Epsin 2

Overview
NameEpsin 2
Smed IDSMED30028718
Length (bp)2489
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Epsin 2 (SMED30028718) t-SNE clustered cells

Violin plots show distribution of expression levels for Epsin 2 (SMED30028718) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Epsin 2 (SMED30028718) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Epsin 2 (SMED30028718) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028718

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30028718SMESG000042233.1 dd_Smed_v4_4779_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30028718SMESG000042233.1 dd_Smed_v4_4779_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30028718SMESG000042233.1 dd_Smed_v4_4779_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028718SMESG000042233.1 dd_Smed_v4_4779_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30028718SMESG000042233.1 dd_Smed_v4_4779_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028718SMESG000042233.1 dd_Smed_v4_4779_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Epsin 2 vs. Ensembl Human
Match: EPN2 (epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639])

HSP 1 Score: 233.032 bits (593), Expect = 2.617e-66
Identity = 134/352 (38.07%), Postives = 196/352 (55.68%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQ------HRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATA----TNVKSQDSSIPLDFDPWKS 1098
            IRR++KN+V  YSEAE  VREATSNDPWGPSS+LM+EIAD+T +  AF +IM ++WKRLND GKNWRHVYK+L LLDYL+K G+ER+A++C +NI  I+TLKDFQY + + KD G+ +REKSK LV LLKD+E L  ER++ LK KE+     + +GS+Q        +P        +++ K    P +          SE+E            +LQ A+ +S+E  E+  ++R    R ++L++++ALE+S+++                               K  K+     L + + + D  +   SS     K++PWG +A    TN     ++     DPW S
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLR----RGDDLRLQMALEESRRDT-----------------------------VKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPWPS 324          
BLAST of Epsin 2 vs. Ensembl Human
Match: EPN2 (epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639])

HSP 1 Score: 233.032 bits (593), Expect = 2.617e-66
Identity = 134/352 (38.07%), Postives = 196/352 (55.68%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQ------HRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATA----TNVKSQDSSIPLDFDPWKS 1098
            IRR++KN+V  YSEAE  VREATSNDPWGPSS+LM+EIAD+T +  AF +IM ++WKRLND GKNWRHVYK+L LLDYL+K G+ER+A++C +NI  I+TLKDFQY + + KD G+ +REKSK LV LLKD+E L  ER++ LK KE+     + +GS+Q        +P        +++ K    P +          SE+E            +LQ A+ +S+E  E+  ++R    R ++L++++ALE+S+++                               K  K+     L + + + D  +   SS     K++PWG +A    TN     ++     DPW S
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLR----RGDDLRLQMALEESRRDT-----------------------------VKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPWPS 324          
BLAST of Epsin 2 vs. Ensembl Human
Match: EPN2 (epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639])

HSP 1 Score: 227.639 bits (579), Expect = 3.666e-66
Identity = 135/365 (36.99%), Postives = 200/365 (54.79%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQ------HRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTP 1149
            IRR++KN+V  YSEAE  VREATSNDPWGPSS+LM+EIAD+T +  AF +IM ++WKRLND GKNWRHVYK+L LLDYL+K G+ER+A++C +NI  I+TLKDFQY + + KD G+ +REKSK LV LLKD+E L  ER++ LK KE+     + +GS+Q        +P        +++ K    P +          SE+E            +LQ A+ +S+E  E+  ++R    R ++L++++ALE+S+++                               K  K+     L + + + D  +   SS     K++PWG +A+  ++         +PW  P         P +TS P
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLR----RGDDLRLQMALEESRRD-----------------------------TVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPSASTNQT---------NPWGGP-------AAPASTSDP 321          
BLAST of Epsin 2 vs. Ensembl Human
Match: EPN2 (epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639])

HSP 1 Score: 230.72 bits (587), Expect = 1.898e-65
Identity = 117/257 (45.53%), Postives = 169/257 (65.76%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQ------HRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKE 825
            IRR++KN+V  YSEAE  VREATSNDPWGPSS+LM+EIAD+T +  AF +IM ++WKRLND GKNWRHVYK+L LLDYL+K G+ER+A++C +NI  I+TLKDFQY + + KD G+ +REKSK LV LLKD+E L  ER++ LK KE+     + +GS+Q        +P        +++ K    P +          SE+E            +LQ A+ +S+E  E+  ++R    R ++L++++ALE+S+++
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLR----RGDDLRLQMALEESRRD 258          
BLAST of Epsin 2 vs. Ensembl Human
Match: EPN1 (epsin 1 [Source:HGNC Symbol;Acc:HGNC:21604])

HSP 1 Score: 229.95 bits (585), Expect = 3.791e-65
Identity = 142/378 (37.57%), Postives = 205/378 (54.23%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEI--------EDD-ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSK-----KEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPL-----DFDPWKSPDNNFGSSKTPM--NTSTPDVWLNKDS 1173
            +RR++KN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK++ L++YL+K G+ER++++C +N++ ++TLKDFQY + + KD GV +REK+K LV LL+D++ L  ER+  LK KEK     ++  +     P     +   Q + + +     ++L    +K E         EDD +LQ A+ LS+EEH++  +IR    R ++L++++A+E+SK     KEE    +   V     P P         T             +  A+   D   G      V   +DPWG  A    S D   P        DPW       G +  P      TPD W + D 
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEEL---QLQLALAMSKEEADQPPSCGPEDDAQLQLALSLSREEHDKEERIR----RGDDLRLQMAIEESKRETGGKEESSLMDLADVFTAPAPAP---------TTDPWGGPAPMAAAVPTAAPTSDPWGGP----PVPPAADPWGGPAPTPASGDPWRPAAPAGPSVDPW-------GGTPAPAAGEGPTPDPWGSSDG 356          
BLAST of Epsin 2 vs. Ensembl Celegans
Match: epn-1 (EPsiN (Endocytic protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9BI72])

HSP 1 Score: 239.195 bits (609), Expect = 4.878e-70
Identity = 133/313 (42.49%), Postives = 195/313 (62.30%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEI---EDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGA 1035
            IRR+VKNV Y +S+A+  VREATSNDPWGPS+ LMSEIAD+T++  AF +IM ++WKRLND GKNWRHVYKSLVLLD+L+KCG+E++A++C +N+ TIETLKDFQ+ E+++D G+ IREK+K +  LL D E L NER++ +  + KF          +   PG +G E R+  +  +      +   +E+ +      E+ +LQ A+ LS+EE E+A ++R+ ++ R    +++ALE+S+K ++ DR     LA  +    VS  Q  ++ L      D L  L     +    N   SS      +DPWGA
Sbjct:    6 IRRQVKNVAYNFSDAQVKVREATSNDPWGPSTALMSEIADLTHNPMAFTEIMSIVWKRLNDSGKNWRHVYKSLVLLDFLIKCGHEKVAQQCRENVFTIETLKDFQHVEDNRDQGLNIREKAKQITSLLSDDERLKNERTRFILTRNKF----------KQNNPGPVGAESRR--SNRHHVTDASLDPEYEDARPSTATEEEMQLQIALALSREECEKADEMRKSDDAR----LQMALEESQKLQDADR-----LATTK-QGTVSSGQLTQSAL------DDLLSLG-VGELVSGNNDQPSSSSAWGMNDPWGA 289          
BLAST of Epsin 2 vs. Ensembl Celegans
Match: epn-1 (EPsiN (Endocytic protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9BI72])

HSP 1 Score: 234.958 bits (598), Expect = 1.273e-68
Identity = 133/313 (42.49%), Postives = 194/313 (61.98%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEI---EDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGA 1035
            IRR+VKNV Y +S+A+  VREATSNDPWGPS+ LMSEIAD+T++  AF +IM ++WKRLND GKNWRHVYKSLVLLD+L+KCG+E++A++C +N+ TIETLKDFQ+ E+++D G+ IREK+K +  LL D E L NER++ +  + KF          +   PG +G E R+  +  +      +   +E+ +      E+ +LQ A+ LS+EE E+A ++R+ ++ R    +++ALE+S+K+   DR     LA  +    VS  Q  ++ L      D L  L     +    N   SS      +DPWGA
Sbjct:    6 IRRQVKNVAYNFSDAQVKVREATSNDPWGPSTALMSEIADLTHNPMAFTEIMSIVWKRLNDSGKNWRHVYKSLVLLDFLIKCGHEKVAQQCRENVFTIETLKDFQHVEDNRDQGLNIREKAKQITSLLSDDERLKNERTRFILTRNKF----------KQNNPGPVGAESRR--SNRHHVTDASLDPEYEDARPSTATEEEMQLQIALALSREECEKADEMRKSDDAR----LQMALEESQKDA--DR-----LATTK-QGTVSSGQLTQSAL------DDLLSLG-VGELVSGNNDQPSSSSAWGMNDPWGA 287          
BLAST of Epsin 2 vs. Ensembl Celegans
Match: rsd-3 (pep chromosome:WBcel235:X:11798505:11803656:1 gene:WBGene00004682.1 transcript:C34E11.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rsd-3)

HSP 1 Score: 97.4413 bits (241), Expect = 6.537e-21
Identity = 51/145 (35.17%), Postives = 87/145 (60.00%), Query Frame = 1
Query:  103 EIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNS--YSAFDDIMQLIWKRLNDKGKN-WRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEE-HKDLGVGIREKSKALVILLKDKEILTNERSK 525
            ++   + + +  Y +A   VREAT+ DPWGP+   M +I + T S     F ++   +++R+ +  K+ WR VYKSL+LLDYL+K G+ER  +E  +  + +  L+ ++Y +E  KD G+ IR + K ++ ++ D E+L  ER K
Sbjct:   27 KVTESMNDAIMNYPKAMMDVREATNEDPWGPTGPQMKKICEYTRSRYMEDFYNVYTPLFQRMLENNKDAWRRVYKSLILLDYLLKNGSERFVQEAREKAYELRRLESYKYIDEKGKDQGINIRHRVKQILEMMNDDELLQAERQK 171          
BLAST of Epsin 2 vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0331833)

HSP 1 Score: 231.876 bits (590), Expect = 9.675e-66
Identity = 134/330 (40.61%), Postives = 197/330 (59.70%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD-ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPW 1092
            +RR +KN+ + YS+A+  VREATSNDPWGPS+ +MSEIA++T +  AF +IMQ+IWKRLND GKNWRHVYK+L+LL+YL+K G+E++A++C +NI  I+TL++F YFEE KD G  +REK+K LV LLKD E L NER K  K KE+F    S  GS  +   G   R++   + ++   P++V +L     ++  E++ +LQ A+ +S+EE E      Q+E +R    ++L L  S+ E++F   N + +    P PK  ++Q++   L       SL   S +S       G  +++      DPW        SQ S      DPW
Sbjct:    8 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSGFGSDGYID-GPSQRDLPPGWQEEP--PKSVSELEMVRPQTAGEEELQLQLAMAMSREEAE------QEEAKRRSDDVRLQLALSQSEQDFKDPNGRPI----PAPKKEEQQSHLLDLLDI----SLGATSISSPPLGAAGGAPTAV-----VDPWAMPGPRAPSQLS------DPW 309          
BLAST of Epsin 2 vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0331838)

HSP 1 Score: 231.876 bits (590), Expect = 9.675e-66
Identity = 134/330 (40.61%), Postives = 197/330 (59.70%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD-ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPW 1092
            +RR +KN+ + YS+A+  VREATSNDPWGPS+ +MSEIA++T +  AF +IMQ+IWKRLND GKNWRHVYK+L+LL+YL+K G+E++A++C +NI  I+TL++F YFEE KD G  +REK+K LV LLKD E L NER K  K KE+F    S  GS  +   G   R++   + ++   P++V +L     ++  E++ +LQ A+ +S+EE E      Q+E +R    ++L L  S+ E++F   N + +    P PK  ++Q++   L       SL   S +S       G  +++      DPW        SQ S      DPW
Sbjct:    8 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSGFGSDGYID-GPSQRDLPPGWQEEP--PKSVSELEMVRPQTAGEEELQLQLAMAMSREEAE------QEEAKRRSDDVRLQLALSQSEQDFKDPNGRPI----PAPKKEEQQSHLLDLLDI----SLGATSISSPPLGAAGGAPTAV-----VDPWAMPGPRAPSQLS------DPW 309          
BLAST of Epsin 2 vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0112941)

