNN+ER  FL  LV GV DIL+   G L D   YHE CRL+ RLKSN+QLGEL+ +  Y   I+L+A+FTV SL      + NS HYLL  WQR+VAS+PY++   PHLL T+ P V+ AY+ SR+ A      +     L+D   V Q+LE ++V+ RC+Y  + + LV  FD+ A  +          S +      +L WLV ++G+ I GR+  A +SD++D +D ELV RVLQL  + D       A L QA    LE+A+L+FLDQ+R+++   ++  +   L + L +   + D+  LL  + +KI+ NL+ W G S+ +I+++L LL ELS+     ++L +L  V  +L +H+    PF                                                 L TN + +    RT FY SL RL +     E+   F  F+ PLT+  +SL   + +    SN       +K  ++ L RD+RG+A   +++  +  LF+WLY A  L  LL A+DLW   +P  +    LKL  EL   R  RL   V+SP G L+FR  S+++  YG +I H+ +   R     Y + +K    C  IL+N L GNYVN G F LY DD+L+  L I  +L+++I   D++ YPKL+ +YY L + L+QDH+ +L   +P   +Y + ++  GL +       SCC+ LD+I S++ +  Q +V        + PN                         R  ++   ++  ++E ++  L +M+S  + N    ++Q +C+NQW+MSRPLL LILL    +  L+    C       +TM   F+ LM  +  ++S +N++KFTQN++TFR ++
Sbjct:    3 IQQLEVLCKQLYEATDIRIRSEAEKALVTFVSSQDALPKCQLLLQRADSSYAQLLAASTLTKLIQG----LSLQERIDIRSYALNYLATVPNLQHFVVQALVSLLAKLTKYGWFDSYKEE-MVFQNLLEDVKKFLQ-GSVEHCTIGVQILSQLVCEMNSVVEMDVQVSFSKMRKIATSFRDQQLLETFLLSCSLLVSARDNSKNISFMDESQQALISHVLRLTKNCLSFDFIGS-STDESADDMNNVQIPTAWRPAFLD----SNTLKLFFDLYQILPNGLASYSISCLVQITSVRRSLFNNSERTKFLTHLVEGVKDILTTLHG-LSDPDNYHEFCRLLARLKSNYQLGELIAVPCYPEAIQLIAKFTVESLHLW-LFAPNSVHYLLTLWQRMVASVPYVKSPDPHLLGTYTPEVIKAYIESRLDAVPVIIRDNLDDPLDDFCMVQQQLEQLSVIERCEYNKTCNLLVQHFDQKAREYENLLQTPNANSIDITIHELQLTWLVYIIGSAIVGRLTVA-TSDEHDTMDAELVIRVLQLMTLTD-------ARLPQAGCEKLELAILSFLDQVRKMHSSEQA--QKANLNKRLSEVFGLTDEQMLLSFINRKIITNLKFW-GRSESIITKTLMLLSELSVHFNSVRKLARLEEVQFMLTHHTSEHFPF-------------------------------------------------LGTNSSLSEMRCRTMFYTSLGRLLMFDL-GEDEERFYNFLEPLTNQFESLGSVMMDNNIFSNEE-----AKKVIIGLARDLRGLALPLNARIQYTMLFEWLYYADYLPILLRAMDLWA-HDP-AVTTPILKLFAELVHCRTQRLAGNVSSPMGILLFREASKLICIYGNRILHQEVPRER----LYPMRLKGIAICFLILKNSLGGNYVNCGVFKLYGDDTLDSVLNIIAKLILTIEQRDLIEYPKLSTAYYNLLNCLSQDHVSYLAALEPAAFVYILKSLTKGLAALDSATYISCCTILDSIVSYIFKQLQMKV-------STFPNKK----------------------LRSLNQENVQFLKVVEMNSELLQSMMSSLLNN----VLQEDCRNQWSMSRPLLVLILLYEDYYRSLKDRIICAQPIEKQQTMAQWFDDLMVGIERNVSSKNKEKFTQNMSTFRRDV 1067          
BLAST of Exportin-7 vs. Ensembl Fly
Match: Ranbp16 (gene:FBgn0053180 transcript:FBtr0303646)

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 419/1183 (35.42%), Postives = 643/1183 (54.35%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFS------TEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQA-LAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPA-MLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQ---CYLSAGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNL 3671
            I++LE+ CK  YE+ +  +RS AE+A ++   S +     +LLL+R +S Y+QL+A STL+KL+      LS+++R++IR+  LNYL     L  FVV+A+V L+ ++TK GW D+ KEE  VF+ ++E + + ++ G  +   I VQIL  LV E N   E ++  S   MRKIA +FR+ QL   F+ S  LL    +N K+++  D  Q +++ + L+LT +CLS+DFIG+   +E +DDM +VQ+PT WR AFL      + + LFF LY+ LP  L   +++CLVQ  S RRS FNN+ER  FL  LV GV DIL+   G L D   YHE CRL+ RLKSN+QLGEL+ +  Y   I+L+A+FTV SL      + NS HYLL  WQR+VAS+PY++   PHLL T+ P V+ AY+ SR+ A      +     L+D   V Q+LE ++V+ RC+Y  + + LV  FD+ A  +          S +      +L WLV ++G+ I GR+  A +SD++D +D ELV RVLQL  + D       A L QA    LE+A+L+FLDQ+R+++   ++  +   L + L +   + D+  LL  + +KI+ NL+ W G S+ +I+++L LL ELS+     ++L +L  V  +L +H+    PF                                                 L TN + +    RT FY SL RL +     E+   F  F+ PLT+  +SL   + +    SN       +K  ++ L RD+RG+A   +++  +  LF+WLY A  L  LL A+DLW   +P  +    LKL  EL   R  RL   V+SP G L+FR  S+++  YG +I H+ +   R     Y + +K    C  IL+N L GNYVN G F LY DD+L+  L I  +L+++I   D++ YPKL+ +YY L + L+QDH+ +L   +P   +Y + ++  GL +       SCC+ LD+I S++ +  Q +V        + PN                         R  ++   ++  ++E ++  L +M+S  + N    ++Q +C+NQW+MSRPLL LILL    +  L+    C       +TM   F+ LM  +  ++S +N++KFTQN++TFR ++
Sbjct:    3 IQQLEVLCKQLYEATDIRIRSEAEKALVTFVSSQDALPKCQLLLQRADSSYAQLLAASTLTKLIQG----LSLQERIDIRSYALNYLATVPNLQHFVVQALVSLLAKLTKYGWFDSYKEE-MVFQNLLEDVKKFLQ-GSVEHCTIGVQILSQLVCEMNSVVEMDVQVSFSKMRKIATSFRDQQLLETFLLSCSLLVSARDNSKNISFMDESQQALISHVLRLTKNCLSFDFIGS-STDESADDMNNVQIPTAWRPAFLD----SNTLKLFFDLYQILPNGLASYSISCLVQITSVRRSLFNNSERTKFLTHLVEGVKDILTTLHG-LSDPDNYHEFCRLLARLKSNYQLGELIAVPCYPEAIQLIAKFTVESLHLW-LFAPNSVHYLLTLWQRMVASVPYVKSPDPHLLGTYTPEVIKAYIESRLDAVPVIIRDNLDDPLDDFCMVQQQLEQLSVIERCEYNKTCNLLVQHFDQKAREYENLLQTPNANSIDITIHELQLTWLVYIIGSAIVGRLTVA-TSDEHDTMDAELVIRVLQLMTLTD-------ARLPQAGCEKLELAILSFLDQVRKMHSSEQA--QKANLNKRLSEVFGLTDEQMLLSFINRKIITNLKFW-GRSESIITKTLMLLSELSVHFNSVRKLARLEEVQFMLTHHTSEHFPF-------------------------------------------------LGTNSSLSEMRCRTMFYTSLGRLLMFDL-GEDEERFYNFLEPLTNQFESLGSVMMDNNIFSNEE-----AKKVIIGLARDLRGLALPLNARIQYTMLFEWLYYADYLPILLRAMDLWA-HDP-AVTTPILKLFAELVHCRTQRLAGNVSSPMGILLFREASKLICIYGNRILHQEVPRER----LYPMRLKGIAICFLILKNSLGGNYVNCGVFKLYGDDTLDSVLNIIAKLILTIEQRDLIEYPKLSTAYYNLLNCLSQDHVSYLAALEPAAFVYILKSLTKGLAALDSATYISCCTILDSIVSYIFKQLQMKV-------STFPNKK----------------------LRSLNQENVQFLKVVEMNSELLQSMMSSLLNN----VLQEDCRNQWSMSRPLLVLILLYEDYYRSLKDRIICAQPIEKQQTMAQWFDDLMVGIERNVSSKNKEKFTQNMSTFRRDV 1067          
BLAST of Exportin-7 vs. Ensembl Fly
Match: Ranbp16 (gene:FBgn0053180 transcript:FBtr0074162)

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 419/1183 (35.42%), Postives = 643/1183 (54.35%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFS------TEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQA-LAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPA-MLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQ---CYLSAGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNL 3671
            I++LE+ CK  YE+ +  +RS AE+A ++   S +     +LLL+R +S Y+QL+A STL+KL+      LS+++R++IR+  LNYL     L  FVV+A+V L+ ++TK GW D+ KEE  VF+ ++E + + ++ G  +   I VQIL  LV E N   E ++  S   MRKIA +FR+ QL   F+ S  LL    +N K+++  D  Q +++ + L+LT +CLS+DFIG+   +E +DDM +VQ+PT WR AFL      + + LFF LY+ LP  L   +++CLVQ  S RRS FNN+ER  FL  LV GV DIL+   G L D   YHE CRL+ RLKSN+QLGEL+ +  Y   I+L+A+FTV SL      + NS HYLL  WQR+VAS+PY++   PHLL T+ P V+ AY+ SR+ A      +     L+D   V Q+LE ++V+ RC+Y  + + LV  FD+ A  +          S +      +L WLV ++G+ I GR+  A +SD++D +D ELV RVLQL  + D       A L QA    LE+A+L+FLDQ+R+++   ++  +   L + L +   + D+  LL  + +KI+ NL+ W G S+ +I+++L LL ELS+     ++L +L  V  +L +H+    PF                                                 L TN + +    RT FY SL RL +     E+   F  F+ PLT+  +SL   + +    SN       +K  ++ L RD+RG+A   +++  +  LF+WLY A  L  LL A+DLW   +P  +    LKL  EL   R  RL   V+SP G L+FR  S+++  YG +I H+ +   R     Y + +K    C  IL+N L GNYVN G F LY DD+L+  L I  +L+++I   D++ YPKL+ +YY L + L+QDH+ +L   +P   +Y + ++  GL +       SCC+ LD+I S++ +  Q +V        + PN                         R  ++   ++  ++E ++  L +M+S  + N    ++Q +C+NQW+MSRPLL LILL    +  L+    C       +TM   F+ LM  +  ++S +N++KFTQN++TFR ++
Sbjct:    3 IQQLEVLCKQLYEATDIRIRSEAEKALVTFVSSQDALPKCQLLLQRADSSYAQLLAASTLTKLIQG----LSLQERIDIRSYALNYLATVPNLQHFVVQALVSLLAKLTKYGWFDSYKEE-MVFQNLLEDVKKFLQ-GSVEHCTIGVQILSQLVCEMNSVVEMDVQVSFSKMRKIATSFRDQQLLETFLLSCSLLVSARDNSKNISFMDESQQALISHVLRLTKNCLSFDFIGS-STDESADDMNNVQIPTAWRPAFLD----SNTLKLFFDLYQILPNGLASYSISCLVQITSVRRSLFNNSERTKFLTHLVEGVKDILTTLHG-LSDPDNYHEFCRLLARLKSNYQLGELIAVPCYPEAIQLIAKFTVESLHLW-LFAPNSVHYLLTLWQRMVASVPYVKSPDPHLLGTYTPEVIKAYIESRLDAVPVIIRDNLDDPLDDFCMVQQQLEQLSVIERCEYNKTCNLLVQHFDQKAREYENLLQTPNANSIDITIHELQLTWLVYIIGSAIVGRLTVA-TSDEHDTMDAELVIRVLQLMTLTD-------ARLPQAGCEKLELAILSFLDQVRKMHSSEQA--QKANLNKRLSEVFGLTDEQMLLSFINRKIITNLKFW-GRSESIITKTLMLLSELSVHFNSVRKLARLEEVQFMLTHHTSEHFPF-------------------------------------------------LGTNSSLSEMRCRTMFYTSLGRLLMFD-LGEDEERFYNFLEPLTNQFESLGSVMMDNNIFSNEE-----AKKVIIGLARDLRGLALPLNARIQYTMLFEWLYYADYLPILLRAMDLWA-HDP-AVTTPILKLFAELVHCRTQRLAGNVSSPMGILLFREASKLICIYGNRILHQEVPRER----LYPMRLKGIAICFLILKNSLGGNYVNCGVFKLYGDDTLDSVLNIIAKLILTIEQRDLIEYPKLSTAYYNLLNCLSQDHVSYLAALEPAAFVYILKSLTKGLAALDSATYISCCTILDSIVSYIFKQLQMKV-------STFPNKK----------------------LRSLNQENVQFLKVVEMNSELLQSMMSSLLNN----VLQEDCRNQWSMSRPLLVLILLYEDYYRSLKDRIICAQPIEKQQTMAQWFDDLMVGIERNVSSKNKEKFTQNMSTFRRDV 1067          
BLAST of Exportin-7 vs. Ensembl Fly
Match: Ranbp16 (gene:FBgn0053180 transcript:FBtr0340311)

