Plexin B-4

Overview
NamePlexin B-4
Smed IDSMED30028696
Length (bp)2620
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Plexin B-4 (SMED30028696) t-SNE clustered cells

Violin plots show distribution of expression levels for Plexin B-4 (SMED30028696) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Plexin B-4 (SMED30028696) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Plexin B-4 (SMED30028696) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028696

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30028696h1SMcG0011645 dd_Smed_v4_12133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028696h1SMcG0011645 dd_Smed_v4_12133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Plexin B-4 vs. Ensembl Human
Match: PLXNB1 (plexin B1 [Source:HGNC Symbol;Acc:HGNC:9103])

HSP 1 Score: 121.709 bits (304), Expect = 2.328e-27
Identity = 131/535 (24.49%), Postives = 236/535 (44.11%), Query Frame = 2
Query:  695 IYVKMYKRKTFSILAEACSVELTVEEMRNIKLQ--KMAFLDYQTAPDSLSTLTKLNIGILLPL--------NIF--------LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPGIQ----------KLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFW 2200
            I V MY+RK+   L +   V++ +E + +      K  F D  T    ++ LT   +G  +P          IF        L R+  V E R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I++ L+ ++V+Q  +    + +  + + + E ++ NW+++C+Y +F  D  G+ L+ L R I+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++        LL     + E     + V VL  D+ISQ K K+LD+           D     +++ +  A           +IL D D T+   ++   + ++NTLQHY++ +   +          + E +  +PG +           + P H+++  D      + R   LR    ++ RA    E  L  LL+ K ++  F++  FQ IL                     STS+ +  +    V YFF +LD+ A+Q  ++ ++T+ +WK   L LRFW
Sbjct: 1323 IIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMT---EMTDLTSDLLGSGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQ-YVAKNPKLMLRRTETVVEKLLTNWMSICLY-TFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNA-------LLAVGPGAGEAQ--GVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVA---------GHLILSDEDVTS---EVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEP-EPPRPRRGSLR--GGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVIL---------------------STSRPVPLA----VKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFW 1803          
BLAST of Plexin B-4 vs. Ensembl Human
Match: PLXNB1 (plexin B1 [Source:HGNC Symbol;Acc:HGNC:9103])

HSP 1 Score: 121.324 bits (303), Expect = 3.588e-27
Identity = 131/535 (24.49%), Postives = 236/535 (44.11%), Query Frame = 2
Query:  695 IYVKMYKRKTFSILAEACSVELTVEEMRNIKLQ--KMAFLDYQTAPDSLSTLTKLNIGILLPL--------NIF--------LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPGIQ----------KLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFW 2200
            I V MY+RK+   L +   V++ +E + +      K  F D  T    ++ LT   +G  +P          IF        L R+  V E R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I++ L+ ++V+Q  +    + +  + + + E ++ NW+++C+Y +F  D  G+ L+ L R I+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++        LL     + E     + V VL  D+ISQ K K+LD+           D     +++ +  A           +IL D D T+   ++   + ++NTLQHY++ +   +          + E +  +PG +           + P H+++  D      + R   LR    ++ RA    E  L  LL+ K ++  F++  FQ IL                     STS+ +  +    V YFF +LD+ A+Q  ++ ++T+ +WK   L LRFW
Sbjct: 1506 IIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMT---EMTDLTSDLLGSGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQ-YVAKNPKLMLRRTETVVEKLLTNWMSICLY-TFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNA-------LLAVGPGAGEAQ--GVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVA---------GHLILSDEDVTS---EVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEP-EPPRPRRGSLR--GGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVIL---------------------STSRPVPLA----VKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFW 1986          
BLAST of Plexin B-4 vs. Ensembl Human
Match: PLXNB1 (plexin B1 [Source:HGNC Symbol;Acc:HGNC:9103])

HSP 1 Score: 121.324 bits (303), Expect = 3.588e-27
Identity = 131/535 (24.49%), Postives = 236/535 (44.11%), Query Frame = 2
Query:  695 IYVKMYKRKTFSILAEACSVELTVEEMRNIKLQ--KMAFLDYQTAPDSLSTLTKLNIGILLPL--------NIF--------LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPGIQ----------KLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFW 2200
            I V MY+RK+   L +   V++ +E + +      K  F D  T    ++ LT   +G  +P          IF        L R+  V E R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I++ L+ ++V+Q  +    + +  + + + E ++ NW+++C+Y +F  D  G+ L+ L R I+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++        LL     + E     + V VL  D+ISQ K K+LD+           D     +++ +  A           +IL D D T+   ++   + ++NTLQHY++ +   +          + E +  +PG +           + P H+++  D      + R   LR    ++ RA    E  L  LL+ K ++  F++  FQ IL                     STS+ +  +    V YFF +LD+ A+Q  ++ ++T+ +WK   L LRFW
Sbjct: 1506 IIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMT---EMTDLTSDLLGSGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQ-YVAKNPKLMLRRTETVVEKLLTNWMSICLY-TFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNA-------LLAVGPGAGEAQ--GVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVA---------GHLILSDEDVTS---EVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEP-EPPRPRRGSLR--GGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVIL---------------------STSRPVPLA----VKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFW 1986          
BLAST of Plexin B-4 vs. Ensembl Human
Match: PLXNB2 (plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104])

HSP 1 Score: 109.768 bits (273), Expect = 1.217e-23
Identity = 105/441 (23.81%), Postives = 191/441 (43.31%), Query Frame = 2
Query:  908 EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPG-----IQKLTPI-HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFW 2200
            E R+     ++    NLL +K      I        F  + K   A L+T+ L    +Y+  IM  L   ++ Q  +    + +  + + + E ++ NW+++C+Y   K D AG+ L+ L +AI+ +++ G +D    KA+Y L+   L  +  +Y  L++ V VQ +              +  + V VL+ D+ISQVK KI+D+          +        +   ++++L     S   IL D D T+   + +  + +VNTL HY +++   L      + +   + +  LPG     +++   + H++     R TD        R    +K R     E  L  LL+ K ++  F++ FFQ++L                            ++    V YFF  LD+ A++ ++  E+T+ +WK   L LRFW
Sbjct: 1306 EPRRPVVEQALYQFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELLEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLK-DSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDE-------------GVDAIPVKVLNCDTISQVKEKIIDQ----------VYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTS---QREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLV-----RPTDEVDEGKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLA-------------------------PGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFW 1689          
BLAST of Plexin B-4 vs. Ensembl Human
Match: PLXNB2 (plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104])