HSP 1 Score: 231.876 bits (590), Expect = 1.259e-65
Identity = 134/330 (40.61%), Postives = 197/330 (59.70%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD-ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPW 1092
            +RR +KN+ + YS+A+  VREATSNDPWGPS+ +MSEIA++T +  AF +IMQ+IWKRLND GKNWRHVYK+L+LL+YL+K G+E++A++C +NI  I+TL++F YFEE KD G  +REK+K LV LLKD E L NER K  K KE+F    S  GS  +   G   R++   + ++   P++V +L     ++  E++ +LQ A+ +S+EE E      Q+E +R    ++L L  S+ E++F   N + +    P PK  ++Q++   L       SL   S +S       G  +++      DPW        SQ S      DPW
Sbjct:    8 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSGFGSDGYID-GPSQRDLPPGWQEEP--PKSVSELEMVRPQTAGEEELQLQLAMAMSREEAE------QEEAKRRSDDVRLQLALSQSEQDFKDPNGRPI----PAPKKEEQQSHLLDLLDI----SLGATSISSPPLGAAGGAPTAV-----VDPWAMPGPRAPSQLS------DPW 309          
BLAST of Epsin 2 vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0331835)

HSP 1 Score: 231.876 bits (590), Expect = 1.275e-65
Identity = 144/366 (39.34%), Postives = 210/366 (57.38%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD-ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQ------DSSIPLDFDPW---KSPDNNFGSSKTPMNTSTP-----DVW 1158
            +RR +KN+ + YS+A+  VREATSNDPWGPS+ +MSEIA++T +  AF +IMQ+IWKRLND GKNWRHVYK+L+LL+YL+K G+E++A++C +NI  I+TL++F YFEE KD G  +REK+K LV LLKD E L NER K  K KE+F    S  GS  +   G   R++   + ++   P++V +L     ++  E++ +LQ A+ +S+EE E      Q+E +R    ++L L  S+ E++F   N + +    P PK  ++Q++   L       SL   S +S       G  +++      DPW        SQ       +S P   DPW    +P    G+   PM TS P     D W
Sbjct:   15 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSGFGSDGYID-GPSQRDLPPGWQEEP--PKSVSELEMVRPQTAGEEELQLQLAMAMSREEAE------QEEAKRRSDDVRLQLALSQSEQDFKDPNGRPI----PAPKKEEQQSHLLDLLDI----SLGATSISSPPLGAAGGAPTAV-----VDPWAMPGPRAPSQLSDPWSGTSSP-QVDPWNPSAAPRTILGAG-VPM-TSAPLGAGNDAW 355          
BLAST of Epsin 2 vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0331837)

HSP 1 Score: 232.261 bits (591), Expect = 8.951e-65
Identity = 134/330 (40.61%), Postives = 197/330 (59.70%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD-ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPW 1092
            +RR +KN+ + YS+A+  VREATSNDPWGPS+ +MSEIA++T +  AF +IMQ+IWKRLND GKNWRHVYK+L+LL+YL+K G+E++A++C +NI  I+TL++F YFEE KD G  +REK+K LV LLKD E L NER K  K KE+F    S  GS  +   G   R++   + ++   P++V +L     ++  E++ +LQ A+ +S+EE E      Q+E +R    ++L L  S+ E++F   N + +    P PK  ++Q++   L       SL   S +S       G  +++      DPW        SQ S      DPW
Sbjct:    8 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSGFGSDGYID-GPSQRDLPPGWQEEP--PKSVSELEMVRPQTAGEEELQLQLAMAMSREEAE------QEEAKRRSDDVRLQLALSQSEQDFKDPNGRPI----PAPKKEEQQSHLLDLLDI----SLGATSISSPPLGAAGGAPTAV-----VDPWAMPGPRAPSQLS------DPW 309          
BLAST of Epsin 2 vs. Ensembl Zebrafish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 238.039 bits (606), Expect = 3.111e-68
Identity = 147/359 (40.95%), Postives = 204/359 (56.82%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGE------LGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDS----LYKLSEASRIFDQQNGDLSSLDVDTKSDPWG-----ATATNVKSQD----SSIPLDFDPW 1092
            IRR++KNVV  YSE EK VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK+L LLDYL+K G+ER+A +C +NI  I+TLKDFQY + + KD G+ +REKSK LV+LLKD + L  ERS+ LK KE+     +S+GS+     G       L     +++ K    P +          SE+E            +LQ A+ +S+E  E+  ++R    R ++L++++ALE+S+K    D +  KV    + PP+ S     + +    A + +        + A    D      ++       DPWG     ++AT VKS D    SS P   DPW
Sbjct:    6 IRRQMKNVVNNYSEPEKKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERMAQVATSVGSNNQIGFGRGSSQPNLSTSYSEEYGKSEGSPASYHGSTSPNASSELEQARPQTSGEEELQLQLALAMSREAAEQEERMR----RGDDLRLQMALEESRK----DTSTGKVSKKKKEPPQSSLMDLMDAVPEGHANQGTDPWGAGAAAAAGPTSDPWQSYGAAPKPAAPVDPWGLPGASSSATPVKSTDPWGSSSAPAAADPW 356          
BLAST of Epsin 2 vs. Ensembl Zebrafish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 234.958 bits (598), Expect = 1.044e-67
Identity = 147/364 (40.38%), Postives = 202/364 (55.49%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGE------LGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWG-----ATATNVKSQD----SSIPLDFDPWKSPDNNFGS 1119
            IRR++KNVV  YSE EK VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK+L LLDYL+K G+ER+A +C +NI  I+TLKDFQY + + KD G+ +REKSK LV+LLKD + L  ERS+ LK KE+     +S+GS+     G       L     +++ K    P +          SE+E            +LQ A+ +S+E  E+  ++R    R ++L++++ALE+S+K    D +  KV            K+  E        +   + +S    ++ +      S       DPWG     ++AT VKS D    SS P   DPW       GS
Sbjct:    6 IRRQMKNVVNNYSEPEKKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERMAQVATSVGSNNQIGFGRGSSQPNLSTSYSEEYGKSEGSPASYHGSTSPNASSELEQARPQTSGEEELQLQLALAMSREAAEQEERMR----RGDDLRLQMALEESRK----DTSTGKV-----------SKKKKEV----GTDQTECFSVSVDLHLWPRST---FSPKPAAPVDPWGLPGASSSATPVKSTDPWGSSSAPAAADPWGPMPATLGS 343          
BLAST of Epsin 2 vs. Ensembl Zebrafish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 235.728 bits (600), Expect = 1.473e-67
Identity = 122/257 (47.47%), Postives = 168/257 (65.37%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGE------LGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKE 825
            IRR++KNVV  YSE EK VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK+L LLDYL+K G+ER+A +C +NI  I+TLKDFQY + + KD G+ +REKSK LV+LLKD + L  ERS+ LK KE+     +S+GS+     G       L     +++ K    P +          SE+E            +LQ A+ +S+E  E+  ++R    R ++L++++ALE+S+K+
Sbjct:    6 IRRQMKNVVNNYSEPEKKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERMAQVATSVGSNNQIGFGRGSSQPNLSTSYSEEYGKSEGSPASYHGSTSPNASSELEQARPQTSGEEELQLQLALAMSREAAEQEERMR----RGDDLRLQMALEESRKD 258          
BLAST of Epsin 2 vs. Ensembl Zebrafish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 227.254 bits (578), Expect = 5.573e-67
Identity = 128/278 (46.04%), Postives = 176/278 (63.31%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGE------LGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVS 888
            IRR++KNVV  YSE EK VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK+L LLDYL+K G+ER+A +C +NI  I+TLKDFQY + + KD G+ +REKSK LV+LLKD + L  ERS+ LK KE+     +S+GS+     G       L     +++ K    P +          SE+E            +LQ A+ +S+E  E+  ++R    R ++L++++ALE+S+K    D +  KV    + PP+ S
Sbjct:    6 IRRQMKNVVNNYSEPEKKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERMAQVATSVGSNNQIGFGRGSSQPNLSTSYSEEYGKSEGSPASYHGSTSPNASSELEQARPQTSGEEELQLQLALAMSREAAEQEERMR----RGDDLRLQMALEESRK----DTSTGKVSKKKKEPPQSS 275          
BLAST of Epsin 2 vs. Ensembl Zebrafish
Match: epn1 (epsin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2680])

HSP 1 Score: 231.106 bits (588), Expect = 3.344e-65
Identity = 140/380 (36.84%), Postives = 204/380 (53.68%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRT----------VMKLNFEE-----------TKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRD-SLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSR 1176
            +RR+VKN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM ++WKRLND GKNWRHVYK++ L++YL+K G+ER+A++C +NI+ ++TLKDFQY + + KD GV +REK+K LV LLKD+E L  ER   LK KEK     S+  +      G  G  +      D  +P++           + ++ EE           T   +ED E++ A+ +S+E H++  ++R    R ++L++++A+E+SK+E+                     K    +L+  SA           A        G  S+       DPWGAT+        + P   DPW       G+      T  PD W +  SR
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGVNVREKAKQLVTLLKDEERLREERIHALKTKEKMAQTSSASSAPSAPALG--GGGVHSGADSDQAWPQSSGEEDLQLQLALAMSKEEAEQKRPCCDKTTHDPLEDAEIRYALTISQETHQQEERLR----RGDDLRLQMAIEESKREKT--------------------KPEESSLMELSAADPWGAPATGSAGPSPPPALGPASTAGPWGPPDPWGATSP-------ASPPSADPWA------GAPA----TVAPDPWSDSSSR 342          
BLAST of Epsin 2 vs. Ensembl Xenopus
Match: uvssa (UV stimulated scaffold protein A [Source:Xenbase;Acc:XB-GENE-5833232])

HSP 1 Score: 238.81 bits (608), Expect = 5.154e-68
Identity = 144/366 (39.34%), Postives = 200/366 (54.64%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEE---RREELKIKLALEQSKKEEEFDRNNQKVLA----VLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPW-GATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTP------MNTSTPDVW 1158
            +RR++KN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK++ L++YL+K G+ER+A++C +NI+ I+TLKDFQY + + KD GV +REK+K LV LLKD E L  ER+  LK KEK     +S  +     P     +   Q + +                   E+ +LQ A+ +SKEE E   ++R  EE   R ++L++++A+E+SKKE    +  Q  L     V  PP  V             A     +  S A                   +DPW G  AT      S++P   DPW  P    G+S  P      +N+++ D W
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCKENIYAIQTLKDFQYVDRDGKDQGVNVREKAKQLVSLLKDDERLKEERAHALKTKEKLAQTSTSSSASSTLNPATEAEQAWPQSSGE-------------------EELQLQLALAMSKEEAE---QVRAKEERIRRGDDLRLQMAIEESKKEAPSKQEEQSSLMDLADVFSPPAPV-------------AASAGPWGASAAP-----------------PADPWAGGVAT------STLPAASDPWGGPPVATGASSDPWGTGAQINSTSADPW 313          
BLAST of Epsin 2 vs. Ensembl Xenopus
Match: uvssa (UV stimulated scaffold protein A [Source:Xenbase;Acc:XB-GENE-5833232])