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 419/1183 (35.42%), Postives = 643/1183 (54.35%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFS------TEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQA-LAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPA-MLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQ---CYLSAGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNL 3671
            I++LE+ CK  YE+ +  +RS AE+A ++   S +     +LLL+R +S Y+QL+A STL+KL+      LS+++R++IR+  LNYL     L  FVV+A+V L+ ++TK GW D+ KEE  VF+ ++E + + ++ G  +   I VQIL  LV E N   E ++  S   MRKIA +FR+ QL   F+ S  LL    +N K+++  D  Q +++ + L+LT +CLS+DFIG+   +E +DDM +VQ+PT WR AFL      + + LFF LY+ LP  L   +++CLVQ  S RRS FNN+ER  FL  LV GV DIL+   G L D   YHE CRL+ RLKSN+QLGEL+ +  Y   I+L+A+FTV SL      + NS HYLL  WQR+VAS+PY++   PHLL T+ P V+ AY+ SR+ A      +     L+D   V Q+LE ++V+ RC+Y  + + LV  FD+ A  +          S +      +L WLV ++G+ I GR+  A +SD++D +D ELV RVLQL  + D       A L QA    LE+A+L+FLDQ+R+++   ++  +   L + L +   + D+  LL  + +KI+ NL+ W G S+ +I+++L LL ELS+     ++L +L  V  +L +H+    PF                                                 L TN + +    RT FY SL RL +     E+   F  F+ PLT+  +SL   + +    SN       +K  ++ L RD+RG+A   +++  +  LF+WLY A  L  LL A+DLW   +P  +    LKL  EL   R  RL   V+SP G L+FR  S+++  YG +I H+ +   R     Y + +K    C  IL+N L GNYVN G F LY DD+L+  L I  +L+++I   D++ YPKL+ +YY L + L+QDH+ +L   +P   +Y + ++  GL +       SCC+ LD+I S++ +  Q +V        + PN                         R  ++   ++  ++E ++  L +M+S  + N    ++Q +C+NQW+MSRPLL LILL    +  L+    C       +TM   F+ LM  +  ++S +N++KFTQN++TFR ++
Sbjct:    3 IQQLEVLCKQLYEATDIRIRSEAEKALVTFVSSQDALPKCQLLLQRADSSYAQLLAASTLTKLIQG----LSLQERIDIRSYALNYLATVPNLQHFVVQALVSLLAKLTKYGWFDSYKEE-MVFQNLLEDVKKFLQ-GSVEHCTIGVQILSQLVCEMNSVVEMDVQVSFSKMRKIATSFRDQQLLETFLLSCSLLVSARDNSKNISFMDESQQALISHVLRLTKNCLSFDFIGS-STDESADDMNNVQIPTAWRPAFLD----SNTLKLFFDLYQILPNGLASYSISCLVQITSVRRSLFNNSERTKFLTHLVEGVKDILTTLHG-LSDPDNYHEFCRLLARLKSNYQLGELIAVPCYPEAIQLIAKFTVESLHLW-LFAPNSVHYLLTLWQRMVASVPYVKSPDPHLLGTYTPEVIKAYIESRLDAVPVIIRDNLDDPLDDFCMVQQQLEQLSVIERCEYNKTCNLLVQHFDQKAREYENLLQTPNANSIDITIHELQLTWLVYIIGSAIVGRLTVA-TSDEHDTMDAELVIRVLQLMTLTD-------ARLPQAGCEKLELAILSFLDQVRKMHSSEQA--QKANLNKRLSEVFGLTDEQMLLSFINRKIITNLKFW-GRSESIITKTLMLLSELSVHFNSVRKLARLEEVQFMLTHHTSEHFPF-------------------------------------------------LGTNSSLSEMRCRTMFYTSLGRLLMFD-LGEDEERFYNFLEPLTNQFESLGSVMMDNNIFSNEE-----AKKVIIGLARDLRGLALPLNARIQYTMLFEWLYYADYLPILLRAMDLWA-HDP-AVTTPILKLFAELVHCRTQRLAGNVSSPMGILLFREASKLICIYGNRILHQEVPRER----LYPMRLKGIAICFLILKNSLGGNYVNCGVFKLYGDDTLDSVLNIIAKLILTIEQRDLIEYPKLSTAYYNLLNCLSQDHVSYLAALEPAAFVYILKSLTKGLAALDSATYISCCTILDSIVSYIFKQLQMKV-------STFPNKK----------------------LRSLNQENVQFLKVVEMNSELLQSMMSSLLNN----VLQEDCRNQWSMSRPLLVLILLYEDYYRSLKDRIICAQPIEKQQTMAQWFDDLMVGIERNVSSKNKEKFTQNMSTFRRDV 1067          
BLAST of Exportin-7 vs. Ensembl Zebrafish
Match: xpo7 (exportin 7 [Source:ZFIN;Acc:ZDB-GENE-060628-2])

HSP 1 Score: 707.597 bits (1825), Expect = 0.000e+0
Identity = 450/1190 (37.82%), Postives = 676/1190 (56.81%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLR-LAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + LSKL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  KE+ +VFR VI  +   ++    +  +I V IL  L  E NQ    + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKL  +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P SL  L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    L+DA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +      +   + +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G    ++L+KL                           V F   +  S H                    +    V    N++      RT FY +L RL L+    E+   F  FM PLT A +++ Q  +  T     N+Q A  K  L+ L+RD+RG+A A ++K SF  LFDW+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+ +L+GNYVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +++Y +++I +GLT+    V + CCSSLD+I ++L + L++S                                 T + ++    ES D++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLEILCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLSKLVSRTSNPLPLEQRIDIRNYVLNYLATRPKLAAFVTQALIQLYARITKLGWFDCQKED-YVFRNVIVDVTRFLQDS-VEHCIIGVTILSQLTNEINQVSFADSTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLAHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTLQ----LFFDLYHSIPPSLSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVDNYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLDDAGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSTNSSTMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GQCEPITSKTLQLLNDLSIGYPYVRKLVKLSA-------------------------VQFMLNNHTSEH--------------------FSFLGVNNQANLSDMRC--RTTFYTALGRL-LMVDLGEDEDQFEQFMLPLTAAFEAVAQMFSTNTF----NEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFDWIYPSYMPILQRAIELWYHVPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITTYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAVLSGNYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVVMYILSSISEGLTALDTMVCTGCCSSLDHIVTYLFKQLSRS---------------------------------TKKRVAPMAQES-DRFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFADLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSVFRREVNDSMK 1077          
BLAST of Exportin-7 vs. Ensembl Zebrafish
Match: xpo7 (exportin 7 [Source:ZFIN;Acc:ZDB-GENE-060628-2])

HSP 1 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 450/1190 (37.82%), Postives = 678/1190 (56.97%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLR-LAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + LSKL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  KE+ +VFR VI  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKL  +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P SL  L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    L+DA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +      +   + +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL                           V F   +  S H                    +    V    N++      RT FY +L RL L+    E+   F  FM PLT A +++ Q  +  T     N+Q A  K  L+ L+RD+RG+A A ++K SF  LFDW+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+ +L+GNYVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +++Y +++I +GLT+    V + CCSSLD+I ++L + L++S                                 T + ++    ES D++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLEILCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLSKLVSRTSNPLPLEQRIDIRNYVLNYLATRPKLAAFVTQALIQLYARITKLGWFDCQKED-YVFRNVIVDVTRFLQDS-VEHCIIGVTILSQLTNEINQA---DSTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLAHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTLQ----LFFDLYHSIPPSLSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVDNYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLDDAGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSTNSSTMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GQCEPITSKTLQLLNDLSIGYSSVRKLVKLSA-------------------------VQFMLNNHTSEH--------------------FSFLGVNNQANLSDMRC--RTTFYTALGRL-LMVDLGEDEDQFEQFMLPLTAAFEAVAQMFSTNTF----NEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFDWIYPSYMPILQRAIELWYHVPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITTYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAVLSGNYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVVMYILSSISEGLTALDTMVCTGCCSSLDHIVTYLFKQLSRS---------------------------------TKKRVAPMAQES-DRFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFADLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSVFRREVNDSMK 1074          
BLAST of Exportin-7 vs. Ensembl Zebrafish
Match: xpo7 (exportin 7 [Source:ZFIN;Acc:ZDB-GENE-060628-2])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 450/1190 (37.82%), Postives = 678/1190 (56.97%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLR-LAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + LSKL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  KE+ +VFR VI  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKL  +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P SL  L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    L+DA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +      +   + +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL                           V F   +  S H                    +    V    N++      RT FY +L RL L+    E+   F  FM PLT A +++ Q  +  T     N+Q A  K  L+ L+RD+RG+A A ++K SF  LFDW+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+ +L+GNYVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +++Y +++I +GLT+    V + CCSSLD+I ++L + L++S                                 T + ++    ES D++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLEILCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLSKLVSRTSNPLPLEQRIDIRNYVLNYLATRPKLAAFVTQALIQLYARITKLGWFDCQKED-YVFRNVIVDVTRFLQDS-VEHCIIGVTILSQLTNEINQA---DSTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLAHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTLQ----LFFDLYHSIPPSLSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVDNYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLDDAGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSTNSSTMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GQCEPITSKTLQLLNDLSIGYSSVRKLVKLSA-------------------------VQFMLNNHTSEH--------------------FSFLGVNNQANLSDMRC--RTTFYTALGRL-LMVDLGEDEDQFEQFMLPLTAAFEAVAQMFSTNTF----NEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFDWIYPSYMPILQRAIELWYHVPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITTYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAVLSGNYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVVMYILSSISEGLTALDTMVCTGCCSSLDHIVTYLFKQLSRS---------------------------------TKKRVAPMAQES-DRFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFADLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSVFRREVNDSMK 1074          
BLAST of Exportin-7 vs. Ensembl Zebrafish
Match: xpo7 (exportin 7 [Source:ZFIN;Acc:ZDB-GENE-060628-2])

HSP 1 Score: 474.167 bits (1219), Expect = 3.804e-147
Identity = 279/671 (41.58%), Postives = 409/671 (60.95%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQ-SYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLGAVAKRL-MKLPVVISLLENHSPMQLPFL 2138
            + +LE+ CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + LSKL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  KE+ +VFR VI  +   ++    +  +I V IL  L  E NQ S+    T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKL  +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P SL  L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    L+DA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +      +   + +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G     +  KL  V  +L NH+     FL
Sbjct:    8 LAQLEILCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLSKLVSRTSNPLPLEQRIDIRNYVLNYLATRPKLAAFVTQALIQLYARITKLGWFDCQKED-YVFRNVIVDVTRFLQDS-VEHCIIGVTILSQLTNEINQVSFSTHSTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLAHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSLSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLDDAGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSTNSSTMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GQCEPITSKTLQLLNDLSIGYPYTHVAFKLSAVQFMLNNHTSEHFSFL 655          

HSP 2 Score: 267.314 bits (682), Expect = 2.441e-73
Identity = 171/460 (37.17%), Postives = 263/460 (57.17%), Query Frame = 3
Query: 2319 RTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLR-LAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            RT FY +L RL L+    E+   F  FM PLT A +++ Q  +  T     N+Q A  K  L+ L+RD+RG+A A ++K SF  LFDW+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+ +L+GNYVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +++Y +++I +GLT+    V + CCSSLD+I ++L + L++S                                 T + ++    ES D++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:  669 RTTFYTALGRL-LMVDLGEDEDQFEQFMLPLTAAFEAVAQMFSTNTF----NEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFDWIYPSYMPILQRAIELWYHVPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITTYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAVLSGNYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVVMYILSSISEGLTALDTMVCTGCCSSLDHIVTYLFKQLSRS---------------------------------TKKRVAPMAQES-DRFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFADLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSVFRREVNDSMK 1078          
BLAST of Exportin-7 vs. Ensembl Zebrafish
Match: xpo4 (exportin 4 [Source:NCBI gene;Acc:324342])

HSP 1 Score: 79.7221 bits (195), Expect = 1.938e-14
Identity = 95/367 (25.89%), Postives = 163/367 (44.41%), Query Frame = 3
Query:  204 NSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYE-GEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIV-QYSLKLTLSCLSYDFIGTCGGE------EVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENL--PASLGHLALACLVQAASFRRSFFNNNERQI-FLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTG--YSRFIELLAQFT 1265
            ++E R  AE   LS   S + F   + +LE     Y    A + + + + +  I L       +R   L Y++QR  L  +V   I+  +  I K G LD +     +F +V     ++I SG P    +A  IL +L+ EF+ S +   I  S          F+E+ L  IF+ ++E+L + S   +  NL  N Q S V Q  L L    LS++F+    G       E + ++M ++   +WR++ L        + LFF ++  +   + +   +L CL Q AS +   F +   Q+ +L  LV G+ +++  NG  ++D+     +  ++  L S F    L  L    ++ FI  L   T
Sbjct:   29 STEQRQHAEHIFLSFRKSKSPFAVCKHILETSKVDYVLFQAATAIMEAVVREWILLEKNSIESLRTFLLTYVLQRPNLQKYVREQILLAVAVIVKRGSLDKSINCKSIFLEV----SQLISSGNPTVQTLACSILTALLSEFSSSNKTSNIGLSMEFHGSCKRIFQEDDLRQIFMLTMEVLQEFS---RRENL--NAQMSCVFQRYLALANQVLSWNFLPPNLGRHYIAMFEATPNVM-LKPTESWRESLLDHR----VMDLFFTVHRKIREDSDMAQDSLQCLAQLASMQGPIFPDESAQVTYLAHLVEGLLNMI--NGIEIEDSEAVG-ISNIISNLISTFPRSVLTALPNELFASFINCLTLLT 378          
BLAST of Exportin-7 vs. Ensembl Xenopus
Match: XPO7 (exportin 7 [Source:NCBI gene;Acc:100038116])

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 457/1190 (38.40%), Postives = 675/1190 (56.72%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF-------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++  R +AE+A +  ++S       +LLLERG+S YSQL+A + L+KL+++S   L +EQR++IRN  L YL  R +LA FV +A++ L  RITKLGW D+ K+E +VFR VI  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   KSL L D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P +   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PHLL+T+ P V  AYV SR+ +      +G    LEDA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +       S    + AV   R L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+++L+F +Q R++Y+ G+   ++ +LY  L   + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              +   +N++      RT FY +L RL L+    E+   F  FM PLT A +SL Q       S+N N+Q A  K +L+ L+RD+RG+A A ++K SF  LFDW+YPA +  L  AI+LW     C   +  LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +   +  Y+L +K  + C  +L+  L+GNYVN G F LY D++L+  L  F++L++S+P +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +          A  P                              +ESE   ++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +S+  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:   24 LAQLEILCKQLYETTDTSTRLQAEKALVEFTNSPECLSKCQLLLERGSSSYSQLLAATCLTKLVSRSTNPLPLEQRIDIRNYVLTYLATRPKLASFVTQALIQLYARITKLGWFDSQKDE-YVFRNVIGDVTRFLQDS-VEYCVIGVSILSQLTNEINQA---DATHPLTKHRKIASSFRDSALFDIFTLSCNLLKQASG--KSLLLSDGSQHDLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPNFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHLLETYTPEVTKAYVTSRLESVHIILRDGLEDPLEDAGLVQQQLDQLSTIGRCEYDKTCALLVQLFDQSAQTYQELLQSGSAPSMELAVQEGR-LTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELSMLSFFEQFRKIYI-GDQVQKSSKLYRRLSDVLGLNDETMVLSIFIGKIITNLKYW-GRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINSQSNLSDMRC--RTTFYTALGRL-LMVDLGEDEEQFSQFMMPLTAAFESLAQMF----NSNNFNEQEA--KRSLVGLVRDLRGIAFAFNAKSSFMMLFDWIYPAYMPILQRAIELWFHDPACTTPI--LKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITTYGNRIL--TLGELPKEQL-YVLKLKGISICFSVLKAALSGNYVNFGVFRLYGDEALDNALQTFVKLLLSVPHSDLLDYPKLSQSYYSLLEVLTQDHMSFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFKQLSRSGKKRGAPPP------------------------------QESE---RFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRSSIVSSQPPEKQQAMHLCFENLMEGIEGNLLTKNRDRFTQNLSAFRREVNDSMK 1090          
BLAST of Exportin-7 vs. Ensembl Xenopus
Match: XPO7 (exportin 7 [Source:NCBI gene;Acc:100038116])