HSP 1 Score: 109.768 bits (273), Expect = 1.217e-23
Identity = 105/441 (23.81%), Postives = 191/441 (43.31%), Query Frame = 2
Query:  908 EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPG-----IQKLTPI-HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFW 2200
            E R+     ++    NLL +K      I        F  + K   A L+T+ L    +Y+  IM  L   ++ Q  +    + +  + + + E ++ NW+++C+Y   K D AG+ L+ L +AI+ +++ G +D    KA+Y L+   L  +  +Y  L++ V VQ +              +  + V VL+ D+ISQVK KI+D+          +        +   ++++L     S   IL D D T+   + +  + +VNTL HY +++   L      + +   + +  LPG     +++   + H++     R TD        R    +K R     E  L  LL+ K ++  F++ FFQ++L                            ++    V YFF  LD+ A++ ++  E+T+ +WK   L LRFW
Sbjct: 1306 EPRRPVVEQALYQFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELLEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLK-DSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDE-------------GVDAIPVKVLNCDTISQVKEKIIDQ----------VYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTS---QREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLV-----RPTDEVDEGKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLA-------------------------PGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFW 1689          
BLAST of Plexin B-4 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 88.1965 bits (217), Expect = 1.681e-17
Identity = 121/524 (23.09%), Postives = 220/524 (41.98%), Query Frame = 2
Query:  893 RNYKVEVRKADENDS-VKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQA-KLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDF--GNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNH--MKLYFRSNTL----------DKSIYEVKALPGIQKLTPI---------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNK----ESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEI 2368
            +N +V+  KA+  ++ +++   LL+NK     ++     N  F  K++     L+ ++L     Y   ++K+L+  ++ +  +   + + LF + + I E ++  W T  ++   K  +AGK L+ L   I+ +M+ G  D  T +ARY LS ++L   + +Y  L + V     +     DI           V VL  D+I+QVK K LD     Y         D  +++  G +  M L  I  S++V   ++              ++NTL HY + N+  + L  +SN+L          +KS   +K  PG+    P          H   S D   TD+  +   L V  ++    D  +    E  L  LL  K ++  FI    ++I +                           ++    + Y F  +D+ A++  + + E V  WK   L LRFW+++I NP+ +F + K   I   L  + + L ++ S     +T  S   + LF +++
Sbjct:  588 KNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELIEKTVEKKFQPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDIP----------VRVLDCDTITQVKEKCLDAKYRGYRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWK-------------RLNTLAHYNVPNNAILTLTSKSNSLYNLSILSDRSEKSSVSMKT-PGVGSPKPWGAPPSVIADHASSSAD---TDNGFKLYHL-VKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESIFS--------------------------SSTVPPCIKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQDHQLTKDSPSSKLLFAKDM 1057          
BLAST of Plexin B-4 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 88.1965 bits (217), Expect = 1.733e-17
Identity = 121/524 (23.09%), Postives = 220/524 (41.98%), Query Frame = 2
Query:  893 RNYKVEVRKADENDS-VKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQA-KLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDF--GNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNH--MKLYFRSNTL----------DKSIYEVKALPGIQKLTPI---------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNK----ESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEI 2368
            +N +V+  KA+  ++ +++   LL+NK     ++     N  F  K++     L+ ++L     Y   ++K+L+  ++ +  +   + + LF + + I E ++  W T  ++   K  +AGK L+ L   I+ +M+ G  D  T +ARY LS ++L   + +Y  L + V     +     DI           V VL  D+I+QVK K LD     Y         D  +++  G +  M L  I  S++V   ++              ++NTL HY + N+  + L  +SN+L          +KS   +K  PG+    P          H   S D   TD+  +   L V  ++    D  +    E  L  LL  K ++  FI    ++I +                           ++    + Y F  +D+ A++  + + E V  WK   L LRFW+++I NP+ +F + K   I   L  + + L ++ S     +T  S   + LF +++
Sbjct: 1170 KNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELIEKTVEKKFQPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDI----------PVRVLDCDTITQVKEKCLDAKYRGYRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWK-------------RLNTLAHYNVPNNAILTLTSKSNSLYNLSILSDRSEKSSVSMKT-PGVGSPKPWGAPPSVIADHASSSAD---TDNGFKLYHL-VKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESIFS--------------------------SSTVPPCIKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQDHQLTKDSPSSKLLFAKDM 1639          
BLAST of Plexin B-4 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 87.8113 bits (216), Expect = 2.394e-17
Identity = 121/524 (23.09%), Postives = 217/524 (41.41%), Query Frame = 2
Query:  893 RNYKVEVRKADE-NDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQA-KLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDF--GNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNH--MKLYFRSNTL----------DKSIYEVKALPGIQKLTPI---------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNK----ESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEI 2368
            +N +V+  KA+     +++   LL+NK     ++     N  F  K++     L+ ++L     Y   ++K+L+  ++ +  +   + + LF + + I E ++  W T  ++   K  +AGK L+ L   I+ +M+ G  D  T +ARY LS ++L   + +Y  L + V     +     DI           V VL  D+I+QVK K LD     Y         D  +++  G +  M L  I  S++V                 + ++NTL HY + N+  + L  +SN+L          +KS   +K  PG+    P          H   S D   TD+  +   L V  ++    D  +    E  L  LL  K ++  FI    ++I +                           ++    + Y F  +D+ A++  + + E V  WK   L LRFW+++I NP+ +F + K   I   L  + + L ++ S     +T  S   + LF +++
Sbjct: 1359 KNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELIEKTVEKKFQPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDI----------PVRVLDCDTITQVKEKCLDAKYRGYRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRV-------------EGGNWKRLNTLAHYNVPNNAILTLTSKSNSLYNLSILSDRSEKSSVSMKT-PGVGSPKPWGAPPSVIADHASSSAD---TDNGFKLYHL-VKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESIFS--------------------------SSTVPPCIKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQDHQLTKDSPSSKLLFAKDM 1828          
BLAST of Plexin B-4 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 83.5741 bits (205), Expect = 5.074e-16
Identity = 121/531 (22.79%), Postives = 215/531 (40.49%), Query Frame = 2
Query:  893 RNYKVEVRKADE-NDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQA-KLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDF--GNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNH--MKLYFRSNTL---------------------DKSIYEVKALPGIQKLTPI---------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNK----ESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLF 2356
            +N +V+  KA+     +++   LL+NK     ++     N  F  K++     L+ ++L     Y   ++K+L+  ++ +  +   + + LF + + I E ++  W T  ++   K  +AGK L+ L   I+ +M+ G  D  T +ARY LS ++L   + +Y  L + V     +     DI           V VL  D+I+QVK K LD     Y         D  +++  G +  M L  I  S++V   ++              ++NTL HY + N+  + L  +SN+L                     +KS   +K  PG+    P          H   S D   TD+  +   L V  ++    D  +    E  L  LL  K ++  FI    ++I +                           ++    + Y F  +D+ A++  + + E V  WK   L LRFW+++I NP+ +F + K   I   L  + + L ++ S     +T  S   + LF
Sbjct: 1170 KNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELIEKTVEKKFQPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDI----------PVRVLDCDTITQVKEKCLDAKYRGYRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWK-------------RLNTLAHYNVPNNAILTLTSKSNSLYNLVNFSSTSMKTASILSDRSEKSSVSMKT-PGVGSPKPWGAPPSVIADHASSSAD---TDNGFKLYHL-VKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESIFS--------------------------SSTVPPCIKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQDHQLTKDSPSSKLLF 1646          
BLAST of Plexin B-4 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 82.8037 bits (203), Expect = 7.384e-16
Identity = 121/531 (22.79%), Postives = 215/531 (40.49%), Query Frame = 2
Query:  893 RNYKVEVRKADE-NDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQA-KLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDF--GNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNH--MKLYFRSNTL---------------------DKSIYEVKALPGIQKLTPI---------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNK----ESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLF 2356
            +N +V+  KA+     +++   LL+NK     ++     N  F  K++     L+ ++L     Y   ++K+L+  ++ +  +   + + LF + + I E ++  W T  ++   K  +AGK L+ L   I+ +M+ G  D  T +ARY LS ++L   + +Y  L + V     +     DI           V VL  D+I+QVK K LD     Y         D  +++  G +  M L  I  S++V   ++              ++NTL HY + N+  + L  +SN+L                     +KS   +K  PG+    P          H   S D   TD+  +   L V  ++    D  +    E  L  LL  K ++  FI    ++I +                           ++    + Y F  +D+ A++  + + E V  WK   L LRFW+++I NP+ +F + K   I   L  + + L ++ S     +T  S   + LF
Sbjct:  588 KNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELIEKTVEKKFQPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDIP----------VRVLDCDTITQVKEKCLDAKYRGYRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWK-------------RLNTLAHYNVPNNAILTLTSKSNSLYNLVNFSSTSMKTASILSDRSEKSSVSMKT-PGVGSPKPWGAPPSVIADHASSSAD---TDNGFKLYHL-VKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESIFS--------------------------SSTVPPCIKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQDHQLTKDSPSSKLLF 1064          
BLAST of Plexin B-4 vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0309865)