HSP 1 Score: 238.039 bits (606), Expect = 9.873e-68
Identity = 206/629 (32.75%), Postives = 309/629 (49.13%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEI------------EDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLA----VLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPW-GATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTP------MNTSTPDVWLNKDSRQSKNI--VDDIF--GDEKPNTQFASN--WNFDVNGLTPSNQNKIIDSNPWEE----SDSSFGQLTKNTT-GSLASLTDIGNDLSREKKHSCSVTDLLD--------TNTSTNKKKTPQEFXXXXXXXXXXXXXXPIPKAGVYRDPMSHVAK--NPFGMTAS--AVVSNPF--NNQTINPKIPMNQIGNSNNSLFASSGNLTSMGINNGQMNSFT------TPMQPTFPISH-SQYQGFSTMNNFSNIP 1824
            +RR++KN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK++ L++YL+K G+ER+A++C +NI+ I+TLKDFQY + + KD GV +REK+K LV LLKD E L  ER+  LK KEK     +S  +     P     +   Q + + +     ++L    +K E             E+ +LQ A+ LSKEEH++  +IR    R ++L++++A+E+SKKE    +  Q  L     V  PP  V             A     +  S A                   +DPW G  AT      S++P   DPW  P    G+S  P      +N+++ D W    +  + ++  V D +  G     T   +N  W+       P  Q+    ++PW      SD   G  +K +T G++  L  +  ++   +       D  D        +++    +KTP+ FLG NA LV+L++        +   P    AK  NPF +T +  A  +NPF  N Q+    + +NQ+ +S   +      +T  G     +  FT      +PM P  PI++ +   G   M    N+P
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCKENIYAIQTLKDFQYVDRDGKDQGVNVREKAKQLVSLLKDDERLKEERAHALKTKEKLAQTSTSSSASSTLNPATEAEQAWPQSSGEEEL---QLQLALAMSKEEAEQVRAKPPAVSEEELQLQLALSLSKEEHDKEERIR----RGDDLRLQMAIEESKKEAPSKQEEQSSLMDLADVFSPPAPV-------------AASAGPWGASAAP-----------------PADPWAGGVAT------STLPAASDPWGGPPVATGASSDPWGTGAQINSTSADPWGGTQAVTTADVKAVSDPWNPGGSTATTGIPNNDPWSSS----PPVAQSVKKAADPWAPAASFSDPWGGSPSKPSTNGTMGELDLLAGEVPMSRSLGSKSPDTFDMTAMSGSLSDSCKPTRKTPESFLGPNAALVDLDS--------LISKPALQNAKTSNPFLVTGTPNATTTNPFQPNQQS---SLTLNQLRSS--PVMTLGQPVTPAGQTPATI-PFTSPMVSVSPMAPGIPIANVAPMVGMQPMAGVPNLP 573          
BLAST of Epsin 2 vs. Ensembl Xenopus
Match: uvssa (UV stimulated scaffold protein A [Source:Xenbase;Acc:XB-GENE-5833232])

HSP 1 Score: 234.572 bits (597), Expect = 3.333e-66
Identity = 147/375 (39.20%), Postives = 207/375 (55.20%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEI------------EDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLA----VLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPW-GATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTP------MNTSTPDVW 1158
            +RR++KN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK++ L++YL+K G+ER+A++C +NI+ I+TLKDFQY + + KD GV +REK+K LV LLKD E L  ER+  LK KEK     +S  +     P     +   Q + + +     ++L    +K E             E+ +LQ A+ LSKEEH++  +IR    R ++L++++A+E+SKKE    +  Q  L     V  PP  V             A     +  S A                   +DPW G  AT      S++P   DPW  P    G+S  P      +N+++ D W
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCKENIYAIQTLKDFQYVDRDGKDQGVNVREKAKQLVSLLKDDERLKEERAHALKTKEKLAQTSTSSSASSTLNPATEAEQAWPQSSGEEEL---QLQLALAMSKEEAEQVRAKPPAVSEEELQLQLALSLSKEEHDKEERIR----RGDDLRLQMAIEESKKEAPSKQEEQSSLMDLADVFSPPAPV-------------AASAGPWGASAAP-----------------PADPWAGGVAT------STLPAASDPWGGPPVATGASSDPWGTGAQINSTSADPW 337          
BLAST of Epsin 2 vs. Ensembl Xenopus
Match: epn2 (epsin2 [Source:NCBI gene;Acc:448609])

HSP 1 Score: 227.254 bits (578), Expect = 3.565e-64
Identity = 147/383 (38.38%), Postives = 205/383 (53.52%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGE------LGREIRKQ-FTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDT--KSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTP-DVWLNKDSRQSKNI 1191
            IRR++KN+V  YSEAE  VREATSNDPWGPSS+LM+EIAD+T +  AF +IM +IWKRLND GKNWRHVYK+L LLDYL+K G+ER++ +C +NI  I+TLKDFQY + + KD G+ +REKSK LV LLKD E L  ER++ LK KE+     + + S+     G       L     +Q + K    P +          SE+E            +LQ A+ +S+E  E+  +IR    R ++L++++ALE+S+K              ++ P K + +Q     L  +            S     Q  D  +  V T  KSDPW   A +        P   DPW+S    FGS      T+ P D W  K    ++++
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVSHQCKENIFAIQTLKDFQYMDRDGKDQGINVREKSKQLVCLLKDDERLKGERAQALKTKERMAQVATGVSSNNQITFGRGSSQPNLSTSYSEQDYGKSGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERIR----RGDDLRLQMALEESRKH------------TIKAPRKKAQQQTTLLDLLDALP----------SGAPAPQKPDTWAAAVATKSKSDPWNVAAVS--------PSSSDPWQS----FGSG---TKTAAPQDPWGGKAGPSTQSL 347          
BLAST of Epsin 2 vs. Ensembl Xenopus
Match: epn2 (epsin2 [Source:NCBI gene;Acc:448609])

HSP 1 Score: 224.557 bits (571), Expect = 3.045e-63
Identity = 148/390 (37.95%), Postives = 207/390 (53.08%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGE------LGREIRKQ-FTKDNQFPRT-------VMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDT--KSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTP-DVWLNKDSRQSKNI 1191
            IRR++KN+V  YSEAE  VREATSNDPWGPSS+LM+EIAD+T +  AF +IM +IWKRLND GKNWRHVYK+L LLDYL+K G+ER++ +C +NI  I+TLKDFQY + + KD G+ +REKSK LV LLKD E L  ER++ LK KE+     + + S+     G       L     +Q + K    P +       V+        SE+E            +LQ A+ +S+E  E+  +IR    R ++L++++ALE+S+K              ++ P K + +Q     L  +            S     Q  D  +  V T  KSDPW   A +        P   DPW+S    FGS      T+ P D W  K    ++++
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVSHQCKENIFAIQTLKDFQYMDRDGKDQGINVREKSKQLVCLLKDDERLKGERAQALKTKERMAQVATGVSSNNQITFGRGSSQPNLSTSYSEQDYGKSGGSPASYHGFMCNVLAATSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERIR----RGDDLRLQMALEESRKH------------TIKAPRKKAQQQTTLLDLLDALP----------SGAPAPQKPDTWAAAVATKSKSDPWNVAAVS--------PSSSDPWQS----FGSG---TKTAAPQDPWGGKAGPSTQSL 354          
BLAST of Epsin 2 vs. Ensembl Mouse
Match: Epn1 (epsin 1 [Source:MGI Symbol;Acc:MGI:1333763])

HSP 1 Score: 236.884 bits (603), Expect = 7.143e-68
Identity = 141/376 (37.50%), Postives = 208/376 (55.32%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEI--------EDD-ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKE----EEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPL-----DFDPWKSPDNNFGSSKTPM--NTSTPDVWLNKD 1170
            +RR++KN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK++ L++YL+K G+ER++++C +N++ ++TLKDFQY + + KD GV +REK+K LV LL+D++ L  ER+  LK KEK     ++  +     P     +   Q + + +     ++L    +K E         EDD +LQ A+ LS+EEH++  +IR    R ++L++++A+E+SK+E    EE    +   +     PP+ SD       +  +    +           D   G      V   +DPWG  A    S D   P        DPW       G +  P      TPD W + D
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEEL---QLQLALAMSKEEADQPPSCGPEDDVQLQLALSLSREEHDKEERIR----RGDDLRLQMAIEESKRETGGKEESSLMDLADVFTTPAPPQASDPWGGPASVPTAVPVAAAAS--------DPWGGPA----VPPAADPWGGAAPTPASGDPWRPAAPTGPSVDPW-------GGTPAPAAGEGPTPDPWGSSD 355          
BLAST of Epsin 2 vs. Ensembl Mouse
Match: Epn1 (epsin 1 [Source:MGI Symbol;Acc:MGI:1333763])

HSP 1 Score: 236.884 bits (603), Expect = 7.967e-68
Identity = 141/376 (37.50%), Postives = 208/376 (55.32%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEI--------EDD-ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKE----EEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPL-----DFDPWKSPDNNFGSSKTPM--NTSTPDVWLNKD 1170
            +RR++KN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK++ L++YL+K G+ER++++C +N++ ++TLKDFQY + + KD GV +REK+K LV LL+D++ L  ER+  LK KEK     ++  +     P     +   Q + + +     ++L    +K E         EDD +LQ A+ LS+EEH++  +IR    R ++L++++A+E+SK+E    EE    +   +     PP+ SD       +  +    +           D   G      V   +DPWG  A    S D   P        DPW       G +  P      TPD W + D
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEEL---QLQLALAMSKEEADQPPSCGPEDDVQLQLALSLSREEHDKEERIR----RGDDLRLQMAIEESKRETGGKEESSLMDLADVFTTPAPPQASDPWGGPASVPTAVPVAAAAS--------DPWGGPA----VPPAADPWGGAAPTPASGDPWRPAAPTGPSVDPW-------GGTPAPAAGEGPTPDPWGSSD 355          
BLAST of Epsin 2 vs. Ensembl Mouse
Match: Epn1 (epsin 1 [Source:MGI Symbol;Acc:MGI:1333763])

HSP 1 Score: 236.884 bits (603), Expect = 7.967e-68
Identity = 141/376 (37.50%), Postives = 208/376 (55.32%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEI--------EDD-ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKE----EEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPL-----DFDPWKSPDNNFGSSKTPM--NTSTPDVWLNKD 1170
            +RR++KN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK++ L++YL+K G+ER++++C +N++ ++TLKDFQY + + KD GV +REK+K LV LL+D++ L  ER+  LK KEK     ++  +     P     +   Q + + +     ++L    +K E         EDD +LQ A+ LS+EEH++  +IR    R ++L++++A+E+SK+E    EE    +   +     PP+ SD       +  +    +           D   G      V   +DPWG  A    S D   P        DPW       G +  P      TPD W + D
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEEL---QLQLALAMSKEEADQPPSCGPEDDVQLQLALSLSREEHDKEERIR----RGDDLRLQMAIEESKRETGGKEESSLMDLADVFTTPAPPQASDPWGGPASVPTAVPVAAAAS--------DPWGGPA----VPPAADPWGGAAPTPASGDPWRPAAPTGPSVDPW-------GGTPAPAAGEGPTPDPWGSSD 355          
BLAST of Epsin 2 vs. Ensembl Mouse
Match: Epn2 (epsin 2 [Source:MGI Symbol;Acc:MGI:1333766])

HSP 1 Score: 230.335 bits (586), Expect = 2.124e-65
Identity = 117/257 (45.53%), Postives = 168/257 (65.37%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQ------HRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKE 825
            IRR++KN+V  YSEAE  VREATSNDPWGPSS+LM+EIAD+T +  AF +IM ++WKRLND GKNWRHVYK+L LLDYL+K G+ER+A++C +NI  I+TLKDFQY + + KD G+ +REKSK LV LLKD+E L  ER + LK KE+     + +GS+Q        +P        +++ K    P +          SE+E            +LQ A+ +S+E  E+  ++R    R ++L++++ALE+S+++
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLR----RGDDLRLQMALEESRRD 258          
BLAST of Epsin 2 vs. Ensembl Mouse
Match: Epn2 (epsin 2 [Source:MGI Symbol;Acc:MGI:1333766])

HSP 1 Score: 229.95 bits (585), Expect = 2.528e-65
Identity = 117/257 (45.53%), Postives = 168/257 (65.37%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQ------HRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKE 825
            IRR++KN+V  YSEAE  VREATSNDPWGPSS+LM+EIAD+T +  AF +IM ++WKRLND GKNWRHVYK+L LLDYL+K G+ER+A++C +NI  I+TLKDFQY + + KD G+ +REKSK LV LLKD+E L  ER + LK KE+     + +GS+Q        +P        +++ K    P +          SE+E            +LQ A+ +S+E  E+  ++R    R ++L++++ALE+S+++
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLR----RGDDLRLQMALEESRRD 258          
BLAST of Epsin 2 vs. UniProt/SwissProt
Match: sp|Q80VP1|EPN1_MOUSE (Epsin-1 OS=Mus musculus OX=10090 GN=Epn1 PE=1 SV=3)