HSP 1 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 458/1197 (38.26%), Postives = 671/1197 (56.06%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQ------SYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF-------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG--AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++  R +AE+A +  ++S       +LLLERG+S YSQL+A + L+KL+++S   L +EQR++IRN  L YL  R +LA FV +A++ L  RITKLGW D+ K+E +VFR VI  +   ++    +  +I V IL  L  E NQ       Y  + T      RKIA++FR++ L+ IF  S  LL + S   KSL L D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P +   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PHLL+T+ P V  AYV SR+ +      +G    LEDA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +       S    + AV   R L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+++L+F +Q R++Y+ G+   ++ +LY  L   + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G     ++L+KL  V  +L NH+     FL                                              +   +N++      RT FY +L RL ++    E+   F  FM PLT A +SL Q       S+N N+Q A  K +L+ L+RD+RG+A A ++K SF  LFDW+YPA +  L  AI+LW     C   +  LKL  EL  +R+ RLQ  V+SP+G L    C+RIL   GE +  E+L         Y+L +K  + C  +L+  L+GNYVN G F LY D++L+  L  F++L++S+P +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +          A  P                              +ESE   ++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +S+  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    6 LAQLEILCKQLYETTDTSTRLQAEKALVEFTNSPECLSKCQLLLERGSSSYSQLLAATCLTKLVSRSTNPLPLEQRIDIRNYVLTYLATRPKLASFVTQALIQLYARITKLGWFDSQKDE-YVFRNVIGDVTRFLQDS-VEYCVIGVSILSQLTNEINQVSADFPCYPADATHPLTKHRKIASSFRDSALFDIFTLSCNLLKQASG--KSLLLSDGSQHDLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPNFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHLLETYTPEVTKAYVTSRLESVHIILRDGLEDPLEDAGLVQQQLDQLSTIGRCEYDKTCALLVQLFDQSAQTYQELLQSGSAPSMELAVQEGR-LTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELSMLSFFEQFRKIYI-GDQVQKSSKLYRRLSDVLGLNDETMVLSIFIGKIITNLKYW-GRCEPITSKTLQLLNDLSIGYPDSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINSQSNLSDMRC--RTTFYTALGRLLMVD-LGEDEEQFSQFMMPLTAAFESLAQMF----NSNNFNEQEA--KRSLVGLVRDLRGIAFAFNAKSSFMMLFDWIYPAYMPILQRAIELWFHDPACTTPI--LKLMAELVHNRSQRLQFDVSSPNGILFLHPCNRILTL-GE-LPKEQL---------YVLKLKGISICFSVLKAALSGNYVNFGVFRLYGDEALDNALQTFVKLLLSVPHSDLLDYPKLSQSYYSLLEVLTQDHMSFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFKQLSRSGKKRGAPPP------------------------------QESE---RFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRSSIVSSQPPEKQQAMHLCFENLMEGIEGNLLTKNRDRFTQNLSAFRREVNDSMK 1074          
BLAST of Exportin-7 vs. Ensembl Xenopus
Match: XPO7 (exportin 7 [Source:NCBI gene;Acc:100038116])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 458/1197 (38.26%), Postives = 671/1197 (56.06%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQ------SYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF-------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG--AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++  R +AE+A +  ++S       +LLLERG+S YSQL+A + L+KL+++S   L +EQR++IRN  L YL  R +LA FV +A++ L  RITKLGW D+ K+E +VFR VI  +   ++    +  +I V IL  L  E NQ       Y  + T      RKIA++FR++ L+ IF  S  LL + S   KSL L D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P +   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PHLL+T+ P V  AYV SR+ +      +G    LEDA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +       S    + AV   R L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+++L+F +Q R++Y+ G+   ++ +LY  L   + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G     ++L+KL  V  +L NH+     FL                                              +   +N++      RT FY +L RL ++    E+   F  FM PLT A +SL Q       S+N N+Q A  K +L+ L+RD+RG+A A ++K SF  LFDW+YPA +  L  AI+LW     C   +  LKL  EL  +R+ RLQ  V+SP+G L    C+RIL   GE +  E+L         Y+L +K  + C  +L+  L+GNYVN G F LY D++L+  L  F++L++S+P +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +          A  P                              +ESE   ++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +S+  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLEILCKQLYETTDTSTRLQAEKALVEFTNSPECLSKCQLLLERGSSSYSQLLAATCLTKLVSRSTNPLPLEQRIDIRNYVLTYLATRPKLASFVTQALIQLYARITKLGWFDSQKDE-YVFRNVIGDVTRFLQDS-VEYCVIGVSILSQLTNEINQVSADFPCYPADATHPLTKHRKIASSFRDSALFDIFTLSCNLLKQASG--KSLLLSDGSQHDLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPNFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHLLETYTPEVTKAYVTSRLESVHIILRDGLEDPLEDAGLVQQQLDQLSTIGRCEYDKTCALLVQLFDQSAQTYQELLQSGSAPSMELAVQEGR-LTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELSMLSFFEQFRKIYI-GDQVQKSSKLYRRLSDVLGLNDETMVLSIFIGKIITNLKYW-GRCEPITSKTLQLLNDLSIGYPDSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINSQSNLSDMRC--RTTFYTALGRLLMVD-LGEDEEQFSQFMMPLTAAFESLAQMF----NSNNFNEQEA--KRSLVGLVRDLRGIAFAFNAKSSFMMLFDWIYPAYMPILQRAIELWFHDPACTTPI--LKLMAELVHNRSQRLQFDVSSPNGILFLHPCNRILTL-GE-LPKEQL---------YVLKLKGISICFSVLKAALSGNYVNFGVFRLYGDEALDNALQTFVKLLLSVPHSDLLDYPKLSQSYYSLLEVLTQDHMSFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFKQLSRSGKKRGAPPP------------------------------QESE---RFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRSSIVSSQPPEKQQAMHLCFENLMEGIEGNLLTKNRDRFTQNLSAFRREVNDSMK 1076          
BLAST of Exportin-7 vs. Ensembl Xenopus
Match: XPO7 (exportin 7 [Source:NCBI gene;Acc:100038116])

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 457/1191 (38.37%), Postives = 671/1191 (56.34%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF-------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG--AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++  R +AE+A +  ++S       +LLLERG+S YSQL+A + L+KL+++S   L +EQR++IRN  L YL  R +LA FV +A++ L  RITKLGW D+ K+E +VFR VI  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   KSL L D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P +   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PHLL+T+ P V  AYV SR+ +      +G    LEDA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +       S    + AV   R L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+++L+F +Q R++Y+ G+   ++ +LY  L   + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G     ++L+KL  V  +L NH+     FL                                              +   +N++      RT FY +L RL ++    E+   F  FM PLT A +SL Q       S+N N+Q A  K +L+ L+RD+RG+A A ++K SF  LFDW+YPA +  L  AI+LW     C   +  LKL  EL  +R+ RLQ  V+SP+G L    C+RIL   GE +  E+L         Y+L +K  + C  +L+  L+GNYVN G F LY D++L+  L  F++L++S+P +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +          A  P                              +ESE   ++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +S+  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLEILCKQLYETTDTSTRLQAEKALVEFTNSPECLSKCQLLLERGSSSYSQLLAATCLTKLVSRSTNPLPLEQRIDIRNYVLTYLATRPKLASFVTQALIQLYARITKLGWFDSQKDE-YVFRNVIGDVTRFLQDS-VEYCVIGVSILSQLTNEINQA---DATHPLTKHRKIASSFRDSALFDIFTLSCNLLKQASG--KSLLLSDGSQHDLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPNFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHLLETYTPEVTKAYVTSRLESVHIILRDGLEDPLEDAGLVQQQLDQLSTIGRCEYDKTCALLVQLFDQSAQTYQELLQSGSAPSMELAVQEGR-LTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELSMLSFFEQFRKIYI-GDQVQKSSKLYRRLSDVLGLNDETMVLSIFIGKIITNLKYW-GRCEPITSKTLQLLNDLSIGYPDSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINSQSNLSDMRC--RTTFYTALGRLLMVD-LGEDEEQFSQFMMPLTAAFESLAQMF----NSNNFNEQEA--KRSLVGLVRDLRGIAFAFNAKSSFMMLFDWIYPAYMPILQRAIELWFHDPACTTPI--LKLMAELVHNRSQRLQFDVSSPNGILFLHPCNRILTL-GE-LPKEQL---------YVLKLKGISICFSVLKAALSGNYVNFGVFRLYGDEALDNALQTFVKLLLSVPHSDLLDYPKLSQSYYSLLEVLTQDHMSFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFKQLSRSGKKRGAPPP------------------------------QESE---RFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRSSIVSSQPPEKQQAMHLCFENLMEGIEGNLLTKNRDRFTQNLSAFRREVNDSMK 1067          
BLAST of Exportin-7 vs. Ensembl Xenopus
Match: XPO7 (exportin 7 [Source:NCBI gene;Acc:100038116])

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 458/1191 (38.46%), Postives = 671/1191 (56.34%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF-------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG--AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++  R +AE+A +  ++S       +LLLERG+S YSQL+A + L+KL+++S   L +EQR++IRN  L YL  R +LA FV +A++ L  RITKLGW D+ K+E +VFR VI  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   KSL L D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P +   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PHLL+T+ P V  AYV SR+ +      +G    LEDA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +       S    + AV   R L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+++L+F +Q R++Y+ G+   ++ +LY  L   + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G     ++L+KL  V  +L NH+     FL                                              +   +N++      RT FY +L RL L+    E+   F  FM PLT A +SL Q       S+N N+Q A  K +L+ L+RD+RG+A A ++K SF  LFDW+YPA +  L  AI+LW     C   +  LKL  EL  +R+ RLQ  V+SP+G L    C+RIL   GE +  E+L         Y+L +K  + C  +L+  L+GNYVN G F LY D++L+  L  F++L++S+P +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +          A  P                              +ESE   ++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +S+  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    9 LAQLEILCKQLYETTDTSTRLQAEKALVEFTNSPECLSKCQLLLERGSSSYSQLLAATCLTKLVSRSTNPLPLEQRIDIRNYVLTYLATRPKLASFVTQALIQLYARITKLGWFDSQKDE-YVFRNVIGDVTRFLQDS-VEYCVIGVSILSQLTNEINQA---DATHPLTKHRKIASSFRDSALFDIFTLSCNLLKQASG--KSLLLSDGSQHDLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPNFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHLLETYTPEVTKAYVTSRLESVHIILRDGLEDPLEDAGLVQQQLDQLSTIGRCEYDKTCALLVQLFDQSAQTYQELLQSGSAPSMELAVQEGR-LTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELSMLSFFEQFRKIYI-GDQVQKSSKLYRRLSDVLGLNDETMVLSIFIGKIITNLKYW-GRCEPITSKTLQLLNDLSIGYPDSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINSQSNLSDMRC--RTTFYTALGRL-LMVDLGEDEEQFSQFMMPLTAAFESLAQMF----NSNNFNEQEA--KRSLVGLVRDLRGIAFAFNAKSSFMMLFDWIYPAYMPILQRAIELWFHDPACTTPI--LKLMAELVHNRSQRLQFDVSSPNGILFLHPCNRILTL-GE-LPKEQL---------YVLKLKGISICFSVLKAALSGNYVNFGVFRLYGDEALDNALQTFVKLLLSVPHSDLLDYPKLSQSYYSLLEVLTQDHMSFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFKQLSRSGKKRGAPPP------------------------------QESE---RFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRSSIVSSQPPEKQQAMHLCFENLMEGIEGNLLTKNRDRFTQNLSAFRREVNDSMK 1068          
BLAST of Exportin-7 vs. Ensembl Mouse
Match: Xpo7 (exportin 7 [Source:MGI Symbol;Acc:MGI:1929705])

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 449/1190 (37.73%), Postives = 677/1190 (56.89%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNS-NQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE  CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + L+KL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  K++ +VFR  I  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P S   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    LED   V Q+L+ ++ + RC+Y  + + LV LFD++A  +      ++    +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I K++ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              +   +N+T      RT FY +L RL L+    E+   +  FM PLT A +++ Q       S+NS N+Q A  K  L+ L+RD+RG+A A ++K SF  LF+W+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+  L+G+YVN G F LY DD+LE  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +      +S +  K + P +                         RES   D +  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    9 LAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDD-YVFRNAITDVTRFLQDS-VEYCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPDVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSASASPMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKVITNLKYW-GRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINNQSNLTDMRC--RTTFYTALGRL-LMVDLGEDEDQYEQFMLPLTAAFEAVAQMF-----STNSFNEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITMYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAALSGSYVNFGVFRLYGDDALENALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFK-----QLSRSTKKRTTPLN-------------------------RES---DCFLHIMQQHPAMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSAFRREVNDSMK 1075          
BLAST of Exportin-7 vs. Ensembl Mouse
Match: Xpo7 (exportin 7 [Source:MGI Symbol;Acc:MGI:1929705])

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 449/1190 (37.73%), Postives = 676/1190 (56.81%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNS-NQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE  CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + L+KL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  K++ +VFR  I  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P S   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    LED   V Q+L+ ++ + RC+Y  + + LV LFD++A  +      ++    +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I K++ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              +   +N+T      RT FY +L RL L+    E+   +  FM PLT A +++ Q       S+NS N+Q A  K  L+ L+RD+RG+A A ++K SF  LF+W+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+  L+G+YVN G F LY DD+LE  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +      +S +  K + P                           RES   D +  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDD-YVFRNAITDVTRFLQDS-VEYCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPDVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSASASPMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKVITNLKYW-GRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINNQSNLTDMRC--RTTFYTALGRL-LMVDLGEDEDQYEQFMLPLTAAFEAVAQMF-----STNSFNEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITMYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAALSGSYVNFGVFRLYGDDALENALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFK-----QLSRSTKKRTTP-------------------------LNRES---DCFLHIMQQHPAMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSAFRREVNDSMK 1074          
BLAST of Exportin-7 vs. Ensembl Mouse
Match: Xpo7 (exportin 7 [Source:MGI Symbol;Acc:MGI:1929705])

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 449/1191 (37.70%), Postives = 677/1191 (56.84%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAA-VSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNS-NQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE  CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + L+KL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  K++ +VFR  I  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P S   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +  +    +G    LED   V Q+L+ ++ + RC+Y  + + LV LFD++A  +      ++    +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I K++ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              +   +N+T      RT FY +L RL L+    E+   +  FM PLT A +++ Q       S+NS N+Q A  K  L+ L+RD+RG+A A ++K SF  LF+W+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+  L+G+YVN G F LY DD+LE  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +      +S +  K + P                           RES   D +  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDD-YVFRNAITDVTRFLQDS-VEYCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPDVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILSRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSASASPMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKVITNLKYW-GRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINNQSNLTDMRC--RTTFYTALGRL-LMVDLGEDEDQYEQFMLPLTAAFEAVAQMF-----STNSFNEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITMYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAALSGSYVNFGVFRLYGDDALENALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFK-----QLSRSTKKRTTP-------------------------LNRES---DCFLHIMQQHPAMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSAFRREVNDSMK 1075          
BLAST of Exportin-7 vs. Ensembl Mouse
Match: Xpo7 (exportin 7 [Source:MGI Symbol;Acc:MGI:1929705])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 439/1173 (37.43%), Postives = 665/1173 (56.69%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNS-NQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDK 3635
            + +LE  CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + L+KL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  K++ +VFR  I  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P S   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    LED   V Q+L+ ++ + RC+Y  + + LV LFD++A  +      ++    +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I K++ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              +   +N+T      RT FY +L RL L+    E+   +  FM PLT A +++ Q       S+NS N+Q A  K  L+ L+RD+RG+A A ++K SF  LF+W+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+  L+G+YVN G F LY DD+LE  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +      +S +  K + P +                         RES   D +  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+
Sbjct:    8 LAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDD-YVFRNAITDVTRFLQDS-VEYCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPDVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSASASPMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKVITNLKYW-GRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINNQSNLTDMRC--RTTFYTALGRL-LMVDLGEDEDQYEQFMLPLTAAFEAVAQMF-----STNSFNEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITMYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAALSGSYVNFGVFRLYGDDALENALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFK-----QLSRSTKKRTTPLN-------------------------RES---DCFLHIMQQHPAMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDR 1057          
BLAST of Exportin-7 vs. Ensembl Mouse
Match: Ranbp17 (RAN binding protein 17 [Source:MGI Symbol;Acc:MGI:1929706])