HSP 1 Score: 99.7525 bits (247), Expect = 6.438e-21
Identity = 122/500 (24.40%), Postives = 220/500 (44.00%), Query Frame = 2
Query:  956 LLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQA-KLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPGI------QKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAW 2389
            L++NK      I     N  F  + +   A LI + L    +Y   I+K L+ +++ +  +  S  + L  + + + E ++  W T  + Y F  + AG+ L+ L RA++ ++  G +D  T++ARY LS ++L  +S D+  +++   + IQ  +  ++++    +  N+ V VL  D+I QVK K L+              +D  +++             + +VIL D D T+   K + E+ ++NTLQHY + +   L         SIY    L         +  +P+            H+++       DS ++  G RV++       L  E  L  LLATK ++  F++  F+ I                F   +  ++  L       + Y F  LDD A+   +T+ E V  WK   L LRFW+++I NPN +F + KS  +   L  + +   +S S +   +   S   + L+ ++I  +Y  W
Sbjct: 1397 LIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTF-LLYKFLKECAGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASI-IQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGA---------TGRVILYDEDVTS---KTESEWKKLNTLQHYNVPDGAGLSLVPK--QSSIYNFSILSDKNEKSHNRAGSPLNNDMHENGLRYWHLVKH-----HDSDMQKEGERVNK-------LVSEIYLTRLLATKGTLQKFVDDLFETI----------------FSTAHRGSALPLA------IKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIP-EYRKW 1845          
BLAST of Plexin B-4 vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0089224)

HSP 1 Score: 98.9821 bits (245), Expect = 1.164e-20
Identity = 127/505 (25.15%), Postives = 220/505 (43.56%), Query Frame = 2
Query:  956 LLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQA-KLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPG----IQKLTPIHIIQSCDSRCTDSKLRSI--------GLRV--------DQSQKIRADLNK---ESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAW 2389
            L++NK      I     N  F  + +   A LI + L    +Y   I+K L+ +++ +  +  S  + L  + + + E ++  W T  + Y F  + AG+ L+ L RA++ ++  G +D  T++ARY LS ++L  +S D+  +++   + IQ  +  ++++    +  N+ V VL  D+I QVK K L+              +D  +++             + +VIL D D T+   K + E+ ++NTLQHY + +   L         SIY    L        K   ++I +   S  T S+  S         GLR            QK    +NK   E  L  LLATK ++  F++  F+ I                F   +  ++  L       + Y F  LDD A+   +T+ E V  WK   L LRFW+++I NPN +F + KS  +   L  + +   +S S +   +   S   + L+ ++I  +Y  W
Sbjct:  957 LIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTF-LLYKFLKECAGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASI-IQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGA---------TGRVILYDEDVTS---KTESEWKKLNTLQHYNVPDGAGLSLVPK--QSSIYNFSILSDKNEKSHKYETLNISKYTSSSPTFSRAGSPLNNDMHENGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDLFETI----------------FSTAHRGSALPLA------IKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIP-EYRKW 1422          
BLAST of Plexin B-4 vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0089225)

HSP 1 Score: 98.9821 bits (245), Expect = 1.164e-20
Identity = 127/505 (25.15%), Postives = 220/505 (43.56%), Query Frame = 2
Query:  956 LLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQA-KLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPG----IQKLTPIHIIQSCDSRCTDSKLRSI--------GLRV--------DQSQKIRADLNK---ESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAW 2389
            L++NK      I     N  F  + +   A LI + L    +Y   I+K L+ +++ +  +  S  + L  + + + E ++  W T  + Y F  + AG+ L+ L RA++ ++  G +D  T++ARY LS ++L  +S D+  +++   + IQ  +  ++++    +  N+ V VL  D+I QVK K L+              +D  +++             + +VIL D D T+   K + E+ ++NTLQHY + +   L         SIY    L        K   ++I +   S  T S+  S         GLR            QK    +NK   E  L  LLATK ++  F++  F+ I                F   +  ++  L       + Y F  LDD A+   +T+ E V  WK   L LRFW+++I NPN +F + KS  +   L  + +   +S S +   +   S   + L+ ++I  +Y  W
Sbjct:  957 LIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTF-LLYKFLKECAGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASI-IQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGA---------TGRVILYDEDVTS---KTESEWKKLNTLQHYNVPDGAGLSLVPK--QSSIYNFSILSDKNEKSHKYETLNISKYTSSSPTFSRAGSPLNNDMHENGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDLFETI----------------FSTAHRGSALPLA------IKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIP-EYRKW 1422          
BLAST of Plexin B-4 vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0089223)

HSP 1 Score: 98.9821 bits (245), Expect = 1.254e-20
Identity = 127/505 (25.15%), Postives = 220/505 (43.56%), Query Frame = 2
Query:  956 LLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQA-KLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPG----IQKLTPIHIIQSCDSRCTDSKLRSI--------GLRV--------DQSQKIRADLNK---ESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAW 2389
            L++NK      I     N  F  + +   A LI + L    +Y   I+K L+ +++ +  +  S  + L  + + + E ++  W T  + Y F  + AG+ L+ L RA++ ++  G +D  T++ARY LS ++L  +S D+  +++   + IQ  +  ++++    +  N+ V VL  D+I QVK K L+              +D  +++             + +VIL D D T+   K + E+ ++NTLQHY + +   L         SIY    L        K   ++I +   S  T S+  S         GLR            QK    +NK   E  L  LLATK ++  F++  F+ I                F   +  ++  L       + Y F  LDD A+   +T+ E V  WK   L LRFW+++I NPN +F + KS  +   L  + +   +S S +   +   S   + L+ ++I  +Y  W
Sbjct: 1397 LIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTF-LLYKFLKECAGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASI-IQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGA---------TGRVILYDEDVTS---KTESEWKKLNTLQHYNVPDGAGLSLVPK--QSSIYNFSILSDKNEKSHKYETLNISKYTSSSPTFSRAGSPLNNDMHENGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDLFETI----------------FSTAHRGSALPLA------IKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIP-EYRKW 1862          
BLAST of Plexin B-4 vs. Ensembl Fly
Match: PlexB (gene:FBgn0025740 transcript:FBtr0308297)