HSP 1 Score: 236.884 bits (603), Expect = 5.573e-67
Identity = 141/376 (37.50%), Postives = 208/376 (55.32%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEI--------EDD-ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKE----EEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPL-----DFDPWKSPDNNFGSSKTPM--NTSTPDVWLNKD 1170
            +RR++KN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK++ L++YL+K G+ER++++C +N++ ++TLKDFQY + + KD GV +REK+K LV LL+D++ L  ER+  LK KEK     ++  +     P     +   Q + + +     ++L    +K E         EDD +LQ A+ LS+EEH++  +IR    R ++L++++A+E+SK+E    EE    +   +     PP+ SD       +  +    +           D   G      V   +DPWG  A    S D   P        DPW       G +  P      TPD W + D
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEEL---QLQLALAMSKEEADQPPSCGPEDDVQLQLALSLSREEHDKEERIR----RGDDLRLQMAIEESKRETGGKEESSLMDLADVFTTPAPPQASDPWGGPASVPTAVPVAAAAS--------DPWGGPA----VPPAADPWGGAAPTPASGDPWRPAAPTGPSVDPW-------GGTPAPAAGEGPTPDPWGSSD 355          
BLAST of Epsin 2 vs. UniProt/SwissProt
Match: sp|Q9Z1Z3|EPN2_RAT (Epsin-2 OS=Rattus norvegicus OX=10116 GN=Epn2 PE=1 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.578e-64
Identity = 135/355 (38.03%), Postives = 196/355 (55.21%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQ------HRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQD------SSIPLDFDPWKSP 1101
            IRR++KN+V  YSEAE  VREATSNDPWGPSS+LM+EIAD+T +   F +IM ++WKRLND GKNWRHVYK+L LLDYL+K G+ER+A++C +NI  I+TLKDFQY + + KD G+ +REKSK LV LLKD+E L  ER + LK KE+     + +GS+Q        +P        +++ K    P +          SE+E            +LQ A+ +S+E  E+  ++R    R ++L++++ALE+S+++       ++V A  +P           TLL        L     +S    Q+    S+     +++PWG T       D      +      DPW  P
Sbjct:    6 IRRQMKNIVNSYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVRFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSISHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLR----RGDDLRLQMALEESRRDTVKVPKKKEVKACCKP----GSHSQQTTLL-------DLMDALPSSGPVAQKTEPWSTGTPANQTNPWGGTVAPANISDPWPSFGTKPAASVDPWGVP 345          
BLAST of Epsin 2 vs. UniProt/SwissProt
Match: sp|Q9Y6I3|EPN1_HUMAN (Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2)

HSP 1 Score: 229.95 bits (585), Expect = 1.820e-64
Identity = 142/378 (37.57%), Postives = 205/378 (54.23%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEI--------EDD-ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSK-----KEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPL-----DFDPWKSPDNNFGSSKTPM--NTSTPDVWLNKDS 1173
            +RR++KN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK++ L++YL+K G+ER++++C +N++ ++TLKDFQY + + KD GV +REK+K LV LL+D++ L  ER+  LK KEK     ++  +     P     +   Q + + +     ++L    +K E         EDD +LQ A+ LS+EEH++  +IR    R ++L++++A+E+SK     KEE    +   V     P P         T             +  A+   D   G      V   +DPWG  A    S D   P        DPW       G +  P      TPD W + D 
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEEL---QLQLALAMSKEEADQPPSCGPEDDAQLQLALSLSREEHDKEERIR----RGDDLRLQMAIEESKRETGGKEESSLMDLADVFTAPAPAP---------TTDPWGGPAPMAAAVPTAAPTSDPWGGP----PVPPAADPWGGPAPTPASGDPWRPAAPAGPSVDPW-------GGTPAPAAGEGPTPDPWGSSDG 356          
BLAST of Epsin 2 vs. UniProt/SwissProt
Match: sp|O88339|EPN1_RAT (Epsin-1 OS=Rattus norvegicus OX=10116 GN=Epn1 PE=1 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 3.222e-64
Identity = 114/250 (45.60%), Postives = 172/250 (68.80%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEI--------EDD-ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKE 825
            +RR++KN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK++ L++YL+K G+ER++++C +N++ ++TLKDFQY + + KD GV +REK+K LV LL+D++ L  ER+  LK KEK     ++  +     P     +   Q + + +     ++L    +K E         EDD +LQ A+ LS+EEH++  +IR    R ++L++++A+E+SK+E
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEEL---QLQLALAMSKEEADQPPSCGPEDDVQLQLALSLSREEHDKEERIR----RGDDLRLQMAIEESKRE 248          
BLAST of Epsin 2 vs. UniProt/SwissProt
Match: sp|Q8CHU3|EPN2_MOUSE (Epsin-2 OS=Mus musculus OX=10090 GN=Epn2 PE=1 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 6.926e-63
Identity = 118/265 (44.53%), Postives = 170/265 (64.15%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQ------HRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMK----IRQDEERR----EELKIKLALEQSKKE 825
            IRR++KN+V  YSEAE  VREATSNDPWGPSS+LM+EIAD+T +  AF +IM ++WKRLND GKNWRHVYK+L LLDYL+K G+ER+A++C +NI  I+TLKDFQY + + KD G+ +REKSK LV LLKD+E L  ER + LK KE+     + +GS+Q        +P        +++ K    P +          SE+E            +LQ A+ +S+E  E++ +     R  +E R    ++L++++ALE+S+++
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQSSESVQTARGSKEERLRRGDDLRLQMALEESRRD 270          
BLAST of Epsin 2 vs. TrEMBL
Match: V9KJM3 (Epsin-3-like protein OS=Callorhinchus milii OX=7868 GN=epn3 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 9.908e-71
Identity = 215/664 (32.38%), Postives = 336/664 (50.60%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELG----REIRKQFT------KDNQFPRTVMKLNFEE---TKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLA--------VLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDSNPWE-ESDSS------FGQLTKNTTGSL-ASLTDIGNDLS-REKKHSCSVTDLLDTNTSTN----------KKKTPQEFX-XXXXXXXXXXXXXPIPKAGVYRDPMSHVAKNPFGMTASAVVS---NPFNNQTINPKIPMNQI----GNSNNSLFASSGNLTSMGINNGQMNSFTTP---MQPTFPISHSQYQGFS--------------TMNNFSNIPWSQPVAPITNQWAI--NTNTANPFF 1893
            IRR+VKN+V+ YSEAE  VREATSNDPWGP S+LMS+IAD+T +  AF +IM ++WKRLND GKNWRHVYK+L LLDYL+K G+E+++++C +NI+T++TLKDFQY + + KD G+ +REK+K LV LLKD+E L  +R+  LK KE+     + +GSHQH  P         + RK         +D+         + E+   T S  E+ +LQ A+ +S+EE ER ++ R   +  EE+++++AL  SK++ E ++  +  L          LR   +  ++   E+ +S+     SL  L +   IF            +  +DPWGA    V +          PW   D +   + +P + ++PD W             D  G E P    A +W   ++  + +  ++  D +PW    D S      +  L   T+GS  A   D+ ++++   K++  S  D+ D     N           ++TP+ FL    A+LVNL++L+ IP       P S  +KNPF +T +A      NPF     N K+ +NQ+    G   +SL  S     ++G+ +G M   ++P   +  + P+S +    FS              T+N  S++P  QP+ P+T    +   +   NPF 
Sbjct:    6 IRRQVKNLVHNYSEAEIKVREATSNDPWGPPSSLMSDIADLTFNVVAFSEIMGMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSEKVSQQCRENIYTVQTLKDFQYIDRDGKDQGINVREKAKQLVSLLKDEERLRQDRAHALKTKERMSQAATGLGSHQHSHPSLASYTHPEDHRKSACASPISYQDSSSSSPRFDPDLEQARPTTSGEEELQLQLALAMSREEAERGLQ-RSPTDSEEEIQLQIALSLSKEQHEKEQRERSSLVDDDEDEDDTLR---RALEESRRESEMSQGKNESSLMDLVD---IFGA-----PVTGPEGHADPWGAELNGVSAPG-------HPWG--DKH---ATSPTSGTSPDPW-------------DSLGTEMPAPAVADSW---MSADSQAASSQPWDPDPWAGPPDPSQSPLDPWASLPTPTSGSQPAGKLDLLSEVAPSSKQNGTSSPDIFDMTGMGNCLQDSAKTNGTRRTPELFLDPNAASLVNLDSLLSIP-------PQSVKSKNPFHVTGAASAPSAINPFQVSDRN-KLTLNQMQISSGLGQDSLTQSG----TVGLASGSMPFMSSPPMALNSSMPVSLTLPPTFSGLAQLGGMAPNMGTTVNMTSSLP--QPLMPVTQPAHVPQASGQLNPFL 615          
BLAST of Epsin 2 vs. TrEMBL
Match: A0A2A2KJI6 (ENTH domain-containing protein OS=Diploscapter pachys OX=2018661 GN=WR25_00488 PE=4 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.833e-70
Identity = 148/339 (43.66%), Postives = 203/339 (59.88%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDE---LQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNF 1113
            IRR+VKNV Y +S+A+  VREATSNDPWGPS+ LMSEIAD+TN+  AF +IM ++WKRLND GKNWRHVYKSLVLLD+L+KCGNE++A++C +NI TIETLKDFQ+ EE++D G+ IREK+K +V LL D+E L NER++ +  + KF+    S  S      G  G   R +   D+      +   FEE +   + +E   LQ A+ LS+EEHE+  ++R    + +E++++LALE+S+KE E            +P   V   Q     LS+SA  D L  L     + +    D  S      S  WG    N  +  SS+    DPW +P   F
Sbjct:    6 IRRQVKNVAYNFSDAQVKVREATSNDPWGPSTALMSEIADLTNNPMAFTEIMSIVWKRLNDSGKNWRHVYKSLVLLDFLIKCGNEKVAQQCRENIFTIETLKDFQHIEENRDQGLNIREKAKQIVSLLSDEERLKNERTRFMLTRNKFKQNYPSSYSDSVGAVGSSGSRHRSRI--DHPTSGASLDPEFEEARPANQTEEEMQLQIALALSREEHEKMDEMR----KSDEVRLQLALEESRKEAE--------KMATQPQGTVHSGQ-----LSQSA-LDDLLSLG-VGELINNTPADQPS------SSAWG---NNSNAGSSSMGGLIDPWATPTQPF 314          
BLAST of Epsin 2 vs. TrEMBL
Match: A0A1I7TMY2 (ENTH domain-containing protein OS=Caenorhabditis tropicalis OX=1561998 PE=4 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.293e-69
Identity = 140/335 (41.79%), Postives = 205/335 (61.19%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEI---EDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVK-SQDSSIPLDFDPWKS 1098
            IRR+VKNV Y +S+A+  VREATSNDPWGPS+ LMSEIAD+T++  AF +IM ++WKRLND GKNWRHVYKSLVLLD+L+KCG+E++A++C +N+ TIETLKDFQ+ E+++D G+ IREK+K +  LL D E L NER++ +  + KF          +   PG +G E R+  +  +    T +   +EE +      E+ +LQ A+ LS+EE E+A ++R+ ++ R    +++ALE+S+K +E DR     LA  +    VS  Q  ++ L      D L  L     +    +   SS   +  +DPWG   ++ + S D       DPW S
Sbjct:    6 IRRQVKNVAYNFSDAQVKVREATSNDPWGPSTALMSEIADLTHNPMAFTEIMSIVWKRLNDSGKNWRHVYKSLVLLDFLIKCGHEKVAQQCRENVFTIETLKDFQHVEDNRDQGLNIREKAKQITSLLSDDERLKNERTRFILTRNKF----------KQNNPGAVGAESRR--SNRHHVSDTSLDPEYEEARPSTATEEEMQLQIALALSREECEKADEMRKSDDAR----LQMALEESQKLQEADR-----LATTK-QGTVSSGQLTQSAL------DDLLSLGVGELVSGNSDQPSSSTAWNNMADPWGVPQSSAQHSNDQMFSSTNDPWAS 312          
BLAST of Epsin 2 vs. TrEMBL
Match: A0A0P4WAE4 (ENTH domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.333e-68
Identity = 181/510 (35.49%), Postives = 261/510 (51.18%), Query Frame = 1
Query:   94 LQME---IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIE--------DDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDR-NNQKVLAVLRPPPKVS-----DKQNNETLLSKSAKRDSL------YKLSEASRIFDQ--QNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDSNPWE-------ESDSSFGQLTKNTTGSLASLTDIGNDLSREKKH-------------SCSVTDLLDTNTS---TNKKKTPQEF 1479
            LQM    IRR +KN+ + Y++A+  VREATSNDPWGPSSTLMSE+AD+T +  AF +IMQ+IWKRLND G+NWRHVYK+LVLL+YL+K G+E++A++C +NI  IETLKDFQYFEE+KD G+ +REK+KALV LLKD+E L NER + LK KE+F    S IGS                F      P        ++  SE+E        ++ELQ  ++L+    +   +  + ++R +++++++A+ QS  EE+F+  N         PP  V+        +N T  + SA             L++A+R  D    NG++    +D  +DPWG    N  S+  + P   DPW SP +   S  T  +  T D W    +R  +  +  I G++           + V G  P  +      +PWE        S   F  LT      +   T +    +REK               S SVTD+  T+T+     K K+P  F
Sbjct:    3 LQMNVSGIRRNLKNIAHNYTDAQIKVREATSNDPWGPSSTLMSEVADLTYNVVAFTEIMQMIWKRLNDHGRNWRHVYKALVLLEYLIKTGSEKVADQCKENIFAIETLKDFQYFEENKDQGMNVREKAKALVTLLKDEERLRNERVRALKAKERFAQSVSGIGSDSDIS-SPTSPTYHDTFVTSTSRPSERNAFGIKDGPSELEAARPQTVGEEELQ--LQLALAMSKEEAEQEEQKKRSDDVRLQMAITQS--EEDFNGVNGGGARPASTPPSTVTLDPWGMPTSNATASATSASPQHTAHIKQNLNLAQATRSLDDLFSNGNI----MDGLTDPWGMALPNGGSETPNQP---DPWGSPVSGPPSRMT--SPPTTDPW--APARSPEPPMGGICGNDP----------WAVLGSVPPAK------DPWEPVENKPPPSRDPFSPLTPTDNRDMDEFTALS---TREKPTNNGSSDAFDLSGLSASVTDITSTSTTKAPPQKSKSPAAF 477          
BLAST of Epsin 2 vs. TrEMBL
Match: A0A267GT68 (ENTH domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003183g1 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 4.164e-68
Identity = 152/375 (40.53%), Postives = 198/375 (52.80%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELG-REIRKQFTKD--NQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDS----RQSKNIVDDIFG 1209
            IRR +KNVV+ YS+A+  VREATSNDPWGPSSTLM+EIA+MT +  A+ +IM LIWKRLNDK KNWRHVYK+LVLLDYLVK G+E++A++C +N+  I++L+DFQY EE KD G  +REK+K LV LLKD E L  ER+  L+ +E+        G       G    R    ++  D      R              ED EL+ A+ +SKEEH   +K R+ E  +E+LK+K+ALE SKKEEE DR                          KS     L  L + S      NG           DPWGA A  + +   S     DPW +P  +  S+    N +  D W    +    +      DD FG
Sbjct:    4 IRRNIKNVVHNYSDAKVKVREATSNDPWGPSSTLMAEIAEMTYNVMAYTEIMSLIWKRLNDKNKNWRHVYKALVLLDYLVKTGSEKVAQQCKENLFVIQSLRDFQYTEEAKDYGQNVREKAKQLVALLKDDEKLRTERASALRTRERLHASGMIGGGRPTVSSGATAYRRASAEYASDRTGSSVRGAPGGGGGGGGVGEEDVELELALAISKEEHAEELKRREAEGLKEDLKLKMALEASKKEEE-DRK-------------------------KSVSSGGLVDLIDTSLSAAPSNG----------RDPWGAPAAPLAASAWS-----DPWSAPHESASSAAPVSNPTASDPWAFSATPSQPQAGGGTFDDAFG 337          
BLAST of Epsin 2 vs. Ensembl Cavefish
Match: epn1 (epsin-1-like [Source:NCBI gene;Acc:103024066])