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 429/1202 (35.69%), Postives = 665/1202 (55.32%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF-----STEG-SQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLGAV-AKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSA---GSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNKLNIDYHSS-NSVEMIA 3731
            + ELE+ C + Y   +   R  AE+A L L DS       +LLLE+G + Y+QL+A + LSKL+ +    L +EQR++IRN  LNY+  + +LA FV++A++ +I ++TKLGW +  K+E FVFR++I  + + ++ G  +  +I V IL  L  E N     + +R +   RKIA +FR+  L  I + +  LL ++    K LNL D  Q S+V   LKL LSCL++DF+G+   +E +DD+ +VQ+PT WR  FL P    + + LFF LY +LP  L  LAL+CLVQ AS RRS F++ ER  +LG L+ GV  IL  N   L D   YHE CR + RLK+N+QLGELV +  Y+  I L+A FT+ SL+  +  + NS HYLL  WQR+VAS+P+++ ++PHLLDT+ P +  A++ SR+ +      +     L+D  +V Q+LE +  +SRC+Y  + + LV LFD+ A  +     +  G + +   +   L WL+ L+G  + GR+    S+D++D +DGEL  RV QL  ++DT         I      E+AVL FLDQ R+ Y+ G+   R  ++Y  + + + I DDN +LET + KI+ NL+ W G  +PVISR+L  L +LS+G +  K+L+K+  V  +L+NH+    PFL                                              +  T N+       RT FY +LTRL L+    E+   F  FM PLT + +++ Q         N+N +    K  L+ L RD+RG+A A ++K S+  LFDW+YPA L  L  AI+ W     C   +  LKL  EL  +R+ RL   V+SP+G L+FR  S+++  YG +I    L S+  +K  Y + +K  + C   L++ L GNYV+ G F LY D+  +  L  F+++++S+  +D++ Y KL++SYY L + LTQDH+ ++   +P ++LY + ++ +GLT+    VSSSCC+SLD + ++L +      ++    KP                            SR   ++  +    M+ +   L  M+S     L   ++  +C+NQW++SRPLLGLILLN K F +L+   +++      E +   F  LME V  +LS++NRD+FTQNL+ FR ++  +  L  D H+  +S++M++
Sbjct:    8 LAELEVLCTHLYVGTDLTERIEAEKALLELIDSPECLSKCQLLLEQGTTSYAQLLAATCLSKLVTRIN-PLPIEQRIDIRNYILNYVASQPKLAPFVIQALIQVIAKLTKLGWFEVQKDE-FVFREIIADVKKFLQ-GTVEHCIIGVIILCELTQEMNLV---DYSRPSAKHRKIATSFRDTSLKDILVLACSLLKQVLA--KPLNLQDQDQQSLVMQVLKLVLSCLNFDFLGS-SADESADDLCTVQIPTTWRTIFLEP----ETLDLFFNLYHSLPPLLSQLALSCLVQFASTRRSLFSSPERAKYLGNLIKGVKRIL-ENPQGLSDPGNYHEFCRFLARLKTNYQLGELVLVKEYAEVIGLIANFTITSLQHWEF-APNSVHYLLTLWQRMVASVPFVKSAEPHLLDTYAPEITKAFITSRLESVAIVVRDNLEDPLDDTATVFQQLEQLCTVSRCEYEKTCTLLVQLFDQNAQNYQKLLHAAPGLAVDMAIQEGRLAWLIYLVGTVVGGRLTYT-STDEHDAMDGELSCRVFQLISLMDTRLPHCTNEKI------ELAVLWFLDQFRKTYV-GDQLQRTSKVYARMSEVLGITDDNHVLETFMTKIVTNLKYW-GRCEPVISRTLQFLSDLSVGYILLKKLVKIDAVKFMLKNHTSEHFPFL---------------------------------------------GISETYNV--GDFRCRTTFYTALTRL-LMVDLGEDEDEFENFMLPLTVSFETVLQIF-------NNNFKQEEVKRMLIGLARDLRGIAFALNTKTSYTMLFDWIYPAYLPVLQRAIERWYGEPACTTPI--LKLLAELMQNRSQRLNFDVSSPNGILLFREASKMICTYGNQILS--LGSLSKDKI-YPMKLKGISICYSALKSALCGNYVSFGVFKLYGDNHFDNVLQAFVKMLLSVSHSDLLQYRKLSQSYYPLLECLTQDHMSFITNLEPPVLLYVLTSLSEGLTTLDTVVSSSCCTSLDYMVTYLFK-----HIAKEGKKPLR--------------------------SREAMQAGQRLLHFMQQNPDVLQQMMSV----LMNTIVFEDCRNQWSVSRPLLGLILLNEKYFSELRASLINSQPLPKQEVLGQCFRNLMEGVEQNLSVKNRDRFTQNLSVFRRDV--AEALRSDGHTDLSSLDMMS 1088          
BLAST of Exportin-7 vs. UniProt/SwissProt
Match: sp|Q5ZLT0|XPO7_CHICK (Exportin-7 OS=Gallus gallus OX=9031 GN=XPO7 PE=2 SV=1)

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 446/1189 (37.51%), Postives = 675/1189 (56.77%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE  CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + L+KL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  K+E +VFR VI  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P S   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    L+D   V Q+L+ ++ + RC+Y  + + LV LFD++A  +      +T    +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              +   +N+T      RT FY +L RL L+    E+   +  FM PLT A +++ Q  +  T     N+Q A  K  L+ L+RD+RG+A A ++K SF  LF+W+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+  L+G+YVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +      +S +  K + P                             ++  D++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLENLCKQLYETTDTATRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDE-YVFRNVITDVTRFLQDS-VEHCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLDDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSATASPMDVAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINNQSNLTDMRC--RTTFYTALGRL-LMVDLGEDEDQYEQFMLPLTAAFETVAQMFSTNTF----NEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITTYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAALSGSYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFK-----QLSRSTKKRTTP----------------------------LTQESDRFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSAFRREVNDSMK 1074          
BLAST of Exportin-7 vs. UniProt/SwissProt
Match: sp|Q5R9G4|XPO7_PONAB (Exportin-7 OS=Pongo abelii OX=9601 GN=XPO7 PE=2 SV=3)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 447/1190 (37.56%), Postives = 676/1190 (56.81%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNS-NQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE  CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + L+KL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  K++ +VFR  I  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P S   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    LED   V Q+L+ ++ + RC+Y  + + LV LFD++A  +      ++    +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ SR+L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              +   +N+T      RT FY +L RL L+    E+   +  FM PLT A +++ Q       S+NS N+Q A  K  L+ L+RD+RG+A A ++K SF  LF+W+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+  L+G+YVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +      +S +  K + P                             ++  D++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDD-YVFRNAITDVTRFLQDS-VEYCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSASASPMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GRCEPITSRTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINNQSNLTDMRC--RTTFYTALGRL-LMVDLGEDEDQYEQFMLPLTAAFEAVAQMF-----STNSFNEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPAC--TTPVLKLMAELVHNRSRRLQFDVSSPNGILLFRETSKMITMYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAALSGSYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFK-----QLSRSTKKRTTP----------------------------LNQESDRFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSAFRREVNDSMK 1074          
BLAST of Exportin-7 vs. UniProt/SwissProt
Match: sp|Q9UIA9|XPO7_HUMAN (Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3)

HSP 1 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 446/1190 (37.48%), Postives = 676/1190 (56.81%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNS-NQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE  CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + L+KL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  K++ +VFR  I  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P S   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    LED   V Q+L+ ++ + RC+Y  + + LV LFD++A  +      ++    +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              +   +N+T      RT FY +L RL L+    E+   +  FM PLT A +++ Q       S+NS N+Q A  K  L+ L+RD+RG+A A ++K SF  LF+W+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+  L+G+YVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +      +S +  K + P                             ++  D++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDD-YVFRNAITDVTRFLQDS-VEYCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSASASPMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINNQSNLTDMRC--RTTFYTALGRL-LMVDLGEDEDQYEQFMLPLTAAFEAVAQMF-----STNSFNEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITMYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAALSGSYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFK-----QLSRSTKKRTTP----------------------------LNQESDRFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSAFRREVNDSMK 1074          
BLAST of Exportin-7 vs. UniProt/SwissProt
Match: sp|Q9EPK7|XPO7_MOUSE (Exportin-7 OS=Mus musculus OX=10090 GN=Xpo7 PE=1 SV=3)

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 449/1190 (37.73%), Postives = 676/1190 (56.81%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNS-NQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE  CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + L+KL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  K++ +VFR  I  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P S   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    LED   V Q+L+ ++ + RC+Y  + + LV LFD++A  +      ++    +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I K++ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              +   +N+T      RT FY +L RL L+    E+   +  FM PLT A +++ Q       S+NS N+Q A  K  L+ L+RD+RG+A A ++K SF  LF+W+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+  L+G+YVN G F LY DD+LE  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +      +S +  K + P                           RES   D +  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDD-YVFRNAITDVTRFLQDS-VEYCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPDVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSASASPMDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKVITNLKYW-GRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GINNQSNLTDMRC--RTTFYTALGRL-LMVDLGEDEDQYEQFMLPLTAAFEAVAQMF-----STNSFNEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITMYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAALSGSYVNFGVFRLYGDDALENALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFK-----QLSRSTKKRTTP-------------------------LNRES---DCFLHIMQQHPAMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSAFRREVNDSMK 1074          
BLAST of Exportin-7 vs. UniProt/SwissProt
Match: sp|Q569Z2|XPO7B_XENLA (Exportin-7-B OS=Xenopus laevis OX=8355 GN=xpo7-b PE=2 SV=1)

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 453/1190 (38.07%), Postives = 672/1190 (56.47%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF-------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++  R +AE+A +  ++S       +LLLERG+S YSQL+A + L+KL+++S   L +EQR++IRN  L YL  R +LA FV +A++ L  RITKLGW D+ K++ FVFR VI  +   ++    +  +I V  L  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   KSL L D  QH ++   LKLT +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P +   L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PHLL+T+ P V  +YV SR+ +      +G    LEDA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +       S    + AV   R L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+++L+F +Q R++Y+ G+   ++ +LY  L   + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL                           V F   +  S H                    +    +   +N++      RT FY +L RL L+    E+   F  FM PLT A +SL Q       S+N N+Q A  K +L+ L+RD+RG+A A ++K SF  LFDW+YPA +  L  AI+LW     C   +  LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +   +  Y+L +K  + C  +L+  L+GNYVN G F LY D++L+  L  F++L++S+P +D++ YPKL++SYY L + LTQDH+ ++ + +P +I+Y +++I +GLT+    V + CCS LD+I ++L +          A  P                              +ESE   ++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +S+  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLEILCKQLYETTDTSTRLQAEKALVEFTNSPECLSKCQLLLERGSSSYSQLLAATCLTKLVSRSTNPLPLEQRIDIRNYVLTYLATRPKLASFVTQALIQLYARITKLGWFDSQKDD-FVFRNVIGDVTRFLQDS-VEYCVIGVSFLSQLTNEINQA---DATHPLTKHRKIASSFRDSALFDIFTLSCNLLKQASG--KSLLLSDESQHDLLMQLLKLTHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTLQ----LFFDLYHSIPPNFTPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHLLETYTPEVTKSYVTSRLESVHIILRDGLEDPLEDAGLVQQQLDQLSTIGRCEYDKTCALLVQLFDQSAQTYQELLQSGSAPSMELAVQEGR-LTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELSMLSFFEQFRKIYI-GDQVQKSSKLYRRLSDVLGLNDETMVLSIFIGKIITNLKYW-GRCEPITSKTLQLLNDLSIGYSSVRKLVKLSA-------------------------VQFMLNNHTSEH--------------------FSFLGINSQSNMSDMRC--RTTFYTALGRL-LMVDLGEDEEQFSQFMMPLTAAFESLAQMFN----SNNFNEQEA--KRSLVGLVRDLRGIAFAFNAKSSFMMLFDWIYPAYMPILQRAIELWFHDPACTTPI--LKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITTYGNRIL--TLGELPKEQL-YVLKLKGISICFSVLKAALSGNYVNFGVFRLYGDEALDNALQTFVKLLLSVPHSDLLDYPKLSQSYYSLLEVLTQDHMSFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFKQLSRSGKKRGAPPP------------------------------QESE---RFLHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRSSIVSSQPPEKQQAMHLCFENLMEGIEGNLLTKNRDRFTQNLSAFRREVNDSMK 1074          
BLAST of Exportin-7 vs. TrEMBL
Match: A0A0L8GXD1 (Importin N-terminal domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22026319mg PE=4 SV=1)

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 460/1183 (38.88%), Postives = 687/1183 (58.07%), Query Frame = 3
Query:  165 ELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFS---TEGSQNAVTRLRE--LCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLS---AGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            +LE  CK  YE+ +S +RS AE+A ++ + S +     +LLLERGNS Y+QL+A STL+KL+++  + L +EQR++IRN  LN+L  R +L  +V++++V L  RITKLGW D  K+E  VFR  ++ + + I+S   + ++I VQ+L  LV E NQ  E E +RS    RK A++FR+ QLY IF  +  LL     N+K+L+  D+ QH ++ +SL+L L+CL++DFIG    +E SDD+ +VQ+PT+WR  FL  S +     LFF LY  LP+SL  +AL+CLVQ AS RRS FNN+ER  FL  LV GV  IL  +  +L   + YHE CRL+ RLKSN+QLGELV +  Y   I+L+A+FTV SL      + NS HYLL  WQR+VAS+PY++ S+PHLL+T+ P V  AY+ SRM +     + G    LED   V Q+L+ ++ + RC+Y  + + LV LFDE A R+    + G Q+    +++  L WLV ++GA + GR+  A S+D++D +DGELV RVLQL  + D+    S          LE+A+L+F +Q R++Y+ G+   +  ++Y  L + + + D++ +L   I KI+ NL+ W G S+ +I+++L LL ELS+G +  ++L+KL  V  +L NH+    PFL            G  +                     NG++              A    RT FY +L RL LL    E+   F  FM PLT A D    A+ N+  ++N+  +   +K +L+ L RD+RGVA A ++K S+   FDW+YP     L  A++LW   +P  +    LKL  EL+ +R+ RLQ  V+SP+G L+FR  S+I++ YGE+I    +  I  ++  Y + +K  + C  +L+  L GNYVN G F LY DD+L+  L +F++L++SIP  D++ YPKL+++YY L + L QDH++++   +P++ LY ++TI +GLT+    V + CC+ LDNI ++L R    +       K +HP S                         R+SE+   +  ++E     L  MLS     +   +M  +C+NQW+MSRPLLGLILLN   F  L+   +S   A     M   FE LME +  SL  +NRD+FTQNL+ FR ++N S K
Sbjct:    9 QLENLCKQMYETADSSLRSDAEKALVAFASSPDCLSKCQLLLERGNSPYAQLLAASTLTKLVSRPNLTLPLEQRIDIRNYVLNFLGTRPKLVHYVLQSLVQLFARITKLGWFDVQKDE-CVFRNAVQDVAKFIQSMSTQHVMIGVQLLSQLVCEMNQLSEAEASRSITKHRKTASSFRDTQLYEIFQLACSLLRTAEGNLKTLDFSDDSQHGLLSHSLRLALNCLTFDFIG-ASTDESSDDLCTVQIPTSWRSVFLDFSTL----QLFFDLYAGLPSSLSSMALSCLVQVASVRRSLFNNDERAQFLNHLVAGVRRIL-EHPQSLSHPNNYHEFCRLLARLKSNYQLGELVKVDNYPEIIKLIAEFTVTSLRMWQC-APNSIHYLLSLWQRMVASVPYVKASEPHLLETYTPEVTKAYITSRMESVHVALTEGLEDPLEDNGMVTQQLDQLSTIGRCEYEKTCALLVQLFDEAAQRYQELISSGGQSVEVAVQQGRLTWLVYIIGAVVGGRVSFA-STDEHDAMDGELVCRVLQLMNLTDSRLQQSGCE------KLELAILSFFEQFRKIYV-GDQVQKTSKVYRRLSEVLRLSDESMVLSVFIGKIITNLKYW-GRSEQIITKTLLLLSELSVGYSSGRKLVKLEAVQLMLNNHTSDHFPFL------------GVNT---------------------NGNIM-------------ADMRCRTTFYTALGRL-LLVDLGEDEEKFDQFMLPLTSAFD----AVGNMLANANTQNKMEEAKRSLIGLARDLRGVAFAFNTKTSYMMNFDWIYPTYTPVLHRAVELWY-HDP-SVTTPVLKLMAELAQNRSQRLQFDVSSPNGVLLFREISKIVVSYGERILS--IGDIPKDQL-YPMKLKGISICFSMLKAALCGNYVNFGVFRLYGDDALDNALAMFVKLLLSIPQNDLLDYPKLSQNYYALLECLAQDHMMFISNLEPQVFLYILSTISEGLTALDTMVCTGCCAILDNIVTYLFRRLTRKK------KKNHPTSI------------------------RDSEA---FLRILEVHPEILQQMLS----TVLNIIMFEDCRNQWSMSRPLLGLILLNEDYFHKLKDSIISSQPADKQPAMAQCFENLMEGIERSLLTKNRDRFTQNLSVFRRDVNDSLK 1081          
BLAST of Exportin-7 vs. TrEMBL
Match: A0A2T7P8M7 (Importin N-terminal domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_09032 PE=4 SV=1)