HSP 1 Score: 87.0409 bits (214), Expect = 5.914e-17
Identity = 105/431 (24.36%), Postives = 172/431 (39.91%), Query Frame = 2
Query: 1037 ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDV-----LSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAI--MEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKN--------------------------HMKLYFRSNTLDKSIYEVKALPGIQKLTPIHIIQS--CDSRCT-DSKLRSIGLRVDQSQKI---RADLNK---ESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            A LI ++L    +Y   I+K L+  ++ ++      + +  + + + E ++ N++ +CMY   K + AG NLF L +AI+ +++ G++D  TN ARY LS ++L  E   + V     L  D+D ++Q +     +N W              D+ISQVK KILD       +S    ++  D     G               + L D D T    K    + ++NTL HY +K                           +   YF +N+    I       G+Q+    H+++    D      + + S G    QS  +      +NK   E  L  LLATK +I  F++ FF  IL    E                             V + F +LD+ A++  + + + V  WK   L LRFW
Sbjct: 1530 ASLIMVVLMNKMEYATEILKSLLLRLIDKSLASKHPQLMLRRTESVVEKMLTNYLAICMYDYLK-EYAGSNLFLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHILQDDLDEKVQCR-----VNDW--------------DTISQVKLKILDAIFKNTPFSMRPSVNEVDLEWRHGR-----------GGHLTLQDEDLTT---KTVNGWKRLNTLAHYGVKESAVMSLIARQNDNYHIPYSKNQNSAPYHNFYFINNSQSHIIINNDIESGLQQPRVYHLVKPNIPDHYMNIKNSVLSGGSPAFQSHVVNNCNDRVNKTIPEVYLTRLLATKGTIQKFVDDFFSIILTVNEE-------------------------LPPAVKWLFDLLDEAARRHDIADTDIVHAWKSNCLPLRFW 1901          
BLAST of Plexin B-4 vs. Ensembl Zebrafish
Match: plxnb1a (plexin b1a [Source:ZFIN;Acc:ZDB-GENE-050302-63])

HSP 1 Score: 125.561 bits (314), Expect = 5.684e-29
Identity = 125/456 (27.41%), Postives = 213/456 (46.71%), Query Frame = 2
Query:  887 LSRNYKVEV-RKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA--LPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            L R+  V   R+A     +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q       + +  + + + E ++ NW+++C+Y +F  D AG++ + L RAI+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++V       L+N+        LP  V+D    D+I+QVK KIL++A    S      A+   +++     M  HL       IL D D T+V   +   + ++NTLQHY++ +   +   S    K I+      +PG  + TP+            H++++ +      K R   LR    ++ RA    E  L  LL+ K ++  F++  F  IL                     STS+ +  +    V YFF +LDD A Q ++T+ ET+ +WK   L LRFW
Sbjct:  263 LRRDLDVPACRRATVEQGLVQLSNLLNSKLFLTKFIHTLEAQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLSHLVEQYTT-KNPKLMLRRTESVVEKLLTNWMSICLY-TFLRDTAGESFYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYRTLTLNV-------LVNNGGAGESQTLPTKVLDC---DTITQVKEKILEQAWKSTSFSQRPSADSVHLEW--RAGMAGHL-------ILSDQDLTSV---VQGSWKRLNTLQHYKVPDGATVTLVSRQ-SKQIHHDSHDYIPG--EKTPMLEDGDEGGVKQWHLVKA-NEEAELPKHRRGSLR--DKERERAKAIPEIYLTRLLSVKGTLQKFVDDLFTVIL---------------------STSRPVPLA----VKYFFDLLDDQAAQHNITDPETIHIWKTNSLPLRFW 663          
BLAST of Plexin B-4 vs. Ensembl Zebrafish
Match: plxnb2b (plexin b2b [Source:ZFIN;Acc:ZDB-GENE-080902-1])

HSP 1 Score: 116.701 bits (291), Expect = 5.702e-26
Identity = 136/571 (23.82%), Postives = 238/571 (41.68%), Query Frame = 2
Query:  632 NLYFIVLICIFLIGMIGIFGTIYVKMYKRKTFSILAEACSVELTVEEMR-----------------------NIKLQKMAFLDYQTAPDSLSTLTKLN----IGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAI--MEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIY--------EVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESC--------LMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIA-KQLSVTEETVELWKCKGLILRFW 2200
            +L   V+I   L+ M+ I   I V  Y+RK+     E   V+  +E +                        +I   ++ FLDY+T  D +  L   +    + I   L+I        E R+A    ++    NLL +K      I        F+ + K   A L+T+ L    +Y+  IM+ L+  ++         + L  + + + E ++ NW+++C+Y   K D AG+ L+ L RAI+ +++ G +D+   KA+Y L+   L  +  +Y +L++ V VQ +      DI           V+VL+ D+ISQVK KIL++    + YS+   +D            ++ L     S   IL D D T+   + +  + ++NTL HY ++++  +   S    +  Y        E  AL    K+   H+++  D              +D+ +  R  +  +S         L  LL+ K ++  F++ FF ++L   +                         +    V YFF  LD+ A +  +V EET+ +WK   L LRFW
Sbjct: 1204 SLPLAVIIPAVLVPMLMIIA-ISVVCYRRKSQQAEREYEKVKHQLENLEESVRDRGKKEVTDLMIVMEDHTNDISEGRIPFLDYKTYTDRVFFLPSKDGANDVMITGKLDI-------PESRRATVTQALNQFSNLLNSKTFLINFIRTLEGRPDFNARAKVYFASLLTVALHGKLEYYTDIMRTLLLGLMEDYVHSKNPKLLLRRSETVVERMLSNWMSICLYQYLK-DTAGEPLYKLFRAIKHQIEKGPVDVQVKKAKYTLNDTGLLGDDVEYSILTLQVLVQGE----GPDITP---------VNVLNCDTISQVKEKILEQVYKNLPYSQRPKVD------------SVTLEWRPGSTGQILSDLDVTS---QKEGRWRRINTLAHYNVRDNATVILSSVQHTQQSYDQNHDSHEERNALLEDDKV--FHLVRPAD-------------ELDEIKSKRGSIKDKSMTKAITEIYLTRLLSVKGTLQQFVDDFFHSVLCSGA-------------------------AVPPAVKYFFDFLDEQALRHENVDEETIHIWKTNSLPLRFW 1697          
BLAST of Plexin B-4 vs. Ensembl Zebrafish
Match: plxnb1b (plexin b1b [Source:ZFIN;Acc:ZDB-GENE-090812-4])

HSP 1 Score: 114.39 bits (285), Expect = 3.146e-25
Identity = 122/458 (26.64%), Postives = 213/458 (46.51%), Query Frame = 2
Query:  887 LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNK--CALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAI--MEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKN---------HMKLYFRSNTLD-----KSIYEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            L R+  V E R+A     +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q  +    + +  + + + E ++ NWI++C+Y  F  + AG++L+ L RAI+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++V +Q         +N  +     +   VL  D+I+QVK KILD+      +S     D+    +D    + +  HL       IL D D T+V   +   + ++NTLQHY++ +         H K +   +T D     K+     A  G  +L   H++++ +      K R   L+    ++ RA    E  L  LL+ K ++  F++  F  IL                     STS+ +  +    + YFF +LDD A +  +++ ET+ +WK   L LRFW
Sbjct: 1673 LRRDLDVQECRRATVEQGLIQLSNLLNSKLFLTKFIHTLESQRTFSPRDRGYVASLLTVALHSKLEYFTDILKTLLNDLVEQ-YIAKNPKLMLRRTETVVEKLLTNWISICLY-GFLRNSAGESLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDLEYRTLTVNVLMQ------GIGMNEAQ----PVAAKVLDCDTITQVKEKILDQVYKGTSFSHRPHTDS----VDLEWRSGVAGHL-------ILSDEDLTSV---VQGNWKRLNTLQHYKVPDGATVALVPRHSK-HIHHDTHDYIAGEKTPMLEDADEGGVRL--WHLVKASEEP-ELPKHRRGSLK----ERERAKTIPEIYLTRLLSMKGTLQKFVDDLFTVIL---------------------STSRPVPLA----IKYFFDLLDDQAVRHGISDSETIHIWKTNSLPLRFW 2071          
BLAST of Plexin B-4 vs. Ensembl Zebrafish
Match: plxnb1b (plexin b1b [Source:ZFIN;Acc:ZDB-GENE-090812-4])