HSP 1 Score: 228.409 bits (581), Expect = 2.262e-64
Identity = 120/242 (49.59%), Postives = 169/242 (69.83%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEE 828
            +RR+VKN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM ++WKRLND GKNWRHVYK++ L++YL+K G+ER+A++C +NI+ ++TLKDFQY + + KD GV +REK+K LV LLKD+E L  ER   LK KEK    Q+S  S     PG  G  +      D  +P++          S  ED +LQ A+ +SKEE E+  ++R    R ++L++++A+E+SK+E+
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGVNVREKAKQLVTLLKDEERLREERIHALKTKEKM--AQTSSASSAPSAPGLGG--VSSSTDGDQAWPQS----------SGEEDLQLQLALAMSKEEAEQEERLR----RGDDLRLQMAIEESKREK 229          
BLAST of Epsin 2 vs. Ensembl Cavefish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 222.246 bits (565), Expect = 5.713e-63
Identity = 116/244 (47.54%), Postives = 157/244 (64.34%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRT-VMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEE 831
            IRR++KNVV  YSEAEK VREATSNDPWGPSS+LMSEI+D+T +  AF +IM +IWKRLND GKNWRHVYK+L LLDYL+K G+ER+A +C +NI  I+TLKDFQY + + KD G+ +REKSK LV+LLKD + L  ERS+ LK KE+     +S+GS+     G    +     +   ++ R+     ++  + S     EL++A              R      EEL+++LAL  S++  E
Sbjct:    6 IRRQMKNVVNNYSEAEKKVREATSNDPWGPSSSLMSEISDLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERMAQVATSVGSNHQINFGRGSSQPNLSTSYSEEYGRSEGSPASYHGSTSPNASSELEQA--------------RPQTSGEEELQLQLALAMSREAAE 235          
BLAST of Epsin 2 vs. Ensembl Cavefish
Match: epn3b (epsin-3-like [Source:NCBI gene;Acc:103023012])

HSP 1 Score: 216.083 bits (549), Expect = 2.593e-60
Identity = 140/378 (37.04%), Postives = 202/378 (53.44%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIE-----LSKEEHERAMKIRQDEER---REELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSK---SAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQD---------SSIPLDFDPWK------SPDNNFGSSKTPMNTSTPDVW 1158
            +RR+VKN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T S  AF ++M ++WKRLND GKNWRHVYK+L LLDYL K G+ER+A++C +N  TI+TL+DFQY + + +D GV +REK+K LV LL+D+E L  ER++ LK KE+        G                       +P    + + + + + +  +E  R+ E      S     RA ++ Q   +    EEL+++LAL  S++E+                     +Q ++T L K    ++R+S     E+S + D  +    S +     DPW A  T   + D         SS P+   PW       SP + +G+S+TP     PD W
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTFSVVAFSEVMAMVWKRLNDHGKNWRHVYKALTLLDYLAKTGSERVAQQCRENAFTIQTLRDFQYVDRDGRDQGVNVREKAKQLVALLRDEERLRQERAQALKTKERMAGGGGGGGG----------GGGGTGGGGGGAYPS---RRSSQPSMAALYGEEFSRSRESPSSFNSSASSPRASELEQSRPQTSGEEELQLQLALAMSREEQR-------------------SRQGDDTHLQKVLEQSRRESESGQGESS-MLDLVDIFGPSTEAPPSDDPWDAQPTCPMTSDPWETVAVVKSSTPVVGSPWTARPSSGSPSHPWGNSQTP-----PDPW 345          
BLAST of Epsin 2 vs. Ensembl Cavefish
Match: epn3a (epsin 3 [Source:NCBI gene;Acc:103029089])

HSP 1 Score: 207.223 bits (526), Expect = 5.401e-57
Identity = 132/383 (34.46%), Postives = 201/383 (52.48%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRT--------------VMKLNFEETKSEIEDDE---LQRAIELSKEEHERAMKIRQDEERR------------------EELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSS---------IPLDFDPWKSPDNNFGS 1119
            +RR VKN+V  Y+EAE  VREATSNDPWGP S+LM EIAD+T +  AF ++M ++WKRLND GKNWRHVYK+L LL+YL+K G+ER+A++C +NI+ I+TL+DFQY + + +D GV +REK+K LV LL+D++ L  ERS+  K +E+      + GS     PG+            +++ R+               +  + E+ + +   +E   LQ A+ +S+EE E   K+R  + R                   E+ ++++AL  SK+E + ++ +               +Q +E+LL K+        L E+ R  + + G  + LD+     P       V   D S          PL  DPW S D +  S
Sbjct:    6 LRRSVKNIVNNYTEAEIKVREATSNDPWGPPSSLMMEIADLTFNVVAFTEVMGMVWKRLNDHGKNWRHVYKALTLLEYLLKAGSERVAQQCRENIYAIQTLRDFQYIDRDGQDQGVNVREKAKQLVSLLRDEDRLKQERSQAHKTRERMAG---AYGSLPPPYPGQRTSHATAATMHGDEYRRSRGSPSSHTSSSSSPHLAPDLEQARPQTSGEEELQLQLALAMSREESE---KVRIPDSRATTTPVKKVPPPSVALDMDEDTQLQIALSLSKEEHQQEQRS---------------RQGDESLLQKA--------LEESKREMEAKGGGSAMLDLVDIFAPAPEAPPGVSPWDLSGAGAQAQAAGPLRSDPWDSLDPSSSS 359          
BLAST of Epsin 2 vs. Ensembl Cavefish
Match: epn3a (epsin 3 [Source:NCBI gene;Acc:103029089])

HSP 1 Score: 205.682 bits (522), Expect = 2.642e-56
Identity = 137/403 (34.00%), Postives = 206/403 (51.12%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRT--------------VMKLNFEETKSEIEDDE---LQRAIELSKEEHERAMKIRQDEERR-------------EELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVS-------------------------DKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSS---------IPLDFDPWKSPDNNFGS 1119
            +RR VKN+V  Y+EAE  VREATSNDPWGP S+LM EIAD+T +  AF ++M ++WKRLND GKNWRHVYK+L LL+YL+K G+ER+A++C +NI+ I+TL+DFQY + + +D GV +REK+K LV LL+D++ L  ERS+  K +E+      + GS     PG+            +++ R+               +  + E+ + +   +E   LQ A+ +S+EE E   K+R  + R              E+ ++++A+  SK+E +     +KV     PPP V+                          +Q +E+LL K+        L E+ R  + + G  + LD+     P       V   D S          PL  DPW S D +  S
Sbjct:    6 LRRSVKNIVNNYTEAEIKVREATSNDPWGPPSSLMMEIADLTFNVVAFTEVMGMVWKRLNDHGKNWRHVYKALTLLEYLLKAGSERVAQQCRENIYAIQTLRDFQYIDRDGQDQGVNVREKAKQLVSLLRDEDRLKQERSQAHKTRERMAG---AYGSLPPPYPGQRTSHATAATMHGDEYRRSRGSPSSHTSSSSSPHLAPDLEQARPQTSGEEELQLQLALAMSREESE---KVRIPDSRATTTPVKPPPVDVDEQTQLQIAMSLSKEESQ-----KKV-----PPPSVALDMDEDTQLQIALSLSKEEHQQEQRSRQGDESLLQKA--------LEESKREMEAKGGGSAMLDLVDIFAPAPEAPPGVSPWDLSGAGAQAQAAGPLRSDPWDSLDPSSSS 384          
BLAST of Epsin 2 vs. Ensembl Sea Lamprey
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 231.106 bits (588), Expect = 1.759e-66
Identity = 136/346 (39.31%), Postives = 194/346 (56.07%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGE------LGREIRKQFTKDNQFPRTV-------MKLNFEETKSEIEDDE---LQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPW 1092
            +RR++KN+V  +SEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM +IWKRLND GKNWRHVYK+L LLDYL+K G+ER+A++C +NI  I+TLKDFQY + + KD GV +REKSK LV LL+D++ L  ER   LK KE+     + +GS+     G       L      ++ K    P +        M    E+ + +   +E   LQ A+ +S+EE E+  ++R    R ++L++++ALE+SK+                   K++ K+  E    + +++ SL  L +A R    Q            +DPWG T           P   DPW
Sbjct:    6 LRRQMKNIVNNFSEAEVKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCKENIFAIQTLKDFQYVDRDGKDQGVNVREKSKQLVALLRDEDRLRGEREHALKTKERLAQGATGMGSNNKVTFGRGSSQPNLSTSYSDEYGKAGGSPASYHGYTSQHMSTQLEQARPQTSGEEELQLQLALAMSREEAEQEERMR----RGDDLRLQMALEESKRA------------------KLAAKK-EEVCACRHSRQSSLLDLVDAFRPTVPQ----------PSADPWGVTPPP--------PAQADPW 310          
BLAST of Epsin 2 vs. Ensembl Sea Lamprey
Match: clint1a (clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2590])