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 455/1185 (38.40%), Postives = 686/1185 (57.89%), Query Frame = 3
Query:  165 ELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFS---TEGSQNAVTRLRE--LCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASS-NPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAG---SPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNKL 3689
            +LE  CK  YE+ +  +RS AE+A ++ ++S +     +LLLERG+S Y+QL+A +TL KL++++ I L +EQR+EIRN  LNYL  R +L  FV +A+V L  RITK GW D +K+E  +FR V+  + + I+SG  + ++I VQ+L  LV E NQ  E E +RS    RKIA++FR+ QL+ IF  +  LL   + N+K L+  D+ QH ++ ++L+L  +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  + +     LFF LY  LP SL   AL+CLVQ AS RRS FNN ER  FL  LV GV  IL  N   L D + YHE CRL+ RLKSN+QLGELV +  Y   I+L+A+FTV SL+     + NS HYLL  WQR+VAS+PY++ ++PH+L+T+ P V  AY+ SR+ +  S    G    L+D   + Q+LE ++ + RC+Y  + + LV LFDE+A R+      GSQ+    + E  L WLV ++GA I GR+  A S+D++D +DGELV RVL+L  + D+      +        L++A+L+F +Q R++Y+ G+   +  ++Y  L + + + D++ +L   I KI+ NL+ W G S+ +IS++L LL +LS+G +  ++L+KL  V  LL +H+    PFL                                                +TTN +  S    RT FY SL RL LL    E+   F  FM PLT A +++   L+N    ++S  +   +K +L+ L RD+RG+  A ++K S+  LFDW+YPA    L  A++LW   +P  +    LKL  EL+ +R+ RLQ  V+SP+G L+FR  S++++ YG+    E+  S+   K      +K  + C  +L+  L GNYVN G F LY DD+L+  L +F++L++SIP +D++ YPKL+++YY L + L QDH+ ++ + +P++ LY ++TI +GL +    V + CC++LDNI ++L R   S+       K   P +  MH S                         + +   +E     L  MLS     +   +M  +C+NQW+MSRPLLGLILLN   F  L++  +S+      ETM   F+ LM+ +  SL  +NRD+FTQNL+ FR ++N S K+
Sbjct:    9 QLETLCKELYETTDGNIRSEAEKALVAFANSPDCLAKCQLLLERGSSPYAQLLAATTLIKLVSRANITLPLEQRVEIRNYVLNYLATRPKLMQFVSQALVQLFARITKFGWFDVSKDEC-IFRNVVTDVGKFIQSGSTQHVMIGVQLLSQLVCEMNQVSESEASRSLTKHRKIASSFRDTQLFEIFQLACSLLRSAAGNLKGLDFSDSSQHGLLSHTLRLAQNCLTFDFIGT-STDESSDDLCTVQIPTSWRTAFLDVTTL----ELFFDLYNGLPPSLSPTALSCLVQMASVRRSLFNNAERAKFLNHLVIGVRSIL-ENPQGLSDPNNYHEFCRLLARLKSNYQLGELVKVDNYGDVIKLIAEFTVTSLQMWQF-APNSVHYLLGLWQRMVASVPYVKAAEPHMLETYTPEVTKAYITSRLGSVHSVIREGTEDPLDDHGLISQQLEQLSTIGRCEYEKTCALLVQLFDESAQRYQEMVATGSQSMELAIEEGRLTWLVYIIGAVIGGRVSFA-STDEHDAMDGELVCRVLRLMNLTDSRLAQGGSE------KLDLAILSFFEQFRKIYV-GDQVQKTSKVYRRLSEVLGLSDESMVLSVFIGKIITNLKFW-GRSEQIISKTLQLLSDLSVGYSSVRKLVKLDAVQFLLNSHTSEHFPFL-----------------------------------------------GITTNNSPISDMRCRTTFYTSLGRL-LLVDLGEDEEKFYQFMMPLTAAFENVGTLLSN----ADSQMKVEEAKRSLIGLARDLRGITFAFNTKTSYMMLFDWIYPAYTPVLQRAMELW-YHDP-AVTTPILKLMAELAQNRSQRLQFDVSSPNGILLFREISKMIVNYGKHT--EKYFSLTRGK------LKGISVCFSMLKAALCGNYVNFGVFRLYGDDALDNVLGMFVKLLLSIPQSDLLDYPKLSQNYYGLLECLAQDHMTFVASLEPQVFLYILSTISEGLVALDTMVCTGCCATLDNIITYLFRCLTSKK------KKMGPQA--MHNS-------------------------EAFLRNLEVHPEILQQMLS----TVLNIIMFEDCRNQWSMSRPLLGLILLNEDYFNKLRENIISSQPSEKQETMAQCFQNLMDGIERSLLTKNRDRFTQNLSVFRRDVNDSLKM 1077          
BLAST of Exportin-7 vs. TrEMBL
Match: A0A1S3K900 (exportin-7 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106179775 PE=4 SV=1)

HSP 1 Score: 738.413 bits (1905), Expect = 0.000e+0
Identity = 458/1186 (38.62%), Postives = 683/1186 (57.59%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAAR---FSTEGSQNAVTRLRE--LCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLL-RLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLS---AGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE  CK  YE+ ++ +R+ AE+A ++ + S +     +LLLERG+S Y+QL+A STL+KL+++    L +EQR++IRN  LNYL  R +L +FV  A+V L  RITKLGW D +K+E +VFR VI+ + + I+SG  + ++I VQ+L  LV E NQS   E +RS    RK  ++FR+ QL+ IF  +  LL   + NIK+L+  D+ Q  ++ ++LKLTL+CL++DF+GT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY NLP SL  +ALACLV  AS RRS F+N ER  FL +LV+GV  +L  N   L +   YHE CRL+ RLKSN+QLGELV +  Y   I+ +A+FTV SL+     + NS HYLL  WQR+VAS+PY++ ++PHLL+T+ P V  AY+ SR+ +       G    L+D   V Q+L+ ++ + RC+Y  + + LVTLFDE A +   F T G +     ++E  L WLV ++GA I GR+  A S+DD+D +DGELV RVLQL  + D+               L++A+L+F +Q R++Y+ G+   +  ++Y  L + + +GD++ +L   + KI+ NL+ W G S+ +I+++L LL +LS+G +  ++L+KL  V  +L +H+    PFL            GT +  +N                                        RT FY +L RL L+    E+   F  FM PLT A D++   L    T    N + A  K AL+ L RD+RGVA A ++K S+  LFDW+YP     LL A++LW       +    LKL  EL+ +R+ RLQ  V+SP+G L+FR  S+I++ YG +I    L  I  ++  Y + +K  + C ++L+  L G YVN G F LY DD+LE  L +F++L++SIP  D++ YPKL+++YY L + + QDH+ ++   +P++ LY ++TI DGLT+    V + CC+ LDNI + L  RL +         K  HP+                           +SE+   +  ++E     L  MLS     +   +M  +C+NQW+MSRPLLGLILLN + F  L+   +S   A   + M   FE LM+ +  SL  +NRD+FTQNL+ FR ++N S K
Sbjct:    7 LAQLEALCKQLYETTDASLRAEAEKALVNFAVSPSCLSKCQLLLERGDSPYAQLLAASTLTKLVSRPNQILPLEQRVDIRNYVLNYLATRPKLLNFVTVALVQLFARITKLGWFDVSKDE-YVFRNVIDDVGKFIQSGSSQHVMIGVQLLAQLVSEMNQS---EASRSLTKHRKTVSSFRDTQLFQIFQLACSLLRTAAGNIKNLDFGDDSQTGLLSHTLKLTLNCLTFDFLGT-STDESSDDLCTVQIPTSWRSAFLDFSTL----QLFFDLYANLPPSLASMALACLVNIASVRRSLFDNVERGKFLNELVSGVKAVLD-NPQGLSEPGSYHEFCRLLARLKSNYQLGELVKVDNYPEIIKKVAEFTVTSLQMWQF-APNSIHYLLSLWQRMVASVPYVKATEPHLLETYTPEVTKAYITSRLESVAVVLREGIEDPLDDQGLVSQQLDQLSTIGRCEYEKTCTLLVTLFDEAANKYQEFVTAGQRGFDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDDHDAMDGELVCRVLQLMNLTDSRLAERGCE------KLDLAMLSFFEQFRKIYV-GDQVQKTSKVYRRLSEVLGLGDESMVLSVFVGKIITNLKYWGG-SELIINKTLQLLSDLSVGYSSVRKLVKLEAVQFVLNSHTSEHFPFL------------GTANTGTNRI---------------------------------KDMRCRTIFYTALGRL-LMVDLGEDEERFELFMMPLTGAFDAVGNMLAAAET---PNFREAEVKRALIGLARDLRGVAFAFNTKTSYMMLFDWVYPTYTPILLRAVELW--YHDPAVTTPILKLMAELAQNRSQRLQFDVSSPNGILLFREISKIMVAYGSRILS--LGDIPKDQ-MYPMKLKGISICFNMLKAALCGGYVNYGVFRLYGDDALENALQMFVKLLLSIPQGDLLDYPKLSQTYYGLLECIAQDHMTFISNLEPQVFLYILSTISDGLTALDTMVCTGCCAVLDNIVTHLFKRLTKKH-------KKPHPHQVG------------------------DSET---FLRVLELHPDILQQMLS----TVLNIIMFEDCRNQWSMSRPLLGLILLNEEYFNKLRDNIISSQPADKQQAMAQCFESLMDGIERSLLTKNRDRFTQNLSVFRRDVNDSLK 1080          
BLAST of Exportin-7 vs. TrEMBL
Match: A0A1S3K9P5 (exportin-7 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106179775 PE=4 SV=1)

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 457/1191 (38.37%), Postives = 685/1191 (57.51%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYE-----GEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAAR---FSTEGSQNAVTRLRE--LCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLL-RLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLS---AGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE  CK  YE+ ++ +R+ AE+A ++ + S +     +LLLERG+S Y+QL+A STL+KL+++    L +EQR++IRN  LNYL  R +L +FV  A+V L  RITKLGW D +K+E +VFR VI+ + + I+SG  + ++I VQ+L  LV E NQ ++      E +RS    RK  ++FR+ QL+ IF  +  LL   + NIK+L+  D+ Q  ++ ++LKLTL+CL++DF+GT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY NLP SL  +ALACLV  AS RRS F+N ER  FL +LV+GV  +L  N   L +   YHE CRL+ RLKSN+QLGELV +  Y   I+ +A+FTV SL+     + NS HYLL  WQR+VAS+PY++ ++PHLL+T+ P V  AY+ SR+ +       G    L+D   V Q+L+ ++ + RC+Y  + + LVTLFDE A +   F T G +     ++E  L WLV ++GA I GR+  A S+DD+D +DGELV RVLQL  + D+          +    L++A+L+F +Q R++Y+ G+   +  ++Y  L + + +GD++ +L   + KI+ NL+ W G S+ +I+++L LL +LS+G +  ++L+KL  V  +L +H+    PFL            GT +  +N                                        RT FY +L RL L+    E+   F  FM PLT A D++   L    T    N + A  K AL+ L RD+RGVA A ++K S+  LFDW+YP     LL A++LW       +    LKL  EL+ +R+ RLQ  V+SP+G L+FR  S+I++ YG +I    L  I  ++  Y + +K  + C ++L+  L G YVN G F LY DD+LE  L +F++L++SIP  D++ YPKL+++YY L + + QDH+ ++   +P++ LY ++TI DGLT+    V + CC+ LDNI + L  RL +         K  HP+                           +SE+   +  ++E     L  MLS     +   +M  +C+NQW+MSRPLLGLILLN + F  L+   +S   A   + M   FE LM+ +  SL  +NRD+FTQNL+ FR ++N S K
Sbjct:    7 LAQLEALCKQLYETTDASLRAEAEKALVNFAVSPSCLSKCQLLLERGDSPYAQLLAASTLTKLVSRPNQILPLEQRVDIRNYVLNYLATRPKLLNFVTVALVQLFARITKLGWFDVSKDE-YVFRNVIDDVGKFIQSGSSQHVMIGVQLLAQLVSEMNQHWQTENDLSEASRSLTKHRKTVSSFRDTQLFQIFQLACSLLRTAAGNIKNLDFGDDSQTGLLSHTLKLTLNCLTFDFLGT-STDESSDDLCTVQIPTSWRSAFLDFSTL----QLFFDLYANLPPSLASMALACLVNIASVRRSLFDNVERGKFLNELVSGVKAVLD-NPQGLSEPGSYHEFCRLLARLKSNYQLGELVKVDNYPEIIKKVAEFTVTSLQMWQF-APNSIHYLLSLWQRMVASVPYVKATEPHLLETYTPEVTKAYITSRLESVAVVLREGIEDPLDDQGLVSQQLDQLSTIGRCEYEKTCTLLVTLFDEAANKYQEFVTAGQRGFDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDDHDAMDGELVCRVLQLMNLTDSRLAE------RGCEKLDLAMLSFFEQFRKIYV-GDQVQKTSKVYRRLSEVLGLGDESMVLSVFVGKIITNLKYWGG-SELIINKTLQLLSDLSVGYSSVRKLVKLEAVQFVLNSHTSEHFPFL------------GTANTGTNRI---------------------------------KDMRCRTIFYTALGRL-LMVDLGEDEERFELFMMPLTGAFDAVGNMLAAAET---PNFREAEVKRALIGLARDLRGVAFAFNTKTSYMMLFDWVYPTYTPILLRAVELW--YHDPAVTTPILKLMAELAQNRSQRLQFDVSSPNGILLFREISKIMVAYGSRILS--LGDIPKDQ-MYPMKLKGISICFNMLKAALCGGYVNYGVFRLYGDDALENALQMFVKLLLSIPQGDLLDYPKLSQTYYGLLECIAQDHMTFISNLEPQVFLYILSTISDGLTALDTMVCTGCCAVLDNIVTHLFKRLTKKH-------KKPHPHQVG------------------------DSET---FLRVLELHPDILQQMLS----TVLNIIMFEDCRNQWSMSRPLLGLILLNEEYFNKLRDNIISSQPADKQQAMAQCFESLMDGIERSLLTKNRDRFTQNLSVFRRDVNDSLK 1088          
BLAST of Exportin-7 vs. TrEMBL
Match: A0A1S3K8L2 (exportin-7 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106179775 PE=4 SV=1)