HSP 1 Score: 114.39 bits (285), Expect = 3.146e-25
Identity = 122/458 (26.64%), Postives = 213/458 (46.51%), Query Frame = 2
Query:  887 LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNK--CALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAI--MEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKN---------HMKLYFRSNTLD-----KSIYEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            L R+  V E R+A     +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q  +    + +  + + + E ++ NWI++C+Y  F  + AG++L+ L RAI+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++V +Q         +N  +     +   VL  D+I+QVK KILD+      +S     D+    +D    + +  HL       IL D D T+V   +   + ++NTLQHY++ +         H K +   +T D     K+     A  G  +L   H++++ +      K R   L+    ++ RA    E  L  LL+ K ++  F++  F  IL                     STS+ +  +    + YFF +LDD A +  +++ ET+ +WK   L LRFW
Sbjct: 1673 LRRDLDVQECRRATVEQGLIQLSNLLNSKLFLTKFIHTLESQRTFSPRDRGYVASLLTVALHSKLEYFTDILKTLLNDLVEQ-YIAKNPKLMLRRTETVVEKLLTNWISICLY-GFLRNSAGESLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDLEYRTLTVNVLMQ------GIGMNEAQ----PVAAKVLDCDTITQVKEKILDQVYKGTSFSHRPHTDS----VDLEWRSGVAGHL-------ILSDEDLTSV---VQGNWKRLNTLQHYKVPDGATVALVPRHSK-HIHHDTHDYIAGEKTPMLEDADEGGVRL--WHLVKASEEP-ELPKHRRGSLK----ERERAKTIPEIYLTRLLSMKGTLQKFVDDLFTVIL---------------------STSRPVPLA----IKYFFDLLDDQAVRHGISDSETIHIWKTNSLPLRFW 2071          
BLAST of Plexin B-4 vs. Ensembl Zebrafish
Match: plxnb3 (plexin B3 [Source:ZFIN;Acc:ZDB-GENE-081104-53])

HSP 1 Score: 107.842 bits (268), Expect = 2.635e-23
Identity = 106/423 (25.06%), Postives = 187/423 (44.21%), Query Frame = 2
Query:  983 KLISNFNENHSFDNKNK--CALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDK--AIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            + I       SF  +++   A L+T+ L    +YF  +MK L+ ++V Q  +    + +  + + + E ++ NW+++C+Y SF  + AG+ L+ L RAI+ ++  G +D  T KA+  L+   L  E  DY  +++ V       L+ S      + +    V VL +D+I+QVK KILD+      +S+    D+ D     G +     HL        L D D T +   +   + ++NTLQHY++ +   +     +  +S   V  +    + TP+            H+++  +      K R   +R    ++ RA    E  L  LL+ K ++  F++  F  IL+ K    +                          V +FF  LDD+A++  + + ETV +WK   L LRFW
Sbjct:  584 RFIHTLEAQQSFSQRDRGYVASLLTMALHDKLEYFTDVMKNLLGDLVQQY-VAKNPKLMLRRTETVVEKMLTNWMSICLY-SFLKEVAGEPLYKLYRAIKYQVDKGPVDAVTGKAKRTLNDSHLLREDIDYCAVTLTV-------LVKSG-----VEVQPCPVKVLDIDTITQVKDKILDQIYKGAAFSQRPAADSLDLEWRSGQAG----HL-------TLSDDDVTAI---VQGRWKRINTLQHYKVPDGATVALIPRS--QSSLGVNQVYQTGEKTPMLEGEEEEGLRLWHLVKPTEDPEI-PKHRKSSMR----ERERAKAIPEIYLTRLLSMKGTLQKFVDDVFVAILSTKRPPPI-------------------------AVRFFFDFLDDMAEKHGIDDPETVHIWKTNSLPLRFW 946          
BLAST of Plexin B-4 vs. Ensembl Xenopus
Match: PLXNB1 (plexin B1 [Source:NCBI gene;Acc:100498269])

HSP 1 Score: 119.013 bits (297), Expect = 1.522e-26
Identity = 148/581 (25.47%), Postives = 249/581 (42.86%), Query Frame = 2
Query:  620 IRCGNLYFIV---------LICIFLIGMIGI-FGTIYVKM--------YKRKTFSILAEACSVELTVEEMRNIKLQ--KMAFLDYQTAPDSLSTLTKLNIGILLPL--------NIF--------LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA--LPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            +R G +Y ++          +   L   IG+  GT +V +        Y+RK+   L +   V++ +E +        K  F D  T    +  LT   +G  +P          IF        L R+  V E R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q  +    + +  + + + E ++ NW+++C+Y +F  D AG+ L+ L R I+ ++  G +D  T KA+Y L+ ++L  +  +Y  L+++  +Q      N+ I   E     L V +L  D+I+QVK KILD+             N   +D    + +  HL       IL D D T+V   +   + +VNTLQHY++ +   +      L K I+      +PG  + TP+            H+++  D      K R   LR     + RA    E  L  LL+ K ++  F++  FQ IL                     STS+ +  +    V YFF +LD+ A    + + ET+ +WK   L LRFW
Sbjct: 1553 VRIGRMYLVLGKVQYDTESQLTFPLEAQIGLGVGTSFVALIVLIIVLIYRRKSKQALRDYKKVQIQLENLETSVRDRCKKEFTDLMT---EMMDLTSDLVGTGIPFLDYKSYAERIFFPGHRESPLQRDLDVPEGRRQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVSLHGKLEYFTDILKTLLNDLVEQY-VAKNPKLMLRRTETVVEKLLTNWMSICLY-TFVRDSAGEPLYMLFRGIKHQVDKGPVDCVTGKAKYTLNDNRLLRDDVEYKTLTLNAIMQT-----NTGITCEE-EAQGLPVKLLDCDTITQVKEKILDQIYKGTPYCN--RPNPEALDLEWRSGLAGHL-------ILSDEDLTSV---VHGSWKRVNTLQHYKVPDGATVALVPR-LSKHIHPENHDYIPG--EKTPMLEDSDEGGVRVWHLVKPTDEP-ELPKHRRGSLR----DRERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVIL---------------------STSRPVPLA----VKYFFDLLDEQAISHGINDPETIHIWKTNSLPLRFW 2077          
BLAST of Plexin B-4 vs. Ensembl Xenopus
Match: PLXNB1 (plexin B1 [Source:NCBI gene;Acc:100498269])