HSP 1 Score: 108.612 bits (270), Expect = 1.178e-24
Identity = 57/144 (39.58%), Postives = 93/144 (64.58%), Query Frame = 1
Query:  124 NVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKR-LNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEH-KDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKF 549
            N+V  Y+E E  VREAT+++PWGPS  LM EIA  T  Y  F ++M ++W R L +   NWR  YK L+LL YL++ G+ER+     ++++ + +L+D+ + +E+ KD GV +R+K K ++  ++D E +  ER K  K ++K+
Sbjct:   15 NIVMNYTEMEAKVREATNDEPWGPSGKLMGEIAKATFMYELFPEVMNMLWARMLRENKNNWRRAYKGLLLLTYLLRNGSERVVTSAREHLYDLRSLEDYHFVDENGKDQGVNVRQKVKEMIDFVQDDERVREERKKAKKHRDKY 158          
BLAST of Epsin 2 vs. Ensembl Yeast
Match: ENT3 (Protein containing an N-terminal epsin-like domain; involved in clathrin recruitment and traffic between the Golgi and endosomes; associates with the clathrin adaptor Gga2p [Source:SGD;Acc:S000003886])

HSP 1 Score: 126.331 bits (316), Expect = 1.345e-31
Identity = 61/149 (40.94%), Postives = 98/149 (65.77%), Query Frame = 1
Query:  112 RKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDK-GKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQ 552
            RK +NVV+ Y+E E  VREAT+N+PWG SSTLM +I+  T ++   ++I+ +I++R  +K G  WR +YK+L LLDYL+K G+ER  ++   +I+ I  L+ F Y + + +D G+ +R + KAL+ LL D   +  ER K  +  +K++
Sbjct:   20 RKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGINVRTRVKALIELLSDDNKIRAERKKARETAKKYK 168          
BLAST of Epsin 2 vs. Ensembl Yeast
Match: ENT2 (Epsin-like protein required for endocytosis and actin patch assembly; functionally redundant with Ent1p; contains clathrin-binding motif at C-terminus; ENT2 has a paralog, ENT1, that arose from the whole genome duplication [Source:SGD;Acc:S000004196])

HSP 1 Score: 111.309 bits (277), Expect = 7.291e-26
Identity = 62/138 (44.93%), Postives = 86/138 (62.32%), Query Frame = 1
Query:  112 RKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHK-DLGVGIREKSKALVILLKDKEILTNERS 522
            R  KN++  YS  +  VR+AT+ND   PS   + ++A  +     F +IM ++ KRLNDKGK WRHV KSL +LDYLV+ G+E     C +N + I+TL++F++  E   D G  IR K+K LV LL D+E L  ERS
Sbjct:    7 RSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKELVSLLNDEERLREERS 144          
BLAST of Epsin 2 vs. Ensembl Yeast
Match: ENT1 (Epsin-like protein involved in endocytosis and actin patch assembly; functionally redundant with Ent2p; binds clathrin via a clathrin-binding domain motif at C-terminus; relocalizes from bud neck to cytoplasm upon DNA replication stress; ENT1 has a paralog, ENT2, that arose from the whole genome duplication [Source:SGD;Acc:S000002320])

HSP 1 Score: 108.227 bits (269), Expect = 2.727e-25
Identity = 84/247 (34.01%), Postives = 125/247 (50.61%), Query Frame = 1
Query:  112 RKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYF-EEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAI---ELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDR 840
            R  KN+V  YS  +  VR ATSND    S   + E+A+ +   + F +IM ++ KRLNDKGK WRH+ K+L ++DYL++ G+E     C +N++ I+TLK+F++  +E  D G  +R K+K L  LL D E L  ER+  +K + +   ++                                        +S+  DD+LQRAI    L+ EE ER  K  QDE+       + AL+ SK+EEE  R
Sbjct:    7 RSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRG------------------------------------TGRSDENDDDLQRAISASRLTAEEDERRRK--QDED------YETALQLSKEEEELKR 209          
BLAST of Epsin 2 vs. Ensembl Yeast
Match: ENT4 (Protein of unknown function; contains an N-terminal epsin-like domain; proposed to be involved in the trafficking of Arn1p in the absence of ferrichrome [Source:SGD;Acc:S000003961])

HSP 1 Score: 52.373 bits (124), Expect = 7.570e-8
Identity = 35/103 (33.98%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  133 YKYSEAEKYVREATSND-PWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRL------NDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQ 420
            +  S  E  V++AT+ D   G + TLM+EI+ +T S     +I+Q+I KRL       +  +N   V K+L L+ YL+  G+    +    N+  IE L+DFQ
Sbjct:   10 FIQSPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRNCIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQ 112          
BLAST of Epsin 2 vs. Ensembl Yeast
Match: ENT5 (Protein containing an N-terminal epsin-like domain; involved in clathrin recruitment and traffic between the Golgi and endosomes; associates with the clathrin adaptor Gga2p, clathrin adaptor complex AP-1, and clathrin [Source:SGD;Acc:S000002560])

HSP 1 Score: 50.0618 bits (118), Expect = 9.900e-7
Identity = 51/187 (27.27%), Postives = 84/187 (44.92%), Query Frame = 1
Query:  112 RKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIM-QLIWKRLNDK-------------------GKNWRHVYKSLVLLDYL---VKCGNE-RIAEECLQNIHTIETLKDFQY---FEEHKDLGV---GIREKSKALVILLKDKEILTNERSK----GLKVKEKFQNKQSSI 570
            R  +NV+ +Y   +  +R AT+ D WGP+   ++++  + N Y     +M +   KRL D                    G  WR V K LV++++L   V  G+E      CL     I T +  Q+   F     + +   GIR+K + ++  L+D + L  ER+K     LK++   Q  +SSI
Sbjct:   21 RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKV--LRNRYQVPLYLMTEYTLKRLVDHIATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLLLNVDTGDELNQIRSCLLTHKHILTREIAQFKVKFSNDGKMEIHERGIRKKGELILQYLEDSQFLKKERAKNKKNALKIR---QQGESSI 202          
BLAST of Epsin 2 vs. Ensembl Nematostella
Match: EDO36992 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH59])

HSP 1 Score: 205.297 bits (521), Expect = 5.899e-62
Identity = 97/156 (62.18%), Postives = 123/156 (78.85%), Query Frame = 1
Query:  100 MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQS 564
            M IRR++KNVV  YS +E  VREATSNDPWGPSS+LMSEIAD T +  AF +IM +IW+RLND GKNWRHVYKSLVLLDY++K G+ER+A++C +NI  I+TLKDFQ+ + + KD G+ +REK+K LV LLKD+E L +ER + LK KE+F    S
Sbjct:    1 MSIRRQLKNVVNNYSNSEVKVREATSNDPWGPSSSLMSEIADATYNVVAFSEIMAMIWRRLNDHGKNWRHVYKSLVLLDYIIKTGSERVAQQCRENIFVIQTLKDFQFIDKDGKDQGMNVREKAKQLVALLKDEERLKSERQRALKAKERFAQASS 156          
BLAST of Epsin 2 vs. Ensembl Nematostella
Match: EDO48788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIC8])

HSP 1 Score: 110.153 bits (274), Expect = 8.097e-28
Identity = 64/151 (42.38%), Postives = 99/151 (65.56%), Query Frame = 1
Query:  103 EIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKR-LNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEH-KDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKF 549
            EI  KV NVV  YSE E  VREAT++D WGP  +LM EIA  T +Y  F ++M ++WKR L +  K WR +YKSL+LL YL+K G++R+      +I+ +  L++F + +E+ KD G+ +R K K L+ L++D + + +ER +  K ++K+
Sbjct:    9 EISDKVTNVVMNYSEVEAKVREATNDDTWGPHGSLMQEIAKYTFTYEHFPEVMSMLWKRMLQEPKKYWRRIYKSLLLLGYLLKNGSDRVVTNARDHIYDMRQLENFHHTDENGKDQGINVRHKVKELIELVQDDDRIRSERKRAKKNRDKY 159          
BLAST of Epsin 2 vs. Ensembl Medaka
Match: epn2 (epsin 2 [Source:NCBI gene;Acc:101161060])

HSP 1 Score: 232.646 bits (592), Expect = 1.920e-66
Identity = 125/257 (48.64%), Postives = 170/257 (66.15%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQ------HRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDD----------ELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKE 825
            IRR++KN+V  YS+AEK VREATSNDPWGPSS+LMSE+AD+T +  AF +IM +IWKRLND GKNWRHVYK+L LLDYL+K G+ER+A +C +NI  I+TLKDFQY + + KD G+ +REKSK LV+LLKD+E L  ERS+ LK KE+    Q S GS Q        +P  L     +++ +    P +          SE+E            +LQ A+ +S+E  E+  +IR    R ++L++++ALE+SKKE
Sbjct:    5 IRRQMKNMVNNYSDAEKKVREATSNDPWGPSSSLMSEVADLTYNVVAFSEIMNMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYVDRDGKDQGINVREKSKQLVVLLKDEERLKAERSQALKTKERM--AQVSTGSSQMGFGRGSSQP-NLSTSYSEEYGRSEGSPASYHGSTSPNAGSELEQARPQTSGEEELQLQLALAMSREAAEQEERIR----RGDDLRLQMALEESKKE 254          
BLAST of Epsin 2 vs. Ensembl Medaka
Match: epn1 (epsin-1 [Source:NCBI gene;Acc:101167232])

HSP 1 Score: 233.032 bits (593), Expect = 6.260e-66
Identity = 140/363 (38.57%), Postives = 198/363 (54.55%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQ--FPRTV------MKLNFEETKSE--------IEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEE------------EFDRNNQKVLAVLR-----PPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPW 1092
            +RR+VKN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM ++WKRLND GKNWRHVYK++ L++YL+K G+ER+A++C +NI+ ++TLKDFQY + + KD G+ +REK+K LV LLKD+E L  ER   LK KEK     S+  +      G            D +  +P++       ++L    +K E        +ED EL  AI LSKE H++  ++R    R ++L++++A+E+SKKE+              D       A +      PPP V     +    + +A  D     S  S       G      V    DPWG T+  V         + DPW
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGLNVREKAKQLVTLLKDEEKLREERIHALKTKEKMAQTSSASSAPSAPSLGGSLSLGSHSGGADPEQAWPQSSGEEDLQLQLALAMSKEEAEQTSTDPLEDAELHYAITLSKEIHQKEERLR----RGDDLRLQMAIEESKKEKPKPEESALMELSAVDPWGAPATATVASAGPSPPPTVPGSAASNPW-APAASTDPWGVTSPTSPTSSDPWGGGPQPTVAPPPDPWGETSNKVN--------NVDPW 355          
BLAST of Epsin 2 vs. Ensembl Medaka
Match: epn1 (epsin-1 [Source:NCBI gene;Acc:101167232])