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 458/1194 (38.36%), Postives = 683/1194 (57.20%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYE--------GEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAAR---FSTEGSQNAVTRLRE--LCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLL-RLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLS---AGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE  CK  YE+ ++ +R+ AE+A ++ + S +     +LLLERG+S Y+QL+A STL+KL+++    L +EQR++IRN  LNYL  R +L +FV  A+V L  RITKLGW D +K+E +VFR VI+ + + I+SG  + ++I VQ+L  LV E NQ  E         E +RS    RK  ++FR+ QL+ IF  +  LL   + NIK+L+  D+ Q  ++ ++LKLTL+CL++DF+GT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY NLP SL  +ALACLV  AS RRS F+N ER  FL +LV+GV  +L  N   L +   YHE CRL+ RLKSN+QLGELV +  Y   I+ +A+FTV SL+     + NS HYLL  WQR+VAS+PY++ ++PHLL+T+ P V  AY+ SR+ +       G    L+D   V Q+L+ ++ + RC+Y  + + LVTLFDE A +   F T G +     ++E  L WLV ++GA I GR+  A S+DD+D +DGELV RVLQL  + D+               L++A+L+F +Q R++Y+ G+   +  ++Y  L + + +GD++ +L   + KI+ NL+ W G S+ +I+++L LL +LS+G +  ++L+KL  V  +L +H+    PFL            GT +  +N                                        RT FY +L RL L+    E+   F  FM PLT A D++   L    T    N + A  K AL+ L RD+RGVA A ++K S+  LFDW+YP     LL A++LW       +    LKL  EL+ +R+ RLQ  V+SP+G L+FR  S+I++ YG +I    L  I  ++  Y + +K  + C ++L+  L G YVN G F LY DD+LE  L +F++L++SIP  D++ YPKL+++YY L + + QDH+ ++   +P++ LY ++TI DGLT+    V + CC+ LDNI + L  RL +         K  HP+                           +SE+   +  ++E     L  MLS     +   +M  +C+NQW+MSRPLLGLILLN + F  L+   +S   A   + M   FE LM+ +  SL  +NRD+FTQNL+ FR ++N S K
Sbjct:    7 LAQLEALCKQLYETTDASLRAEAEKALVNFAVSPSCLSKCQLLLERGDSPYAQLLAASTLTKLVSRPNQILPLEQRVDIRNYVLNYLATRPKLLNFVTVALVQLFARITKLGWFDVSKDE-YVFRNVIDDVGKFIQSGSSQHVMIGVQLLAQLVSEMNQVSEHWQTENDLSEASRSLTKHRKTVSSFRDTQLFQIFQLACSLLRTAAGNIKNLDFGDDSQTGLLSHTLKLTLNCLTFDFLGT-STDESSDDLCTVQIPTSWRSAFLDFSTL----QLFFDLYANLPPSLASMALACLVNIASVRRSLFDNVERGKFLNELVSGVKAVLD-NPQGLSEPGSYHEFCRLLARLKSNYQLGELVKVDNYPEIIKKVAEFTVTSLQMWQF-APNSIHYLLSLWQRMVASVPYVKATEPHLLETYTPEVTKAYITSRLESVAVVLREGIEDPLDDQGLVSQQLDQLSTIGRCEYEKTCTLLVTLFDEAANKYQEFVTAGQRGFDIAVQEGRLTWLVYIIGAVIGGRVSFA-STDDHDAMDGELVCRVLQLMNLTDSRLAERGCE------KLDLAMLSFFEQFRKIYV-GDQVQKTSKVYRRLSEVLGLGDESMVLSVFVGKIITNLKYWGG-SELIINKTLQLLSDLSVGYSSVRKLVKLEAVQFVLNSHTSEHFPFL------------GTANTGTNRIKDMRC---------------------------------RTIFYTALGRL-LMVDLGEDEERFELFMMPLTGAFDAVGNMLAAAET---PNFREAEVKRALIGLARDLRGVAFAFNTKTSYMMLFDWVYPTYTPILLRAVELW--YHDPAVTTPILKLMAELAQNRSQRLQFDVSSPNGILLFREISKIMVAYGSRILS--LGDIPKDQ-MYPMKLKGISICFNMLKAALCGGYVNYGVFRLYGDDALENALQMFVKLLLSIPQGDLLDYPKLSQTYYGLLECIAQDHMTFISNLEPQVFLYILSTISDGLTALDTMVCTGCCAVLDNIVTHLFKRLTKKH-------KKPHPHQVG------------------------DSET---FLRVLELHPDILQQMLS----TVLNIIMFEDCRNQWSMSRPLLGLILLNEEYFNKLRDNIISSQPADKQQAMAQCFESLMDGIERSLLTKNRDRFTQNLSVFRRDVNDSLK 1091          
BLAST of Exportin-7 vs. Ensembl Cavefish
Match: xpo7 (exportin 7 [Source:NCBI gene;Acc:103043958])

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 452/1189 (38.02%), Postives = 678/1189 (57.02%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + LSKL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  KE+ +VFR VI  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKL  +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P SL  L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T  P V  AY+ SR+ +      +G    L+DA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +      +   S +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              V   +N++      RT FY +L RL L+    E+   F  FM PLT A +++ Q  +  T     N+Q A  K  L+ L+RD+RG+A A ++K SF  LFDW+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+ +L+GNYVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P ++LY +++I +GLT+    V + CCSSLD+I ++L +      +S +  K + P                             ++  D++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLEILCKQLYETTDTSTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLSKLVSRTSNPLPLEQRIDIRNYVLNYLATRPKLAAFVTQALIQLYARITKLGWFDCQKED-YVFRNVIVDVTRFLQDS-VEHCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDEGQHGLLMQLLKLAHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSLSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETFTPEVTKAYITSRLESVHIILRDGLEDPLDDAGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSTNSSSMDVAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GQCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GVNNQSNLSDMRC--RTTFYTALGRL-LMVDLGEDEDQFEQFMLPLTAAFEAVAQMFSTNTF----NEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFDWIYPSYIPILQRAIELWYHVPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITTYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAVLSGNYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVVLYILSSISEGLTALDTMVCTGCCSSLDHIVTYLFK-----QLSRSTKKRAAP----------------------------MAQESDRFFHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFADLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSVFRREVNDSMK 1074          
BLAST of Exportin-7 vs. Ensembl Cavefish
Match: xpo7 (exportin 7 [Source:NCBI gene;Acc:103043958])

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 452/1195 (37.82%), Postives = 679/1195 (56.82%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQS------YEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + LSKL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  KE+ +VFR VI  +   ++    +  +I V IL  L  E NQ       ++ + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKL  +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P SL  L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T  P V  AY+ SR+ +      +G    L+DA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +      +   S +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G +  ++L+KL  V  +L NH+     FL                                              V   +N++      RT FY +L RL L+    E+   F  FM PLT A +++ Q  +  T     N+Q A  K  L+ L+RD+RG+A A ++K SF  LFDW+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+ +L+GNYVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P ++LY +++I +GLT+    V + CCSSLD+I ++L +      +S +  K + P                             ++  D++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    8 LAQLEILCKQLYETTDTSTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLSKLVSRTSNPLPLEQRIDIRNYVLNYLATRPKLAAFVTQALIQLYARITKLGWFDCQKED-YVFRNVIVDVTRFLQDS-VEHCIIGVTILSQLTNEINQVSSSELFHDADTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDEGQHGLLMQLLKLAHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSLSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETFTPEVTKAYITSRLESVHIILRDGLEDPLDDAGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSTNSSSMDVAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GQCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GVNNQSNLSDMRC--RTTFYTALGRL-LMVDLGEDEDQFEQFMLPLTAAFEAVAQMFSTNTF----NEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFDWIYPSYIPILQRAIELWYHVPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITTYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAVLSGNYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVVLYILSSISEGLTALDTMVCTGCCSSLDHIVTYLFK-----QLSRSTKKRAAP----------------------------MAQESDRFFHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFADLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSVFRREVNDSMK 1083          
BLAST of Exportin-7 vs. Ensembl Cavefish
Match: xpo7 (exportin 7 [Source:NCBI gene;Acc:103043958])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 452/1192 (37.92%), Postives = 678/1192 (56.88%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF------STEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG----AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++  R +AE+A +  ++S +     +LLLERG+S YSQL+A + LSKL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  KE+ +VFR VI  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKL  +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P SL  L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  N  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PH+L+T  P V  AY+ SR+ +      +G    L+DA  V Q+L+ ++ + RC+Y  + + LV LFD++A  +      +   S +   +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LS+G     + ++L+KL  V  +L NH+     FL                                              V   +N++      RT FY +L RL L+    E+   F  FM PLT A +++ Q  +  T     N+Q A  K  L+ L+RD+RG+A A ++K SF  LFDW+YP+ +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y L +K  + C  +L+ +L+GNYVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++SYY L + LTQDH+ ++ + +P ++LY +++I +GLT+    V + CCSSLD+I ++L +      +S +  K + P                             ++  D++  +M+     +  MLS     +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:    2 LAQLEILCKQLYETTDTSTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLSKLVSRTSNPLPLEQRIDIRNYVLNYLATRPKLAAFVTQALIQLYARITKLGWFDCQKED-YVFRNVIVDVTRFLQDS-VEHCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDEGQHGLLMQLLKLAHNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFDLYHSIPPSLSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRIL-ENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHMLETFTPEVTKAYITSRLESVHIILRDGLEDPLDDAGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSTNSSSMDVAVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNEKLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GQCEPITSKTLQLLNDLSIGYPSHTLVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GVNNQSNLSDMRC--RTTFYTALGRL-LMVDLGEDEDQFEQFMLPLTAAFEAVAQMFSTNTF----NEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFDWIYPSYIPILQRAIELWYHVPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITTYGNRIL--TLGEVPKDQV-YALKLKGISICFSMLKAVLSGNYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEPHVVLYILSSISEGLTALDTMVCTGCCSSLDHIVTYLFK-----QLSRSTKKRAAP----------------------------MAQESDRFFHIMQQHPEMIQQMLS----TVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFADLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSVFRREVNDSMK 1071          
BLAST of Exportin-7 vs. Ensembl Cavefish
Match: xpo4 (exportin 4 [Source:NCBI gene;Acc:324342])

HSP 1 Score: 73.1738 bits (178), Expect = 1.508e-12
Identity = 93/372 (25.00%), Postives = 159/372 (42.74%), Query Frame = 3
Query:  204 NSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYE-GEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIV-QYSLKLTLSCLSYDFIGT-----------CGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENL--PASLGHLALACLVQAASFRRSFFNNNERQI-FLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTG--YSRFIELLAQFT 1265
            ++E R  AE   LS   S + F   + +LE     Y    A + + + + +  + L       +R   L Y++QR  L  +V   ++  +  I K G LD +     +F +V     ++I SG P    +A  IL +L+ EF+ S +   I  S          F+E+ L  IF+ ++E+L + S   +  NL  N Q S V Q  L L    LS++F+                 E + ++M ++    WR+A L        + LFF ++  +   + +   +L CL Q AS     F +   Q+ +L  LV G+  ++  NG  ++D+     +  ++  L + F    L  L    +S FI  L   T
Sbjct:    3 STEQRQHAEHIFLSFRKSKSPFGVCKHILETSKVDYVLFQAATAIMEAVVREWVLLEKNSIESLRTFLLTYVLQRPNLQKYVREQMLLAVAVIVKRGSLDKSINCKSIFHEV----GQLISSGNPIVQTLACSILTALLSEFSSSNKTSNIGLSMEFHGSCKRVFQEDDLRQIFVLTMEVLQEFS---RRENL--NAQMSCVFQRYLALANQVLSWNFLPPNHILFKEILHYIAMFEATQNVM-LKPTETWREALLDHR----VMDLFFTVHRKIREDSDMAQDSLQCLAQLASMHGPIFPDESAQVTYLAHLVEGLLTMI--NGIEIEDSEAVG-ISNIISNLITTFPRSILTALPSELFSSFINCLTILT 357          
BLAST of Exportin-7 vs. Ensembl Sea Lamprey
Match: xpo7 (exportin 7 [Source:ZFIN;Acc:ZDB-GENE-060628-2])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 453/1206 (37.56%), Postives = 682/1206 (56.55%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF-----STEGS--QNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYC-LADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNKLNIDYHSSNSVEMIA 3731
            + +LEL CK  YE+ ++  R +AE+A + L++S       +LLLERG+S Y+QL+A + LSKL++++   L +EQR++IRN  L+YL  R +L  FV +A++ L  RITKLGW D +K+E FV R VI  + + ++ G  +  +I   IL  LV E NQ+   + TR     RKIA++FR+  LY IF  S  LL + S   K+L+L D  QH ++ + LKLT +CL++DFIG    E   +D+ +VQ+PT+WR AFL  + +     LFF LY +LP +L  L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL  +  +L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+   + + NS HYLL  WQRL AS+PY++ ++PH+L+T+ P V  AY+ SR+ +      +G    L+D   + Q+LE ++ + RC+Y  + + LV LFD++A  +     S+ G   + AV   R L WLV ++GA I GR+  A S+D++D +DGEL+ RVLQL  + D+           A AG   LE+A+L+  +  R++Y+ G+   +  ++Y+ L + + + D+  +L   I KI+ NL+ W G S+P++SR+L LL++LS+G    ++L+KL  V  +L+NH+    PFL                                                    I   SS   T + A L RL ++    E+   F  F+ PLT A + + +       SSN NQ+ A  K  L+ L RD+RG+A A +SK S+  LFDWLYP  +   L AI+LW     C   +  LKL  EL  +R+ RLQ  V SP+G L+FR  S+++  YG  I    L  I  ++  Y L +K  + C  IL+  L GNYVN G F LY D +L+  L   ++L+++IP AD++ YPKL++SYY  L + LTQDH+ +L   +P ++LY + ++ +GL++    V +SCC+SLD++ ++L +    Q+  N   +P+                                + RD+   +++     +  MLS     +   +M  +C+NQW+MSRPLLGLILLN K F +L+   +S+ +PE    M   FE LME +  +L  +NRD+FTQNL  FR ++N S K ++   ++NSV+M++
Sbjct:    8 LAQLELLCKQLYETTDTSQRVQAEKALVDLTNSPECLSQCQLLLERGSSSYAQLLAATCLSKLISRTNNPLPLEQRVDIRNYVLSYLASRPKLVSFVTQALIQLYARITKLGWFDCDKDE-FVVRNVITDVTKFLQ-GSVEHCMIGAMILSELVSEMNQA---DTTRPITKHRKIASSFRDVSLYEIFTLSCTLLREASG--KNLDLSDERQHGLLLHLLKLTYNCLNFDFIGASSDESF-EDLCTVQIPTSWRSAFLDVATL----QLFFDLYCSLPPTLSPLVLSCLVQVASVRRSLFNNTERAKFLSHLVDGVKRIL-ESPQSLSDPNNYHEFCRLLARLKSNYQLGELVRVESYPDVIRLIANFTVTSLQHW-AFAPNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHVILRDGLEDPLDDTGLIMQQLEQLSTIGRCEYEKTCALLVQLFDQSAQAYQETLRSSPGQPMEIAVQEGR-LTWLVYMIGAVIGGRVSFA-STDEHDAMDGELICRVLQLMNLTDSRL---------AQAGNEKLELAILSCFEHFRKIYI-GDQVQKYSKVYKRLSEVLGLNDETMVLSVFIGKIITNLKYW-GRSEPILSRTLNLLNDLSVGYPSVRKLVKLTAVQFMLKNHTSEHFPFL---------------------------------------------------GINSQSSLSDTFYTA-LGRLLIVD-LGEDEDQFEQFILPLTAAFEVVVRMF----NSSNFNQEEA--KRTLVGLARDLRGIAFAFNSKTSYMMLFDWLYPTYMPVFLRAIELWYLEPACTTPI--LKLVAELVQNRSQRLQFDVISPNGILLFREASKMITTYGNLILS--LGEIPKDQL-YPLKLKGISICFSILKAALCGNYVNFGVFRLYGDSALDNALQTAVKLLLTIPHADLLNYPKLSQSYYSPLLECLTQDHMNFLVGLEPSVLLYILTSVSEGLSALDTMVCTSCCASLDHMVTYLFK----QLSRNGKKRPASA----------------------------VPQDRDRLLHILQQRPDIMQQMLS----TVLNIIMFEDCRNQWSMSRPLLGLILLNEKYFTELRNNIVSSQAPEKQQAMHLCFENLMEAIERNLLTKNRDRFTQNLAIFRRDVNDSLK-SMSPFAANSVDMMS 1085          
BLAST of Exportin-7 vs. Ensembl Nematostella
Match: EDO48742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM5])