HSP 1 Score: 119.013 bits (297), Expect = 1.672e-26
Identity = 141/538 (26.21%), Postives = 235/538 (43.68%), Query Frame = 2
Query:  695 IYVKMYKRKTFSILAEACSVELTVEEMRNIKLQ--KMAFLDYQTAPDSLSTLTKLNIGILLPL--------NIF--------LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA--LPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            I V +Y+RK+   L +   V++ +E +        K  F D  T    +  LT   +G  +P          IF        L R+  V E R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q  +    + +  + + + E ++ NW+++C+Y +F  D AG+ L+ L R I+ ++  G +D  T KA+Y L+ ++L  +  +Y  L+++  +Q      N+ I   E     L V +L  D+I+QVK KILD+             N   +D    + +  HL       IL D D T+V   +   + +VNTLQHY++ +   +      L K I+      +PG  + TP+            H+++  D      K R   LR     + RA    E  L  LL+ K ++  F++  FQ IL                     STS+ +  +    V YFF +LD+ A    + + ET+ +WK   L LRFW
Sbjct: 1473 IIVLIYRRKSKQALRDYKKVQIQLENLETSVRDRCKKEFTDLMT---EMMDLTSDLVGTGIPFLDYKSYAERIFFPGHRESPLQRDLDVPEGRRQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVSLHGKLEYFTDILKTLLNDLVEQY-VAKNPKLMLRRTETVVEKLLTNWMSICLY-TFVRDSAGEPLYMLFRGIKHQVDKGPVDCVTGKAKYTLNDNRLLRDDVEYKTLTLNAIMQT-----NTGITCEE-EAQGLPVKLLDCDTITQVKEKILDQIYKGTPYCN--RPNPEALDLEWRSGLAGHL-------ILSDEDLTSV---VHGSWKRVNTLQHYKVPDGATVALVPR-LSKHIHPENHDYIPG--EKTPMLEDSDEGGVRVWHLVKPTDEP-ELPKHRRGSLR----DRERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVIL---------------------STSRPVPLA----VKYFFDLLDEQAISHGINDPETIHIWKTNSLPLRFW 1954          
BLAST of Plexin B-4 vs. Ensembl Xenopus
Match: PLXNB1 (plexin B1 [Source:NCBI gene;Acc:100498269])

HSP 1 Score: 118.627 bits (296), Expect = 1.899e-26
Identity = 141/538 (26.21%), Postives = 235/538 (43.68%), Query Frame = 2
Query:  695 IYVKMYKRKTFSILAEACSVELTVEEMRNIKLQ--KMAFLDYQTAPDSLSTLTKLNIGILLPL--------NIF--------LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA--LPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            I V +Y+RK+   L +   V++ +E +        K  F D  T    +  LT   +G  +P          IF        L R+  V E R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q  +    + +  + + + E ++ NW+++C+Y +F  D AG+ L+ L R I+ ++  G +D  T KA+Y L+ ++L  +  +Y  L+++  +Q      N+ I   E     L V +L  D+I+QVK KILD+             N   +D    + +  HL       IL D D T+V   +   + +VNTLQHY++ +   +      L K I+      +PG  + TP+            H+++  D      K R   LR     + RA    E  L  LL+ K ++  F++  FQ IL                     STS+ +  +    V YFF +LD+ A    + + ET+ +WK   L LRFW
Sbjct: 1465 IIVLIYRRKSKQALRDYKKVQIQLENLETSVRDRCKKEFTDLMT---EMMDLTSDLVGTGIPFLDYKSYAERIFFPGHRESPLQRDLDVPEGRRQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVSLHGKLEYFTDILKTLLNDLVEQY-VAKNPKLMLRRTETVVEKLLTNWMSICLY-TFVRDSAGEPLYMLFRGIKHQVDKGPVDCVTGKAKYTLNDNRLLRDDVEYKTLTLNAIMQT-----NTGITCEE-EAQGLPVKLLDCDTITQVKEKILDQIYKGTPYCN--RPNPEALDLEWRSGLAGHL-------ILSDEDLTSV---VHGSWKRVNTLQHYKVPDGATVALVPR-LSKHIHPENHDYIPG--EKTPMLEDSDEGGVRVWHLVKPTDEP-ELPKHRRGSLR----DRERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVIL---------------------STSRPVPLA----VKYFFDLLDEQAISHGINDPETIHIWKTNSLPLRFW 1946          
BLAST of Plexin B-4 vs. Ensembl Xenopus
Match: PLXNB1 (plexin B1 [Source:NCBI gene;Acc:100498269])

HSP 1 Score: 118.627 bits (296), Expect = 2.103e-26
Identity = 141/538 (26.21%), Postives = 235/538 (43.68%), Query Frame = 2
Query:  695 IYVKMYKRKTFSILAEACSVELTVEEMRNIKLQ--KMAFLDYQTAPDSLSTLTKLNIGILLPL--------NIF--------LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA--LPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            I V +Y+RK+   L +   V++ +E +        K  F D  T    +  LT   +G  +P          IF        L R+  V E R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q  +    + +  + + + E ++ NW+++C+Y +F  D AG+ L+ L R I+ ++  G +D  T KA+Y L+ ++L  +  +Y  L+++  +Q      N+ I   E     L V +L  D+I+QVK KILD+             N   +D    + +  HL       IL D D T+V   +   + +VNTLQHY++ +   +      L K I+      +PG  + TP+            H+++  D      K R   LR     + RA    E  L  LL+ K ++  F++  FQ IL                     STS+ +  +    V YFF +LD+ A    + + ET+ +WK   L LRFW
Sbjct: 1477 IIVLIYRRKSKQALRDYKKVQIQLENLETSVRDRCKKEFTDLMT---EMMDLTSDLVGTGIPFLDYKSYAERIFFPGHRESPLQRDLDVPEGRRQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVSLHGKLEYFTDILKTLLNDLVEQY-VAKNPKLMLRRTETVVEKLLTNWMSICLY-TFVRDSAGEPLYMLFRGIKHQVDKGPVDCVTGKAKYTLNDNRLLRDDVEYKTLTLNAIMQT-----NTGITCEE-EAQGLPVKLLDCDTITQVKEKILDQIYKGTPYCN--RPNPEALDLEWRSGLAGHL-------ILSDEDLTSV---VHGSWKRVNTLQHYKVPDGATVALVPR-LSKHIHPENHDYIPG--EKTPMLEDSDEGGVRVWHLVKPTDEP-ELPKHRRGSLR----DRERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVIL---------------------STSRPVPLA----VKYFFDLLDEQAISHGINDPETIHIWKTNSLPLRFW 1958          
BLAST of Plexin B-4 vs. Ensembl Xenopus
Match: PLXNB1 (plexin B1 [Source:NCBI gene;Acc:100498269])

HSP 1 Score: 118.627 bits (296), Expect = 2.177e-26
Identity = 141/538 (26.21%), Postives = 235/538 (43.68%), Query Frame = 2
Query:  695 IYVKMYKRKTFSILAEACSVELTVEEMRNIKLQ--KMAFLDYQTAPDSLSTLTKLNIGILLPL--------NIF--------LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA--LPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            I V +Y+RK+   L +   V++ +E +        K  F D  T    +  LT   +G  +P          IF        L R+  V E R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q  +    + +  + + + E ++ NW+++C+Y +F  D AG+ L+ L R I+ ++  G +D  T KA+Y L+ ++L  +  +Y  L+++  +Q      N+ I   E     L V +L  D+I+QVK KILD+             N   +D    + +  HL       IL D D T+V   +   + +VNTLQHY++ +   +      L K I+      +PG  + TP+            H+++  D      K R   LR     + RA    E  L  LL+ K ++  F++  FQ IL                     STS+ +  +    V YFF +LD+ A    + + ET+ +WK   L LRFW
Sbjct: 1464 IIVLIYRRKSKQALRDYKKVQIQLENLETSVRDRCKKEFTDLMT---EMMDLTSDLVGTGIPFLDYKSYAERIFFPGHRESPLQRDLDVPEGRRQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVSLHGKLEYFTDILKTLLNDLVEQY-VAKNPKLMLRRTETVVEKLLTNWMSICLY-TFVRDSAGEPLYMLFRGIKHQVDKGPVDCVTGKAKYTLNDNRLLRDDVEYKTLTLNAIMQT-----NTGITCEE-EAQGLPVKLLDCDTITQVKEKILDQIYKGTPYCN--RPNPEALDLEWRSGLAGHL-------ILSDEDLTSV---VHGSWKRVNTLQHYKVPDGATVALVPR-LSKHIHPENHDYIPG--EKTPMLEDSDEGGVRVWHLVKPTDEP-ELPKHRRGSLR----DRERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVIL---------------------STSRPVPLA----VKYFFDLLDEQAISHGINDPETIHIWKTNSLPLRFW 1945          
BLAST of Plexin B-4 vs. Ensembl Mouse
Match: Plxnb1 (plexin B1 [Source:MGI Symbol;Acc:MGI:2154238])