HSP 1 Score: 230.72 bits (587), Expect = 2.616e-65
Identity = 136/347 (39.19%), Postives = 192/347 (55.33%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEE------------EFDRNNQKVLAVLR-----PPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPW 1092
            +RR+VKN+V+ YSEAE  VREATSNDPWGPSS+LMSEIAD+T +  AF +IM ++WKRLND GKNWRHVYK++ L++YL+K G+ER+A++C +NI+ ++TLKDFQY + + KD G+ +REK+K LV LLKD+E L  ER   LK KEK     S+  +      G            D +         + ++  E ED +LQ A+ +SKEE E+  ++R    R ++L++++A+E+SKKE+              D       A +      PPP V     +    + +A  D     S  S       G      V    DPWG T+  V         + DPW
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGLNVREKAKQLVTLLKDEEKLREERIHALKTKEKMAQTSSASSAPSAPSLGGSLSLGSHSGGADPE-------QAWPQSSGE-EDLQLQLALAMSKEEAEQEERLR----RGDDLRLQMAIEESKKEKPKPEESALMELSAVDPWGAPATATVASAGPSPPPTVPGSAASNPW-APAASTDPWGVTSPTSPTSSDPWGGGPQPTVAPPPDPWGETSNKVN--------NVDPW 331          
BLAST of Epsin 2 vs. Ensembl Medaka
Match: epn3a (epsin-1 [Source:NCBI gene;Acc:101168623])

HSP 1 Score: 196.052 bits (497), Expect = 3.334e-53
Identity = 102/219 (46.58%), Postives = 137/219 (62.56%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKI 759
            IRR++KN V+ Y++AE  VREAT NDPWGP  +LMSEI+D+T +  AF DIM++IWKRLND GKNWRHV+K+LVLL++LVK G+ER+ + C +NIH+I+TLKDFQY + +  D G  +REK+K L  LL+D+E L  ERS  LK K +     S +                        +P T  +L      SEIE     +A+  S EE ER +K+
Sbjct:    6 IRRQMKNAVHSYTDAEIKVREATCNDPWGPPVSLMSEISDLTFNVVAFADIMRIIWKRLNDNGKNWRHVFKALVLLEHLVKTGSERVVKACKENIHSIQTLKDFQYIDRDGHDQGATVREKAKRLASLLRDEEKLKKERSHALKSKSRVAGLPSPLDRSMSSS--------SFDSDLPPSYPSTPSRL-----PSEIE-----KALPTSAEEEERQLKL 206          
BLAST of Epsin 2 vs. Ensembl Medaka
Match: epn3a (epsin-1 [Source:NCBI gene;Acc:101168623])

HSP 1 Score: 196.052 bits (497), Expect = 4.018e-53
Identity = 102/219 (46.58%), Postives = 137/219 (62.56%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFE-EHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKI 759
            IRR++KN V+ Y++AE  VREAT NDPWGP  +LMSEI+D+T +  AF DIM++IWKRLND GKNWRHV+K+LVLL++LVK G+ER+ + C +NIH+I+TLKDFQY + +  D G  +REK+K L  LL+D+E L  ERS  LK K +     S +                        +P T  +L      SEIE     +A+  S EE ER +K+
Sbjct:    6 IRRQMKNAVHSYTDAEIKVREATCNDPWGPPVSLMSEISDLTFNVVAFADIMRIIWKRLNDNGKNWRHVFKALVLLEHLVKTGSERVVKACKENIHSIQTLKDFQYIDRDGHDQGATVREKAKRLASLLRDEEKLKKERSHALKSKSRVAGLPSPLDRSMSSS--------SFDSDLPPSYPSTPSRL-----PSEIE-----KALPTSAEEEERQLKL 206          
BLAST of Epsin 2 vs. Planmine SMEST
Match: SMESG000042233.1 (SMESG000042233.1)

HSP 1 Score: 1182.16 bits (3057), Expect = 0.000e+0
Identity = 592/599 (98.83%), Postives = 592/599 (98.83%), Query Frame = 1
Query:  100 MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDSNPWEESDSSFGQLTKNTTGSLASLTDIGNDLSREKKHSCSVTDLLDTNTSTNKKKTPQEFXXXXXXXXXXXXXXPIPKAGVYRDPMSHVAKNPFGMTASAVVSNPFNNQTINPKIPMNQIGNSNNSLFASSGNLTSMGINNGQMNSFTTPMQPTFPISHSQYQGFSTMNNFSNIPWSQPVAPITNQWAINTNTANPFFN 1896
            MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEE       VLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDSNPWEESDSSFGQLTKNTTGSLASLTDIGNDLSREKKHSCSVTDLLDTNTSTNKKKTPQEFLGENANLVNLENLVPIPKAGVYRDPMSHVAKNPFGMTASAVVSNPFNNQTINPKIPMNQIGNSNNSLFASSGNLTSMGINNGQMNSFTTPMQPTFPISHSQYQGFSTMNNFSNIPWSQPVAPITNQWAINTNTANPFFN
Sbjct:    1 MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEE-------VLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDSNPWEESDSSFGQLTKNTTGSLASLTDIGNDLSREKKHSCSVTDLLDTNTSTNKKKTPQEFLGENANLVNLENLVPIPKAGVYRDPMSHVAKNPFGMTASAVVSNPFNNQTINPKIPMNQIGNSNNSLFASSGNLTSMGINNGQMNSFTTPMQPTFPISHSQYQGFSTMNNFSNIPWSQPVAPITNQWAINTNTANPFFN 592          
BLAST of Epsin 2 vs. Planmine SMEST
Match: SMESG000042233.1 (SMESG000042233.1)

HSP 1 Score: 1153.27 bits (2982), Expect = 0.000e+0
Identity = 583/599 (97.33%), Postives = 583/599 (97.33%), Query Frame = 1
Query:  100 MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDSNPWEESDSSFGQLTKNTTGSLASLTDIGNDLSREKKHSCSVTDLLDTNTSTNKKKTPQEFXXXXXXXXXXXXXXPIPKAGVYRDPMSHVAKNPFGMTASAVVSNPFNNQTINPKIPMNQIGNSNNSLFASSGNLTSMGINNGQMNSFTTPMQPTFPISHSQYQGFSTMNNFSNIPWSQPVAPITNQWAINTNTANPFFN 1896
            MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEE       VLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDSNPWEESDSSFGQLTKNTTGSLASLTDIGNDLSREKKHSCSVTDLLDTNTSTNKKKTPQEFLGENANLVNLENLVPIPKA         VAKNPFGMTASAVVSNPFNNQTINPKIPMNQIGNSNNSLFASSGNLTSMGINNGQMNSFTTPMQPTFPISHSQYQGFSTMNNFSNIPWSQPVAPITNQWAINTNTANPFFN
Sbjct:    1 MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEE-------VLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDSNPWEESDSSFGQLTKNTTGSLASLTDIGNDLSREKKHSCSVTDLLDTNTSTNKKKTPQEFLGENANLVNLENLVPIPKA---------VAKNPFGMTASAVVSNPFNNQTINPKIPMNQIGNSNNSLFASSGNLTSMGINNGQMNSFTTPMQPTFPISHSQYQGFSTMNNFSNIPWSQPVAPITNQWAINTNTANPFFN 583          
BLAST of Epsin 2 vs. Planmine SMEST
Match: SMESG000042233.1 (SMESG000042233.1)

HSP 1 Score: 1084.71 bits (2804), Expect = 0.000e+0
Identity = 554/599 (92.49%), Postives = 554/599 (92.49%), Query Frame = 1
Query:  100 MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQKVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDSNPWEESDSSFGQLTKNTTGSLASLTDIGNDLSREKKHSCSVTDLLDTNTSTNKKKTPQEFXXXXXXXXXXXXXXPIPKAGVYRDPMSHVAKNPFGMTASAVVSNPFNNQTINPKIPMNQIGNSNNSLFASSGNLTSMGINNGQMNSFTTPMQPTFPISHSQYQGFSTMNNFSNIPWSQPVAPITNQWAINTNTANPFFN 1896
            MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEE                                    LYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDSNPWEESDSSFGQLTKNTTGSLASLTDIGNDLSREKKHSCSVTDLLDTNTSTNKKKTPQEFLGENANLVNLENLVPIPKA         VAKNPFGMTASAVVSNPFNNQTINPKIPMNQIGNSNNSLFASSGNLTSMGINNGQMNSFTTPMQPTFPISHSQYQGFSTMNNFSNIPWSQPVAPITNQWAINTNTANPFFN
Sbjct:    1 MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEE------------------------------------LYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDSNPWEESDSSFGQLTKNTTGSLASLTDIGNDLSREKKHSCSVTDLLDTNTSTNKKKTPQEFLGENANLVNLENLVPIPKA---------VAKNPFGMTASAVVSNPFNNQTINPKIPMNQIGNSNNSLFASSGNLTSMGINNGQMNSFTTPMQPTFPISHSQYQGFSTMNNFSNIPWSQPVAPITNQWAINTNTANPFFN 554          
BLAST of Epsin 2 vs. Planmine SMEST
Match: SMESG000066105.1 (SMESG000066105.1)

HSP 1 Score: 171.014 bits (432), Expect = 1.750e-45
Identity = 95/248 (38.31%), Postives = 154/248 (62.10%), Query Frame = 1
Query:  106 IRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRK-----QFTKDNQFPRTVMKLNFE-ETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEE 831
            IRRK+KNVV  YSE E  VREATSN+ WGPS++++ +IA ++   +    IM +IWKRL D GK WRHVYKSL+L+++L+  GN  IAE C QN+H +++L++FQY +   DLG  IR++++ +V LLKD ++L +ER+K      +F     S GS+   + G     + +      F  +N+  + ++K ++   T  + ED +LQ A+  S+E+  +  K+ + E+  ++ K+ LA+ ++  E E
Sbjct:    2 IRRKIKNVVKNYSETEILVREATSNESWGPSNSILVKIATLSAVDTNIVQIMPIIWKRLKDSGKKWRHVYKSLILMEFLITRGNPSIAENCRQNVHFLQSLENFQYEDNGVDLGARIRKRAETIVQLLKDSDLLKSERNKAAITDMRFSKAIVSQGSNVPIKYGNGVGSLSQGPSTGSFGSNNE-TKDIIKPDYAVPTSLQEEDIQLQIALAESQEDANQKQKLEKIEQLTDDYKMSLAIRKNLNENE 248          
BLAST of Epsin 2 vs. Planmine SMEST
Match: SMESG000019746.1 (SMESG000019746.1)