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 435/1187 (36.65%), Postives = 657/1187 (55.35%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF----STEGSQNAVTRLRE--LCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCM-MMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPET---MKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            I +LEL CK  YE+ ++  R+ AE+A ++ + S +     + LLERGNS YSQL+A S+L++L++++     VEQR++IRN  LNYL  R +LA FV +A++ L+ R+TKL W DT+K E  VFR + + + + ++S      +I VQIL  LV E NQS   + TRS    RKIA++FR+  L+ IF  S+ LL +     + LNL +  QHS++   L LT +CLS+DFIGT   +E +DD+ +VQ+PT+WR  FL  + +     LFF LY +LP +L  +AL+CLVQ AS RRS FNNNER  +L QLV GV  I+      L   + YHE CRL+ RLKSN+QLGELV + GY+ FI L+  FTV           NS HYLL  WQR+VAS+PY++ ++PHLL+T+ P V +AY+ SR+ +       G    L+D  +V Q+LE ++ + RC+Y  + + L++LFD+ A R+    S  G+      ++E  L WLV ++G+ I GR+  + + D+ D LDGELV RVLQL  + D++     +        LE+A+L+F +Q R++Y+ G+   +  ++Y  L +R+ + D++ +L   I KI+ N++ W G S+ + S++L LL +LS+G +  ++L+KL  V  +L NH+    PFL            G  S                      G  Y     + T             FY +L RL L+    E+   F  FM P+T      +Q    V T ++       SK  L+ L RD+RG+A A +SK S+  LF+W+YP+ +  LL A +LW   +P  +    LKL  EL  +R+ RLQ  V+SP+G L+FR  S++++      ++     + S     +L +K  + C  +L+  L G YVN G F LY DD+L+  L  F++L++SIP  D++ YPK++++YY L + L QDH+ +L   +P++ LY +++I +GLT+  + V + CC +LD I ++L +    +   N  I    P                                    C+ ++ES    L  MLS     +   +M  +C+NQW+MSRPLLGLILLN K    ++        P+    M   F  LME V CSL  +NRD+FTQNL+ FR ++  S K
Sbjct:    1 IAQLELLCKQLYEATDTASRNAAEKALVNFTSSPDCLTKCQFLLERGNSSYSQLLAASSLTRLISRNAT-FPVEQRVDIRNYVLNYLGTRPKLASFVSQALIQLLTRLTKLSWFDTHKSE-LVFRTINDDVGKFLQSSVDH-CIIGVQILSQLVCEMNQS---DSTRSLTKHRKIASSFRDTLLHDIFQLSLTLLRQAYQ--EQLNLQNESQHSLMNQLLSLTCNCLSFDFIGT-SMDESADDLGTVQIPTSWRAVFLDYTTLQ----LFFNLYASLPPTLSPMALSCLVQLASVRRSLFNNNERAKYLEQLVKGVKQIM-EAPQLLSHPNNYHEFCRLLARLKSNYQLGELVKVEGYAEFIALITNFTVTGCMQMWQFPPNSVHYLLSLWQRMVASMPYVKSTEPHLLETYTPEVTNAYITSRLASVEVVVREGAEDPLDDTGTVQQQLEQLSTIGRCEYEKTCNLLISLFDQAAQRYQELRSNNGASTENVSIQEGRLTWLVYIIGSVIGGRVTYS-TVDEYDALDGELVCRVLQLMNLTDSQLSQRGSE------KLELAILSFFEQFRKIYV-GDQAQKTSKVYRRLSERLGLHDESMVLSVFIGKIITNMKYWGG-SENITSKTLQLLSDLSVGYSSVRKLVKLDAVQFVLNNHTSEHFPFL------------GIQS----------------------GRPYSEMRCRTT-------------FYIALGRL-LMVDLGEDDEKFDHFMSPITSRWHCRSQ----VITYTHDLFHTEESKRTLIGLCRDLRGLAFAFNSKVSYMMLFEWIYPSYMPVLLRACELWY-HDP-NVTTPVLKLMTELVQNRSQRLQFDVSSPNGILLFREASKMIVACPFMFSYFVRVPVLSLT---VLTLKGISICFLMLKAALCGGYVNFGVFNLYGDDALDNALNTFVKLLLSIPRTDLVEYPKVSQAYYALLEILAQDHMNFLSRLEPQVFLYMLSSILEGLTAIDIMVCTGCCGTLDYIVTYLFKCFSKRRKKNTQILNDEPP-----------------------------------CLRILESHPEMLQQMLS----TVLNVIMFEDCRNQWSMSRPLLGLILLNEKVSSTIRASITMQTPPDKRDEMTMCFRNLMEGVECSLVAKNRDRFTQNLSIFRRDVYNSLK 1068          
BLAST of Exportin-7 vs. Ensembl Medaka
Match: xpo7 (exportin 7 [Source:NCBI gene;Acc:101158920])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 459/1189 (38.60%), Postives = 684/1189 (57.53%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF-----STEGSQNAVT-RLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++ VR +AE+A +  ++S +     +LLLERG+S YSQL+A + LSKL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  K+E +VFR VI  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKL+ +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P SL  L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL+ N   L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PHLL+T+ P V  AY+ SR+ +      +G    LEDA  V Q+L+ ++ + RC+Y  + + LV LFD+ A  +     ST  S   VT +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LSLG +  ++L+KL  V  +L NH+     FL                                              V   +N++      RT FY +L RL L+    E+   F  FM PLT A +++ Q L+  T     N+Q A  K  L+ L+RD+RG+A A ++K SF  LFDW+YPA +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y + +K  + C  +L+ +L+GNYVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++S+Y L + LTQDH+ ++ + +P +++Y +++I +GLT+    V + CCSSLD+I ++L +    Q+  +   +P+               + D FL    H+ ++  E                  M+ + +  +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:   46 LAQLEILCKQLYETTDTAVRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLSKLVSRTSNPLPLEQRIDIRNYVLNYLATRPKLAAFVTQALIQLYARITKLGWFDCQKDE-YVFRNVIADVTRFLQDS-VEHCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLSYNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFNLYHSIPPSLSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRILA-NPQCLPDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHLLETYTPEVTKAYITSRLESVHVILRDGLEDPLEDAGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQAAQTYQELLQSTNSSAVDVTVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNERLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GQCEPITSKTLQLLNDLSLGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GVNNQSNLSDMRC--RTTFYTALGRL-LMVDLGEDEDQFEQFMLPLTAAFEAVAQMLSTNTF----NEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFDWIYPAYMPILQRAIELWYHDPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITTYGNRIL--TLGEVPKDQV-YGVKLKGVSVCFTMLKAVLSGNYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSFYSLLEVLTQDHMNFIASLEPHVVMYILSSISEGLTALDTMVCTGCCSSLDHIVTYLFK----QLSRSTKKRPA------------AMATDDRFL----HIMQQHPE------------------MIQQMLSTVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFADLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSVFRREVNDSMK 1111          
BLAST of Exportin-7 vs. Ensembl Medaka
Match: xpo7 (exportin 7 [Source:NCBI gene;Acc:101158920])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 459/1189 (38.60%), Postives = 684/1189 (57.53%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARF-----STEGSQNAVT-RLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAG---LEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLG-AVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPE---TMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNK 3686
            + +LE+ CK  YE+ ++ VR +AE+A +  ++S +     +LLLERG+S YSQL+A + LSKL++++   L +EQR++IRN  LNYL  R +LA FV +A++ L  RITKLGW D  K+E +VFR VI  +   ++    +  +I V IL  L  E NQ+   + T      RKIA++FR++ L+ IF  S  LL + S   K+LNL D  QH ++   LKL+ +CL++DFIGT   +E SDD+ +VQ+PT+WR AFL  S +     LFF LY ++P SL  L L+CLVQ AS RRS FNN ER  FL  LV+GV  IL+ N   L D + YHE CRL+ RLKSN+QLGELV +  Y   I L+A FTV SL+  +  + NS HYLL  WQRL AS+PY++ ++PHLL+T+ P V  AY+ SR+ +      +G    LEDA  V Q+L+ ++ + RC+Y  + + LV LFD+ A  +     ST  S   VT +   L WLV ++GA I GR+  A S+D+ D +DGELV RVLQL  + D+           A AG   LE+A+L+F +Q R++Y+ G+   ++ +LY  L + + + D+  +L   I KI+ NL+ W G  +P+ S++L LL++LSLG +  ++L+KL  V  +L NH+     FL                                              V   +N++      RT FY +L RL L+    E+   F  FM PLT A +++ Q L+  T     N+Q A  K  L+ L+RD+RG+A A ++K SF  LFDW+YPA +  L  AI+LW     C      LKL  EL  +R+ RLQ  V+SP+G L+FR  S+++  YG +I    L  +  ++  Y + +K  + C  +L+ +L+GNYVN G F LY DD+L+  L  F++L++SIP +D++ YPKL++S+Y L + LTQDH+ ++ + +P +++Y +++I +GLT+    V + CCSSLD+I ++L +    Q+  +   +P+               + D FL    H+ ++  E                  M+ + +  +   ++  +C+NQW+MSRPLLGLILLN K F DL+   +++  PE    M   FE LME +  +L  +NRD+FTQNL+ FR  +N S K
Sbjct:   66 LAQLEILCKQLYETTDTAVRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLSKLVSRTSNPLPLEQRIDIRNYVLNYLATRPKLAAFVTQALIQLYARITKLGWFDCQKDE-YVFRNVIADVTRFLQDS-VEHCIIGVTILSQLTNEINQA---DTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASG--KNLNLNDESQHGLLMQLLKLSYNCLNFDFIGT-STDESSDDLCTVQIPTSWRSAFLDSSTL----QLFFNLYHSIPPSLSPLVLSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRILA-NPQCLPDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEF-APNSVHYLLSLWQRLAASVPYVKATEPHLLETYTPEVTKAYITSRLESVHVILRDGLEDPLEDAGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQAAQTYQELLQSTNSSAVDVTVQEGRLTWLVYIIGAVIGGRVSFA-STDEQDAMDGELVCRVLQLMNLTDSRL---------AQAGNERLELAMLSFFEQFRKIYI-GDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYW-GQCEPITSKTLQLLNDLSLGYSSVRKLVKLSAVQFMLNNHTSEHFSFL---------------------------------------------GVNNQSNLSDMRC--RTTFYTALGRL-LMVDLGEDEDQFEQFMLPLTAAFEAVAQMLSTNTF----NEQEA--KRTLVGLVRDLRGIAFAFNAKTSFMMLFDWIYPAYMPILQRAIELWYHDPAC--TTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITTYGNRIL--TLGEVPKDQV-YGVKLKGVSVCFTMLKAVLSGNYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSFYSLLEVLTQDHMNFIASLEPHVVMYILSSISEGLTALDTMVCTGCCSSLDHIVTYLFK----QLSRSTKKRPA------------AMATDDRFL----HIMQQHPE------------------MIQQMLSTVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFADLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSVFRREVNDSMK 1131          
BLAST of Exportin-7 vs. Ensembl Medaka
Match: xpo4 (exportin 4 [Source:NCBI gene;Acc:101165185])

HSP 1 Score: 63.929 bits (154), Expect = 1.223e-9
Identity = 87/363 (23.97%), Postives = 154/363 (42.42%), Query Frame = 3
Query:  204 NSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLV-YEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGT---CGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENL--PASLGHLALACLVQAASFRRSFFNNNERQI-FLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTG--YSRFIELLAQFT 1265
            ++E R  AE   LS   S + F   + +LE     Y    A + + + + +  I L       +R   L Y++QR  L  +V   I+  +  I K G LD +     +F +V     ++I SG P    +A  IL +L+    + S    I  S          F+E+ L  IF+ ++E+L +  N  ++LN        + Q  L L    LS++F+           +   ++++   +WR+A L  + + D   LFF ++  +   + +   +L CL Q AS     F +   QI +L  +V G   ++  NG  ++D+     +  ++  L + F    L  L    ++ FI  L   T
Sbjct:   20 STEQRQHAEHVFLSFRKSKSPFAICKHILETSKVDYVLFQAATAIMEAVVREWILLEKSSIESLRAFLLTYVLQRPNLQKYVREQILLAVAVIVKRGSLDKSISCKSIFHEV----GQLISSGNPTVQTLACSILTALLSEFSSSSKTSSIGLSMEFHGNCKRLFQEDGLRQIFMMTMEVLQEF-NRRENLN---AQMSCVFQRFLSLANQVLSWNFLPPNHILFFYRRATQNVTLKPTESWREALLD-TRVMD---LFFTVHRKIREDSDMAQDSLQCLAQLASMHGPIFPDESAQISYLAHMVEGFLSMI--NGIEIEDSEAVG-ISNIISNLITMFPRSVLTALPSELFTSFINCLTLLT 367          
BLAST of Exportin-7 vs. Planmine SMEST
Match: SMESG000017293.1 (SMESG000017293.1)

