LITAF domain-containing protein
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30028698 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 7
Homology
BLAST of LITAF domain-containing protein vs. Ensembl Medaka
Match: si:ch211-157c3.4 (lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog [Source:NCBI gene;Acc:101165558]) HSP 1 Score: 45.4394 bits (106), Expect = 5.258e-6 Identity = 24/67 (35.82%), Postives = 37/67 (55.22%), Query Frame = 2 Query: 287 TKCDKCENEVIPKLKYKIGSFTWCMCVVXXXXXXXXXXXXXX--SNNYKDIYHKCPVCDHTLYVTRR 481 T C KCE +V + YK G++ W MC++F IL N++KD+YH CP C L++ ++ Sbjct: 87 TNCPKCERQVETVVDYKAGTYAWLMCLLFICCGLILLCCLIPFFMNSFKDVYHSCPNCHKILHIEKK 153
BLAST of LITAF domain-containing protein vs. Ensembl Medaka
Match: si:ch211-157c3.4 (lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog [Source:NCBI gene;Acc:101165558]) HSP 1 Score: 45.0542 bits (105), Expect = 7.069e-6 Identity = 24/67 (35.82%), Postives = 37/67 (55.22%), Query Frame = 2 Query: 287 TKCDKCENEVIPKLKYKIGSFTWCMCVVXXXXXXXXXXXXXX--SNNYKDIYHKCPVCDHTLYVTRR 481 T C KCE +V + YK G++ W MC++F IL N++KD+YH CP C L++ ++ Sbjct: 84 TNCPKCERQVETVVDYKAGTYAWLMCLLFICCGLILLCCLIPFFMNSFKDVYHSCPNCHKILHIEKK 150
BLAST of LITAF domain-containing protein vs. Planmine SMEST
Match: SMESG000020869.1 (SMESG000020869.1) HSP 1 Score: 184.111 bits (466), Expect = 6.755e-60 Identity = 136/137 (99.27%), Postives = 136/137 (99.27%), Query Frame = 2 Query: 74 MDNKDTSNXXXXXXXGFATNQHFIXXXXXXXXXXXXXXXXXXXXXXLILGRNQMIVTNQGVVANIGLVYLKTKCDKCENEVIPKLKYKIGSFTWCMCVVXXXXXXXXXXXXXXSNNYKDIYHKCPVCDHTLYVTRRC 484 MDNKDTSNPPPPPP GFATNQHFISEQSQYQSHSVQVVYPHVHQQQLILGRNQMIVTNQGVVANIGLVYLKTKCDKCENEVIPKLKYKIGSFTWCMCVVFFLIFPILFFLPFISNNYKDIYHKCPVCDHTLYVTRRC Sbjct: 1 MDNKDTSNPPPPPPLGFATNQHFISEQSQYQSHSVQVVYPHVHQQQLILGRNQMIVTNQGVVANIGLVYLKTKCDKCENEVIPKLKYKIGSFTWCMCVVFFLIFPILFFLPFISNNYKDIYHKCPVCDHTLYVTRRC 137
BLAST of LITAF domain-containing protein vs. Planmine SMEST
Match: SMESG000020865.1 (SMESG000020865.1) HSP 1 Score: 67.3958 bits (163), Expect = 2.558e-14 Identity = 37/77 (48.05%), Postives = 45/77 (58.44%), Query Frame = 2 Query: 257 VANIGLVYLKTKCDKCENEVIPKLKYKIGSFTWCMC-VVXXXXXXXXXXXXXXSNNYKDIYHKCPVCDHTLYVTRRC 484 V I K +CDKCENEV P + YK G FTW MC ++F +PF N +KD +KCP+CDH LY RRC Sbjct: 63 VTKINYGSSKVRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRRC 139 The following BLAST results are available for this feature:
BLAST of LITAF domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of LITAF domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of LITAF domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of LITAF domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of LITAF domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of LITAF domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of LITAF domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of LITAF domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of LITAF domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of LITAF domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of LITAF domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of LITAF domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of LITAF domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 2
BLAST of LITAF domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 2
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30028698 ID=SMED30028698|Name=LITAF domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=596bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|