HSP 1 Score: 118.627 bits (296), Expect = 6.458e-28
Identity = 71/170 (41.76%), Postives = 105/170 (61.76%), Query Frame = 1
Query:   91 ELQMEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRL-NDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEH-KDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGS-HQHRR 591
            E+  E+  KV N V  Y+E E  VR AT++DPWGP    M EIA+ T  Y     +M ++W+R+  ++  NWR  YKSL+LL YL++ G+ERI   C ++I+ +  L+ +QY +E+ KD G+ IR KSK L+ LL+++  L+NER K    + K+  K    GS + HRR
Sbjct:    7 EMGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKSLLLLSYLLRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKY--KAGISGSVNGHRR 174          
The following BLAST results are available for this feature:
BLAST of Epsin 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPN22.617e-6638.07epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639][more]
EPN22.617e-6638.07epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639][more]
EPN23.666e-6636.99epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639][more]
EPN21.898e-6545.53epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639][more]
EPN13.791e-6537.57epsin 1 [Source:HGNC Symbol;Acc:HGNC:21604][more]
back to top
BLAST of Epsin 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
epn-14.878e-7042.49EPsiN (Endocytic protein) homolog [Source:UniProt... [more]
epn-11.273e-6842.49EPsiN (Endocytic protein) homolog [Source:UniProt... [more]
rsd-36.537e-2135.17pep chromosome:WBcel235:X:11798505:11803656:1 gene... [more]
back to top
BLAST of Epsin 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lqf9.675e-6640.61gene:FBgn0028582 transcript:FBtr0331833[more]
lqf9.675e-6640.61gene:FBgn0028582 transcript:FBtr0331838[more]
lqf1.259e-6540.61gene:FBgn0028582 transcript:FBtr0112941[more]
lqf1.275e-6539.34gene:FBgn0028582 transcript:FBtr0331835[more]
lqf8.951e-6540.61gene:FBgn0028582 transcript:FBtr0331837[more]
back to top
BLAST of Epsin 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epn23.111e-6840.95epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
epn21.044e-6740.38epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
epn21.473e-6747.47epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
epn25.573e-6746.04epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
epn13.344e-6536.84epsin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2680][more]
back to top
BLAST of Epsin 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uvssa5.154e-6839.34UV stimulated scaffold protein A [Source:Xenbase;A... [more]
uvssa9.873e-6832.75UV stimulated scaffold protein A [Source:Xenbase;A... [more]
uvssa3.333e-6639.20UV stimulated scaffold protein A [Source:Xenbase;A... [more]
epn23.565e-6438.38epsin2 [Source:NCBI gene;Acc:448609][more]
epn23.045e-6337.95epsin2 [Source:NCBI gene;Acc:448609][more]
back to top
BLAST of Epsin 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Epn17.143e-6837.50epsin 1 [Source:MGI Symbol;Acc:MGI:1333763][more]
Epn17.967e-6837.50epsin 1 [Source:MGI Symbol;Acc:MGI:1333763][more]
Epn17.967e-6837.50epsin 1 [Source:MGI Symbol;Acc:MGI:1333763][more]
Epn22.124e-6545.53epsin 2 [Source:MGI Symbol;Acc:MGI:1333766][more]
Epn22.528e-6545.53epsin 2 [Source:MGI Symbol;Acc:MGI:1333766][more]
back to top
BLAST of Epsin 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80VP1|EPN1_MOUSE5.573e-6737.50Epsin-1 OS=Mus musculus OX=10090 GN=Epn1 PE=1 SV=3[more]
sp|Q9Z1Z3|EPN2_RAT1.578e-6438.03Epsin-2 OS=Rattus norvegicus OX=10116 GN=Epn2 PE=1... [more]
sp|Q9Y6I3|EPN1_HUMAN1.820e-6437.57Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2[more]
sp|O88339|EPN1_RAT3.222e-6445.60Epsin-1 OS=Rattus norvegicus OX=10116 GN=Epn1 PE=1... [more]
sp|Q8CHU3|EPN2_MOUSE6.926e-6344.53Epsin-2 OS=Mus musculus OX=10090 GN=Epn2 PE=1 SV=1[more]
back to top
BLAST of Epsin 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V9KJM39.908e-7132.38Epsin-3-like protein OS=Callorhinchus milii OX=786... [more]
A0A2A2KJI61.833e-7043.66ENTH domain-containing protein OS=Diploscapter pac... [more]
A0A1I7TMY21.293e-6941.79ENTH domain-containing protein OS=Caenorhabditis t... [more]
A0A0P4WAE41.333e-6835.49ENTH domain-containing protein OS=Scylla olivacea ... [more]
A0A267GT684.164e-6840.53ENTH domain-containing protein OS=Macrostomum lign... [more]
back to top
BLAST of Epsin 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epn12.262e-6449.59epsin-1-like [Source:NCBI gene;Acc:103024066][more]
epn25.713e-6347.54epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
epn3b2.593e-6037.04epsin-3-like [Source:NCBI gene;Acc:103023012][more]
epn3a5.401e-5734.46epsin 3 [Source:NCBI gene;Acc:103029089][more]
epn3a2.642e-5634.00epsin 3 [Source:NCBI gene;Acc:103029089][more]
back to top
BLAST of Epsin 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
epn21.759e-6639.31epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
clint1a1.178e-2439.58clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Epsin 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ENT31.345e-3140.94Protein containing an N-terminal epsin-like domain... [more]
ENT27.291e-2644.93Epsin-like protein required for endocytosis and ac... [more]
ENT12.727e-2534.01Epsin-like protein involved in endocytosis and act... [more]
ENT47.570e-833.98Protein of unknown function; contains an N-termina... [more]
ENT59.900e-727.27Protein containing an N-terminal epsin-like domain... [more]
back to top
BLAST of Epsin 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO369925.899e-6262.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487888.097e-2842.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Epsin 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epn21.920e-6648.64epsin 2 [Source:NCBI gene;Acc:101161060][more]
epn16.260e-6638.57epsin-1 [Source:NCBI gene;Acc:101167232][more]
epn12.616e-6539.19epsin-1 [Source:NCBI gene;Acc:101167232][more]
epn3a3.334e-5346.58epsin-1 [Source:NCBI gene;Acc:101168623][more]
epn3a4.018e-5346.58epsin-1 [Source:NCBI gene;Acc:101168623][more]
back to top
BLAST of Epsin 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042233.10.000e+098.83SMESG000042233.1[more]
SMESG000042233.10.000e+097.33SMESG000042233.1[more]
SMESG000042233.10.000e+092.49SMESG000042233.1[more]
SMESG000066105.11.750e-4538.31SMESG000066105.1[more]
SMESG000019746.16.458e-2841.76SMESG000019746.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028718 ID=SMED30028718|Name=Epsin 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2489bp
CGCTAGTTAAGTGGTTTTGAAAATAATATAATAGAGCTGTTTTATTATAA
ATTTTATTATTAAATAAAACATCTCTTTACTATCTGAAAGGAATTACAAA
TGGAAATAAGAAGAAAAGTGAAAAATGTGGTATATAAATACTCAGAAGCT
GAAAAATATGTCAGGGAAGCTACATCAAATGATCCATGGGGTCCATCAAG
TACCTTAATGAGTGAAATAGCTGATATGACAAACTCTTACTCGGCTTTTG
ATGATATTATGCAATTGATTTGGAAAAGACTAAATGATAAAGGAAAGAAT
TGGAGGCATGTTTATAAGTCATTAGTGTTATTGGATTATTTAGTTAAATG
TGGAAACGAAAGAATTGCCGAAGAGTGTTTACAAAATATTCATACTATTG
AAACATTGAAAGATTTTCAATATTTTGAGGAACATAAAGATTTAGGAGTA
GGAATACGTGAAAAATCAAAAGCTTTAGTTATTTTGCTAAAAGACAAAGA
AATTCTAACTAATGAGCGATCTAAAGGATTAAAAGTTAAAGAAAAATTTC
AAAATAAGCAGTCGTCAATTGGTTCTCATCAACATCGAAGACCGGGGGAA
TTGGGTCGTGAAATTAGAAAACAATTTACTAAAGATAATCAATTTCCAAG
AACTGTTATGAAATTGAATTTCGAGGAGACCAAATCAGAAATTGAGGATG
ATGAGTTACAAAGAGCAATTGAACTTAGCAAAGAAGAACACGAAAGAGCT
ATGAAAATCAGACAAGATGAAGAACGTCGAGAAGAATTAAAAATAAAATT
AGCACTGGAACAAAGTAAAAAAGAAGAAGAGTTTGATAGAAACAATCAAA
AAGTACTAGCCGTTTTGAGGCCACCTCCAAAGGTATCTGATAAACAAAAC
AATGAAACTCTACTAAGTAAATCCGCAAAGCGTGATTCTTTATATAAACT
AAGTGAAGCTTCAAGAATATTCGATCAACAAAATGGTGACTTGAGTAGTC
TAGACGTAGATACTAAATCTGATCCTTGGGGAGCAACAGCAACAAATGTA
AAATCGCAAGATTCCAGCATTCCATTAGATTTTGATCCCTGGAAATCTCC
GGATAATAATTTCGGATCTAGTAAAACACCAATGAATACAAGCACTCCAG
ATGTATGGCTCAATAAGGATTCCAGGCAATCCAAAAACATTGTTGATGAT
ATTTTTGGAGATGAAAAACCGAATACTCAGTTCGCGTCGAATTGGAATTT
TGATGTTAATGGATTAACTCCAAGCAACCAAAACAAAATTATTGATTCGA
ATCCTTGGGAAGAATCGGATAGTTCTTTCGGTCAATTGACTAAAAATACA
ACAGGGTCTTTGGCTTCATTGACTGATATTGGTAACGACCTATCAAGAGA
AAAGAAACATTCCTGCAGCGTTACAGATTTATTGGACACGAATACAAGCA
CCAATAAAAAGAAAACACCTCAAGAGTTTTTGGGCGAGAATGCCAATTTG
GTGAATCTGGAAAATCTTGTTCCGATTCCTAAAGCAGGAGTCTACAGAGA
TCCGATGTCTCATGTTGCTAAAAATCCATTCGGCATGACTGCTTCCGCAG
TGGTCAGTAATCCATTCAATAATCAAACTATAAATCCCAAAATTCCAATG
AATCAAATTGGTAACTCGAATAATTCTCTTTTTGCTTCTTCTGGAAATTT
GACATCAATGGGCATCAATAATGGGCAGATGAATTCCTTTACCACACCGA
TGCAGCCAACTTTTCCGATTTCTCATTCACAATATCAGGGATTTTCAACA
ATGAATAATTTCTCAAATATTCCCTGGTCCCAACCAGTTGCTCCAATTAC
AAACCAATGGGCTATCAACACTAACACAGCAAATCCATTTTTCAATTGAT
ATATAAATTTATTTTTTGACCATTTTATCGATAATGCCTCAAGTGGCTTA
AAAATTTCCCATTTATTACTACTGCACATATATATATTCGTTTTTTCTGT
TTCAATCAATATTTTTCACCGAAACATCACATTGCTGTATATTGTTGATC
ATGTTTTGTCGAGTCTTTTTTGGCTTTAAAAACAATTGTGTATGAAGTAG
AAAATTTTCTTGGTCGGATTTCAACTGAATTTTAGTCGATGACTAAAAAT
GAGTAGTTTAACAGAGTTGATTTTTATTGCGCTTTTGAGATTTTTGCGAT
AATTTGATTTGAACTCAATTATTTTTATTATTAGAGATATAAATCGTTTT
TATTGTGATAATATGGATATTTGATGCACCTCATGAGTGAGTAAACAGTG
ATATTTGTGTCATGTATTTTTAATAGTTAAATATTAGATTGATAATTTCA
TTGTTTCTTCAGCTAATACTTTGTTTGTTCAAATAAATATTTTCAATGAA
CACACCAGTGAATAATGTGGGTTTATTCAATTATTTACTTTTTGTAAATA
TTCGAAATTTATATAATTTCGAGATTGTTTTTTTTCTTG
back to top

protein sequence of SMED30028718-orf-1

>SMED30028718-orf-1 ID=SMED30028718-orf-1|Name=SMED30028718-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=600bp
MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAF
DDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTI
ETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKF
QNKQSSIGSHQHRRPGELGREIRKQFTKDNQFPRTVMKLNFEETKSEIED
DELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEFDRNNQ
KVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSS
LDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTP
DVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDS
NPWEESDSSFGQLTKNTTGSLASLTDIGNDLSREKKHSCSVTDLLDTNTS
TNKKKTPQEFLGENANLVNLENLVPIPKAGVYRDPMSHVAKNPFGMTASA
VVSNPFNNQTINPKIPMNQIGNSNNSLFASSGNLTSMGINNGQMNSFTTP
MQPTFPISHSQYQGFSTMNNFSNIPWSQPVAPITNQWAINTNTANPFFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003903UIM_dom
IPR013809ENTH
IPR008942ENTH_VHS
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
Vocabulary: cellular component
TermDefinition
GO:0030128clathrin coat of endocytic vesicle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 207..240
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 149..168
NoneNo IPR availablePANTHERPTHR12276EPSIN/ENT-RELATEDcoord: 3..551
NoneNo IPR availablePANTHERPTHR12276:SF48EPSIN-1coord: 3..551
NoneNo IPR availableCDDcd16990ENTH_Epsincoord: 16..138
e-value: 1.32761E-68
score: 216.067
IPR003903Ubiquitin interacting motifSMARTSM00726uimcoord: 198..217
e-value: 0.0023
score: 27.2
coord: 227..246
e-value: 31.0
score: 13.0
IPR003903Ubiquitin interacting motifPFAMPF02809UIMcoord: 228..242
e-value: 70.0
score: 3.7
coord: 199..214
e-value: 2.9E-4
score: 20.6
IPR003903Ubiquitin interacting motifPROSITEPS50330UIMcoord: 199..217
score: 9.89
IPR013809ENTH domainSMARTSM00273enth_2coord: 15..140
e-value: 2.3E-47
score: 173.4
IPR013809ENTH domainPFAMPF01417ENTHcoord: 14..136
e-value: 1.1E-43
score: 148.3
IPR013809ENTH domainPROSITEPS50942ENTHcoord: 9..140
score: 40.222
IPR008942ENTH/VHSGENE3DG3DSA:1.25.40.90coord: 1..140
e-value: 8.3E-58
score: 196.4
IPR008942ENTH/VHSSUPERFAMILYSSF48464ENTH/VHS domaincoord: 2..140