HSP 1 Score: 2375.51 bits (6155), Expect = 0.000e+0
Identity = 1190/1191 (99.92%), Postives = 1191/1191 (100.00%), Query Frame = 3
Query:  159 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFSTEGSQNAVTRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLGAVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHXXXXXXXXXXXXXXXXNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGXXXXXXXXXXXXXXXXDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNKLNIDYHSSNSVEMIA 3731
            IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFSTEGSQNA+TRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLGAVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHSIGGSSGSGGISGGIGNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGLTSTSLTVSSSCCSSLDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNKLNIDYHSSNSVEMIA
Sbjct:    4 IEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERGNSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFVVRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAVQILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGKMSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSVQVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRRSFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNFQLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVASLPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVPQELEAVAVLSRCQYGLSVSRLVTLFDETAARFSTEGSQNAITRLRELCWLVLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHLIQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNALLETLIQKILVNLRCWAGLSKPVISRSLALLHELSLGAVAKRLMKLPVVISLLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHSIGGSSGSGGISGGIGNGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGFMGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACHSKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSRNNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYIKETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPADMMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGLTSTSLTVSSSCCSSLDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGSIDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQPECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPETMKSSFEKLMEDVNCSLSIRNRDKFTQNLNTFRHNLNGSNKLNIDYHSSNSVEMIA 1194          
The following BLAST results are available for this feature:
BLAST of Exportin-7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
XPO70.000e+037.48exportin 7 [Source:HGNC Symbol;Acc:HGNC:14108][more]
XPO70.000e+037.48exportin 7 [Source:HGNC Symbol;Acc:HGNC:14108][more]
RANBP170.000e+035.81RAN binding protein 17 [Source:HGNC Symbol;Acc:HGN... [more]
RANBP173.707e-12239.90RAN binding protein 17 [Source:HGNC Symbol;Acc:HGN... [more]
RANBP174.000e-12239.90RAN binding protein 17 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Exportin-7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C35A5.81.836e-14930.61pep chromosome:WBcel235:V:10521992:10525908:-1 gen... [more]
back to top
BLAST of Exportin-7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ranbp160.000e+035.41gene:FBgn0053180 transcript:FBtr0303647[more]
Ranbp160.000e+035.42gene:FBgn0053180 transcript:FBtr0303645[more]
Ranbp160.000e+035.42gene:FBgn0053180 transcript:FBtr0303646[more]
Ranbp160.000e+035.42gene:FBgn0053180 transcript:FBtr0074162[more]
Ranbp160.000e+035.42gene:FBgn0053180 transcript:FBtr0340311[more]
back to top
BLAST of Exportin-7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xpo70.000e+037.82exportin 7 [Source:ZFIN;Acc:ZDB-GENE-060628-2][more]
xpo70.000e+037.82exportin 7 [Source:ZFIN;Acc:ZDB-GENE-060628-2][more]
xpo70.000e+037.82exportin 7 [Source:ZFIN;Acc:ZDB-GENE-060628-2][more]
xpo73.804e-14741.58exportin 7 [Source:ZFIN;Acc:ZDB-GENE-060628-2][more]
xpo41.938e-1425.89exportin 4 [Source:NCBI gene;Acc:324342][more]
back to top
BLAST of Exportin-7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
XPO70.000e+038.40exportin 7 [Source:NCBI gene;Acc:100038116][more]
XPO70.000e+038.26exportin 7 [Source:NCBI gene;Acc:100038116][more]
XPO70.000e+038.26exportin 7 [Source:NCBI gene;Acc:100038116][more]
XPO70.000e+038.37exportin 7 [Source:NCBI gene;Acc:100038116][more]
XPO70.000e+038.46exportin 7 [Source:NCBI gene;Acc:100038116][more]
back to top
BLAST of Exportin-7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Xpo70.000e+037.73exportin 7 [Source:MGI Symbol;Acc:MGI:1929705][more]
Xpo70.000e+037.73exportin 7 [Source:MGI Symbol;Acc:MGI:1929705][more]
Xpo70.000e+037.70exportin 7 [Source:MGI Symbol;Acc:MGI:1929705][more]
Xpo70.000e+037.43exportin 7 [Source:MGI Symbol;Acc:MGI:1929705][more]
Ranbp170.000e+035.69RAN binding protein 17 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Exportin-7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZLT0|XPO7_CHICK0.000e+037.51Exportin-7 OS=Gallus gallus OX=9031 GN=XPO7 PE=2 S... [more]
sp|Q5R9G4|XPO7_PONAB0.000e+037.56Exportin-7 OS=Pongo abelii OX=9601 GN=XPO7 PE=2 SV... [more]
sp|Q9UIA9|XPO7_HUMAN0.000e+037.48Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV... [more]
sp|Q9EPK7|XPO7_MOUSE0.000e+037.73Exportin-7 OS=Mus musculus OX=10090 GN=Xpo7 PE=1 S... [more]
sp|Q569Z2|XPO7B_XENLA0.000e+038.07Exportin-7-B OS=Xenopus laevis OX=8355 GN=xpo7-b P... [more]
back to top
BLAST of Exportin-7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8GXD10.000e+038.88Importin N-terminal domain-containing protein OS=O... [more]
A0A2T7P8M70.000e+038.40Importin N-terminal domain-containing protein OS=P... [more]
A0A1S3K9000.000e+038.62exportin-7 isoform X3 OS=Lingula unguis OX=7574 GN... [more]
A0A1S3K9P50.000e+038.37exportin-7 isoform X2 OS=Lingula unguis OX=7574 GN... [more]
A0A1S3K8L20.000e+038.36exportin-7 isoform X1 OS=Lingula unguis OX=7574 GN... [more]
back to top
BLAST of Exportin-7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
xpo70.000e+038.02exportin 7 [Source:NCBI gene;Acc:103043958][more]
xpo70.000e+037.82exportin 7 [Source:NCBI gene;Acc:103043958][more]
xpo70.000e+037.92exportin 7 [Source:NCBI gene;Acc:103043958][more]
xpo41.508e-1225.00exportin 4 [Source:NCBI gene;Acc:324342][more]
back to top
BLAST of Exportin-7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
xpo70.000e+037.56exportin 7 [Source:ZFIN;Acc:ZDB-GENE-060628-2][more]
back to top
BLAST of Exportin-7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Exportin-7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO487420.000e+036.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Exportin-7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
xpo70.000e+038.60exportin 7 [Source:NCBI gene;Acc:101158920][more]
xpo70.000e+038.60exportin 7 [Source:NCBI gene;Acc:101158920][more]
xpo41.223e-923.97exportin 4 [Source:NCBI gene;Acc:101165185][more]
back to top
BLAST of Exportin-7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000017293.10.000e+099.92SMESG000017293.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028720 ID=SMED30028720|Name=Exportin-7|organism=Schmidtea mediterranea sexual|type=transcript|length=3782bp
CTGATAGTTAATTTAATTTATAATTTTTTTATACAGATTAATATTCTATT
ATCTGAGTATTTTATTAAATTCATATCAATAAGTAATTCATCAAGTAGAT
CAATAATTCTTATTCAGTGCTTACATTTTAGAATTTCAAAAAATTCAAAA
TGACAACTATTGAAGAATTAGAGTTATACTGCAAAAATGCGTACGAATCA
GAAAATTCTGAAGTTAGATCTAGAGCTGAGCAAGCATGTTTGAGTTTGTC
GGACTCCGTAAATGGGTTTGAAACGAGTCGGTTGTTGTTGGAAAGAGGAA
ATTCACATTACTCGCAACTGGTTGCAATTTCAACCTTGTCTAAGCTATTG
AATAAAAGTCAGATTGAGCTATCGGTTGAGCAAAGATTAGAAATAAGGAA
TTTGTGCCTGAATTATCTCATGCAGAGGGAGGAGCTGGCGGATTTTGTCG
TTCGGGCAATCGTTGGCCTGATCTGTCGAATCACGAAGCTCGGCTGGCTC
GATACGAATAAAGAGGAGAACTTTGTGTTCCGACAAGTAATCGAGCCGAT
GATGGAGATGATCAAGAGCGGTCAGCCGAAACCGATGCTGATAGCAGTGC
AGATCCTGTACAGTCTCGTGTATGAGTTTAACCAGAGCTATGAGGGAGAG
ATCACCCGGTCCACAATTGTCATGCGCAAGATCGCCAACAATTTCCGCGA
GAATCAGCTCTACAGCATTTTCATCACCTCGGTGGAGTTGCTGGGCAAAA
TGTCAAACAATATCAAATCGCTGAATCTATATGATAATATGCAGCATTCC
ATCGTGCAATACAGCCTAAAACTGACTTTGTCCTGCTTGTCGTACGATTT
CATCGGTACGTGTGGTGGTGAAGAGGTCAGTGACGACATGATGAGCGTCC
AGGTGCCTACCAATTGGAGACAAGCATTCCTGAGTCCGAGTGACATTCCT
GATCCGGTGCCGCTCTTTTTCCGGTTGTACGAGAATCTGCCGGCAAGTTT
GGGCCATCTTGCGTTGGCCTGTCTCGTGCAAGCCGCCTCCTTCCGCCGAT
CCTTCTTCAATAATAATGAGCGCCAGATATTCCTCGGTCAGCTCGTGAAT
GGTGTTTGTGATATTCTCTCACGAAACGGTGGAGCGCTCGACGATGCCAG
CTGTTACCATGAGTTGTGCCGACTTGTGTGCCGATTGAAAAGTAATTTCC
AGCTGGGCGAGCTCGTCACGTTGACGGGTTACTCGCGTTTCATAGAGTTG
CTGGCTCAATTCACCGTCAGATCCCTGGAGGCTGGCGACAGCGACAGCAG
CAACAGCCAGCACTATCTACTGCTGACATGGCAGCGCCTGGTAGCCAGCT
TGCCATACCTGCGATGCAGTCAGCCTCATCTGCTGGACACGCACTGCCCA
ATTGTACTTGATGCGTACGTACGATCGCGCATGCGGGCCGCCGTATCCCA
GGACAGCAACGGTCCATGGGGAGATCTCGAGGATGCAGTGAGTGTGCCCC
AGGAACTGGAGGCGGTCGCTGTACTTTCCCGCTGCCAATACGGACTGAGC
GTCAGTCGCTTAGTGACGCTATTTGATGAGACTGCGGCCCGATTTTCAAC
CGAAGGCAGCCAGAATGCGGTAACGAGATTACGTGAGCTTTGTTGGCTCG
TGCTGTTGATGGGGGCCTGTATCAGTGGACGTATTGGCTGTGCGGGATCC
AGTGATGACAATGACCGATTGGACGGGGAATTGGTCGCCCGCGTCCTTCA
GTTGGCCGGCATGATCGATACCGAATGCCTCGGCAGCAATGCTCATCTCA
TCCAAGCTTTGGCAGGCCTCGAAGTGGCTGTACTTGCGTTCCTCGATCAA
ATCCGTCGGGTCTACCTATGTGGCGAGAGCTGTATCCGAGCTGTCCGATT
GTATGAAGTTCTCCAGCAACGGATAACAATCGGTGATGACAACGCGCTCC
TAGAAACACTGATTCAGAAAATCCTGGTCAATTTGCGGTGCTGGGCGGGC
CTGAGTAAGCCAGTGATATCACGCTCATTGGCATTGCTGCATGAGTTGTC
GTTGGGCGCCGTGGCTAAGCGGCTGATGAAGCTTCCTGTCGTCATATCGT
TGCTAGAGAACCATTCCCCGATGCAACTGCCTTTCCTTATGCACTCGTGC
CAGGATCCTCAGCAGGTCGCATTTGGTACTGGCAGTATGCCTAGCAATCA
TTCCATTGGTGGTAGCAGTGGCAGCGGCGGCATTAGTGGAGGCATTGGCA
ACGGTGATCTCTATAGGCATAATGCGGTCCAGCTCACCACCAATATCACA
GGGGCCAGTTCCAATCCCCGCACTTGCTTTTATGCATCTCTCACTCGACT
GTTTCTTTTATCTCCACATGCCGAGGAACCGGCGGTGTTCCTGGGATTCA
TGGGTCCATTAACGCATGCTTGCGATTCGCTCACACAGGCCTTGACAAAC
GTTACCACAAGTTCCAATTCCAACCAGCAAGCAGCTACTAGCAAGCTCGC
ATTACTGGCACTCATCAGGGATGTCAGGGGGGTCGCAACGGCTTGTCACA
GCAAATGTTCCTTCCAGGCGCTCTTTGATTGGCTGTATCCTGCTATGTTG
TCACATCTACTGGTGGCCATCGATCTCTGGGGTCCCACTGAGCCGTGCGG
TTTAGTCCTCGGCTGTCTCAAACTGGCAGGCGAATTATCACTCAGCAGGA
ATAACCGTTTGCAACCTCAGGTCGCCTCTCCTAGTGGAGAACTAATGTTC
CGAGTTTGTTCCCGGATTTTGATTTGCTACGGCGAGAAAATCACCCACGA
ACGTCTCGCATCAATTCGCTCAAACAAAACACAATATTTACTATACATCA
AAGAGACAACAGCTTGCATTGACATCTTGCGCAATCTTCTAACGGGAAAT
TATGTTAACCTTGGAGCTTTCGCGCTTTATGCCGATGATTCGCTAGAAAA
GTGCTTACTGATATTCCTGCAATTGATGGTTAGCATTCCCCCGGCTGATA
TGATGGCATATCCGAAACTGGCTCGTTCATATTACTGTCTGGCAGACTCA
TTAACGCAGGATCATCTTATTTGGCTCGGTACTCAACAGCCAGAAATGAT
CCTTTATTTCGTCAATACCATCTGTGATGGATTAACATCTACCTCACTGA
CAGTCTCGTCCAGTTGTTGCTCCAGCCTCGACAACATTGCTTCATTCCTG
CTTCGTCTTGCTCAAAGTCAAGTCGTGTCGAACAATGCCATTAAGCCATC
CCACCCGAATTCAGCAAATATGCATCTCAGTGATAATGTGCGCGGGTCGA
TTGACCATTTCCTGATGACCTCCCAGCACTTGAGCAGACGGGAATCAGAA
TCCAGGGATAAATATTGCATGATGATGGAGTCATCAACTGGTCAGTTGAA
CACAATGCTATCGAGGAGCATGGAAAATTTATTTCAAGCGCTCATGCAAC
CCGAATGTAAAAACCAGTGGGCCATGTCTCGACCTTTATTAGGCCTTATT
TTATTGAATAACAAGGCTTTCGAGGACCTCCAACAGTGCTACTTGTCGGC
AGGATCACCGGAAACAATGAAAAGTTCATTTGAGAAGTTGATGGAAGATG
TCAATTGCTCTCTCAGCATCCGGAATAGAGACAAGTTTACGCAAAATCTG
AACACGTTCCGACATAATCTGAACGGATCAAACAAGTTGAATATAGATTA
TCATTCCTCCAACTCTGTCGAAATGATCGCATAAAGCTTGTAAGGCATTT
ACGGATTAAAATATAATCTAATTATGTTGTGC
back to top

protein sequence of SMED30028720-orf-1

>SMED30028720-orf-1 ID=SMED30028720-orf-1|Name=SMED30028720-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1195bp
MTTIEELELYCKNAYESENSEVRSRAEQACLSLSDSVNGFETSRLLLERG
NSHYSQLVAISTLSKLLNKSQIELSVEQRLEIRNLCLNYLMQREELADFV
VRAIVGLICRITKLGWLDTNKEENFVFRQVIEPMMEMIKSGQPKPMLIAV
QILYSLVYEFNQSYEGEITRSTIVMRKIANNFRENQLYSIFITSVELLGK
MSNNIKSLNLYDNMQHSIVQYSLKLTLSCLSYDFIGTCGGEEVSDDMMSV
QVPTNWRQAFLSPSDIPDPVPLFFRLYENLPASLGHLALACLVQAASFRR
SFFNNNERQIFLGQLVNGVCDILSRNGGALDDASCYHELCRLVCRLKSNF
QLGELVTLTGYSRFIELLAQFTVRSLEAGDSDSSNSQHYLLLTWQRLVAS
LPYLRCSQPHLLDTHCPIVLDAYVRSRMRAAVSQDSNGPWGDLEDAVSVP
QELEAVAVLSRCQYGLSVSRLVTLFDETAARFSTEGSQNAVTRLRELCWL
VLLMGACISGRIGCAGSSDDNDRLDGELVARVLQLAGMIDTECLGSNAHL
IQALAGLEVAVLAFLDQIRRVYLCGESCIRAVRLYEVLQQRITIGDDNAL
LETLIQKILVNLRCWAGLSKPVISRSLALLHELSLGAVAKRLMKLPVVIS
LLENHSPMQLPFLMHSCQDPQQVAFGTGSMPSNHSIGGSSGSGGISGGIG
NGDLYRHNAVQLTTNITGASSNPRTCFYASLTRLFLLSPHAEEPAVFLGF
MGPLTHACDSLTQALTNVTTSSNSNQQAATSKLALLALIRDVRGVATACH
SKCSFQALFDWLYPAMLSHLLVAIDLWGPTEPCGLVLGCLKLAGELSLSR
NNRLQPQVASPSGELMFRVCSRILICYGEKITHERLASIRSNKTQYLLYI
KETTACIDILRNLLTGNYVNLGAFALYADDSLEKCLLIFLQLMVSIPPAD
MMAYPKLARSYYCLADSLTQDHLIWLGTQQPEMILYFVNTICDGLTSTSL
TVSSSCCSSLDNIASFLLRLAQSQVVSNNAIKPSHPNSANMHLSDNVRGS
IDHFLMTSQHLSRRESESRDKYCMMMESSTGQLNTMLSRSMENLFQALMQ
PECKNQWAMSRPLLGLILLNNKAFEDLQQCYLSAGSPETMKSSFEKLMED
VNCSLSIRNRDKFTQNLNTFRHNLNGSNKLNIDYHSSNSVEMIA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005643nuclear pore
GO:0005737cytoplasm
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0015031protein transport
GO:0051028mRNA transport
GO:0051169nuclear transport
GO:0006886intracellular protein transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0008536Ran GTPase binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 1..519
e-value: 2.9E-27
score: 97.5
NoneNo IPR availablePANTHERPTHR12596:SF2EXPORTIN 7coord: 720..1177
NoneNo IPR availablePANTHERPTHR12596:SF2EXPORTIN 7coord: 3..667
NoneNo IPR availablePANTHERPTHR12596EXPORTIN 4,7-RELATEDcoord: 3..667
coord: 720..1177
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 4..1021