HSP 1 Score: 117.087 bits (292), Expect = 4.901e-26
Identity = 114/454 (25.11%), Postives = 206/454 (45.37%), Query Frame = 2
Query:  887 LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA--LPGIQ----------KLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFW 2200
            L R+  V + R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I++ L+ ++V+Q  +    + +  + + + E ++ NW+++C+Y +F  D  G+ L+ L R I+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++        LL     + E     + V VL  D+ISQ K K+LD+           D+    +++ +  A           +IL D D T+   +L   + ++NTLQHY++ +   +      L K I       +PG +           + P H+++  D      + R   LR    ++ RA    E  L  LL+ K ++  F++  FQ IL                     STS+ +  +    V YFF +LD+ A+Q  ++ ++T+ +WK   L LRFW
Sbjct: 1569 LHRDLGVPDSRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQ-YVAKNPKLMLRRTETVVEKLLTNWMSICLY-TFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNA-------LLAVGPGAGEAQC--VPVKVLDCDTISQAKEKMLDQLYKGVPLAQRPDSCTLDVEWRSGVA---------GHLILSDEDVTS---ELQGLWRRLNTLQHYKVPDGATVAL-VPCLTKHILRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEP-EPPRPRRGSLR--GGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVIL---------------------STSRPVPLA----VKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFW 1970          
BLAST of Plexin B-4 vs. Ensembl Mouse
Match: Plxnb3 (plexin B3 [Source:MGI Symbol;Acc:MGI:2154240])

HSP 1 Score: 115.161 bits (287), Expect = 2.023e-25
Identity = 113/496 (22.78%), Postives = 218/496 (43.95%), Query Frame = 2
Query:  779 NIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDK--AIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYF-----RSNTLDKSIYEVKALPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            +++   + FLDY+T  +       +   +   L         V VR+      +  + NLL +K     LI    E  SF  +++C  A L++L L    +Y   IM+ L+ ++ +   +    + +  + + + E ++ NW+++C+Y +F  + AG+ L+ L RAI+ ++  G +D  T KA+  L+   L  E  ++  L++     + L    +D  +    +  +   VL  D+I+QVK K+LD+      +S+   +    + +D    + +  HL        L D D T+V       + ++NTLQHY++ +   +          T+ +S+ +     G  + TP+            H++++ +     +K+R   LR  + ++ RA    E  L  LL+ K ++  F++  FQ IL+      +                          V Y F  LD++A++  + + ET+ +WK   L+LRFW
Sbjct: 1312 DLEASGIPFLDYRTYAERAFFPGHVGCPLQPGLEGLGEEGRSVTVRQG-----LTQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHVASLLSLALHSKLEYLTDIMRTLLGDLAAH-YVHKNPKLMLRRTETMVEKLLTNWLSICLY-TFLKEVAGEPLYMLFRAIKYQVDKGPVDAVTGKAKRTLNDSHLLREDVEFQPLTL-----MALVGPEADRAAGNSGVHRVPARVLDTDTITQVKEKVLDQIYKGTPFSQRPSV----HSLDLEWRSGLAGHL-------TLSDEDLTSV---TQNHWKRLNTLQHYKVPDGATVVLIPQVHNGGTVSQSLGQTGCPSG--ENTPMLEDGEEGGVRLWHLVKATE-EAEGAKVRRSSLRDRERERSRAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSMNRPVPI-------------------------AVKYLFDFLDELAEKHGIEDPETLHIWKTNSLLLRFW 1753          
BLAST of Plexin B-4 vs. Ensembl Mouse
Match: Plxnb2 (plexin B2 [Source:MGI Symbol;Acc:MGI:2154239])

HSP 1 Score: 110.538 bits (275), Expect = 4.562e-24
Identity = 105/441 (23.81%), Postives = 193/441 (43.76%), Query Frame = 2
Query:  908 EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPG-----IQKLTPI-HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFW 2200
            E R+     ++    NLL +K      I        F  + K   A L+T+ L    +Y+  IM+ L   ++ Q  +    + +  + + + E ++ NW+++C+Y   K D AG+ L+ L +AI+ +++ G +D    KA+Y L+   L  +  +Y  L++ V VQ      +  I++       + V VL+ D+ISQVK KI+D+          +        +   ++++L     S   IL D D T+   + +  + ++NTL HY +++   L      + +   + +  LPG     +++   + H++     R TD        R    +K R     E  L  LL+ K ++  F++ FFQ++L                            ++    V YFF  LD+ A++  +  E+T+ +WK   L LRFW
Sbjct: 1310 ESRRPIVEQALYQFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLK-DSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQ------DEGIDA-------IPVKVLNCDTISQVKEKIIDQ----------VYRTQPCSCWPKPDSVVLEWRPGSTAQILSDLDLTS---QREGRWKRINTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLV-----RPTDEVDEGKSKRGSMKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLA-------------------------PGHAVPPAVKYFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFW 1693          
BLAST of Plexin B-4 vs. Ensembl Mouse
Match: Plxnb2 (plexin B2 [Source:MGI Symbol;Acc:MGI:2154239])

HSP 1 Score: 110.538 bits (275), Expect = 4.562e-24
Identity = 105/441 (23.81%), Postives = 193/441 (43.76%), Query Frame = 2
Query:  908 EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPG-----IQKLTPI-HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFW 2200
            E R+     ++    NLL +K      I        F  + K   A L+T+ L    +Y+  IM+ L   ++ Q  +    + +  + + + E ++ NW+++C+Y   K D AG+ L+ L +AI+ +++ G +D    KA+Y L+   L  +  +Y  L++ V VQ      +  I++       + V VL+ D+ISQVK KI+D+          +        +   ++++L     S   IL D D T+   + +  + ++NTL HY +++   L      + +   + +  LPG     +++   + H++     R TD        R    +K R     E  L  LL+ K ++  F++ FFQ++L                            ++    V YFF  LD+ A++  +  E+T+ +WK   L LRFW
Sbjct: 1310 ESRRPIVEQALYQFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLK-DSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQ------DEGIDA-------IPVKVLNCDTISQVKEKIIDQ----------VYRTQPCSCWPKPDSVVLEWRPGSTAQILSDLDLTS---QREGRWKRINTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLV-----RPTDEVDEGKSKRGSMKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLA-------------------------PGHAVPPAVKYFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFW 1693          
BLAST of Plexin B-4 vs. Ensembl Mouse
Match: Plxnd1 (plexin D1 [Source:MGI Symbol;Acc:MGI:2154244])

HSP 1 Score: 105.145 bits (261), Expect = 2.027e-22
Identity = 116/478 (24.27%), Postives = 221/478 (46.23%), Query Frame = 2
Query:  953 NLLLNKEKCFKLISNFNENHSFDNKNKCAL--LITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAI--MEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFR-SNTLDKSIYEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEI 2368
            +LL NK      +    +   F  +++C+L  L+T+ L    +Y+ +IMKEL+ +++  A      + +  + + + E ++ NW+++CMY   + +  G+  F L+ AI+ ++  G ID  T KARY L+ + L  E+             I+ K  N +++     + +L V  +  D+++QVK KIL+     + YS+     A D  +++  S+         +   +L D D T+V   ++    ++NTL HY+I     L    ++  D ++  VK L   +K    H++   D      K           Q  R  +  E  L  LL+TK ++  F++  F+ IL+ + +                             V YFF  L++ A++  +++ +T+ +WK   L LRFW++I+ NP  +F ++K+++I   L  I +   ++ SI+   +   S   + L+ +EI
Sbjct: 1415 SLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKELLVDLID-ASAAKNPKLMLRRTESVVEKMLTNWMSICMYGCLR-ETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLREN-------------IEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQW--PRAEDVDLEWFASS---------TQSYVLRDLDDTSV---VEDGRKKLNTLAHYKIPEGASLAMSLTDKKDSTLGRVKDL-DTEKY--FHLVLPTDELVEPKK--------SHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPP------------------------LAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEI 1828          
BLAST of Plexin B-4 vs. UniProt/SwissProt
Match: sp|O43157|PLXB1_HUMAN (Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3)

HSP 1 Score: 121.324 bits (303), Expect = 1.723e-26
Identity = 131/535 (24.49%), Postives = 236/535 (44.11%), Query Frame = 2
Query:  695 IYVKMYKRKTFSILAEACSVELTVEEMRNIKLQ--KMAFLDYQTAPDSLSTLTKLNIGILLPL--------NIF--------LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPGIQ----------KLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFW 2200
            I V MY+RK+   L +   V++ +E + +      K  F D  T    ++ LT   +G  +P          IF        L R+  V E R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I++ L+ ++V+Q  +    + +  + + + E ++ NW+++C+Y +F  D  G+ L+ L R I+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++        LL     + E     + V VL  D+ISQ K K+LD+           D     +++ +  A           +IL D D T+   ++   + ++NTLQHY++ +   +          + E +  +PG +           + P H+++  D      + R   LR    ++ RA    E  L  LL+ K ++  F++  FQ IL                     STS+ +  +    V YFF +LD+ A+Q  ++ ++T+ +WK   L LRFW
Sbjct: 1506 IIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMT---EMTDLTSDLLGSGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQ-YVAKNPKLMLRRTETVVEKLLTNWMSICLY-TFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNA-------LLAVGPGAGEAQ--GVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVA---------GHLILSDEDVTS---EVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEP-EPPRPRRGSLR--GGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVIL---------------------STSRPVPLA----VKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFW 1986          
BLAST of Plexin B-4 vs. UniProt/SwissProt
Match: sp|Q8CJH3|PLXB1_MOUSE (Plexin-B1 OS=Mus musculus OX=10090 GN=Plxnb1 PE=1 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 3.428e-25
Identity = 114/454 (25.11%), Postives = 206/454 (45.37%), Query Frame = 2
Query:  887 LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA--LPGIQ----------KLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFW 2200
            L R+  V + R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I++ L+ ++V+Q  +    + +  + + + E ++ NW+++C+Y +F  D  G+ L+ L R I+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++        LL     + E     + V VL  D+ISQ K K+LD+           D+    +++ +  A           +IL D D T+   +L   + ++NTLQHY++ +   +      L K I       +PG +           + P H+++  D      + R   LR    ++ RA    E  L  LL+ K ++  F++  FQ IL                     STS+ +  +    V YFF +LD+ A+Q  ++ ++T+ +WK   L LRFW
Sbjct: 1569 LHRDLGVPDSRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQ-YVAKNPKLMLRRTETVVEKLLTNWMSICLY-TFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNA-------LLAVGPGAGEAQC--VPVKVLDCDTISQAKEKMLDQLYKGVPLAQRPDSCTLDVEWRSGVA---------GHLILSDEDVTS---ELQGLWRRLNTLQHYKVPDGATVAL-VPCLTKHILRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEP-EPPRPRRGSLR--GGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVIL---------------------STSRPVPLA----VKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFW 1970          
BLAST of Plexin B-4 vs. UniProt/SwissProt
Match: sp|Q9QY40|PLXB3_MOUSE (Plexin-B3 OS=Mus musculus OX=10090 GN=Plxnb3 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 1.415e-24
Identity = 113/496 (22.78%), Postives = 218/496 (43.95%), Query Frame = 2
Query:  779 NIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDK--AIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYF-----RSNTLDKSIYEVKALPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            +++   + FLDY+T  +       +   +   L         V VR+      +  + NLL +K     LI    E  SF  +++C  A L++L L    +Y   IM+ L+ ++ +   +    + +  + + + E ++ NW+++C+Y +F  + AG+ L+ L RAI+ ++  G +D  T KA+  L+   L  E  ++  L++     + L    +D  +    +  +   VL  D+I+QVK K+LD+      +S+   +    + +D    + +  HL        L D D T+V       + ++NTLQHY++ +   +          T+ +S+ +     G  + TP+            H++++ +     +K+R   LR  + ++ RA    E  L  LL+ K ++  F++  FQ IL+      +                          V Y F  LD++A++  + + ET+ +WK   L+LRFW
Sbjct: 1312 DLEASGIPFLDYRTYAERAFFPGHVGCPLQPGLEGLGEEGRSVTVRQG-----LTQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHVASLLSLALHSKLEYLTDIMRTLLGDLAAH-YVHKNPKLMLRRTETMVEKLLTNWLSICLY-TFLKEVAGEPLYMLFRAIKYQVDKGPVDAVTGKAKRTLNDSHLLREDVEFQPLTL-----MALVGPEADRAAGNSGVHRVPARVLDTDTITQVKEKVLDQIYKGTPFSQRPSV----HSLDLEWRSGLAGHL-------TLSDEDLTSV---TQNHWKRLNTLQHYKVPDGATVVLIPQVHNGGTVSQSLGQTGCPSG--ENTPMLEDGEEGGVRLWHLVKATE-EAEGAKVRRSSLRDRERERSRAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSMNRPVPI-------------------------AVKYLFDFLDELAEKHGIEDPETLHIWKTNSLLLRFW 1753          
BLAST of Plexin B-4 vs. UniProt/SwissProt
Match: sp|B2RXS4|PLXB2_MOUSE (Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 3.191e-23
Identity = 105/441 (23.81%), Postives = 193/441 (43.76%), Query Frame = 2
Query:  908 EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPG-----IQKLTPI-HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFW 2200
            E R+     ++    NLL +K      I        F  + K   A L+T+ L    +Y+  IM+ L   ++ Q  +    + +  + + + E ++ NW+++C+Y   K D AG+ L+ L +AI+ +++ G +D    KA+Y L+   L  +  +Y  L++ V VQ      +  I++       + V VL+ D+ISQVK KI+D+          +        +   ++++L     S   IL D D T+   + +  + ++NTL HY +++   L      + +   + +  LPG     +++   + H++     R TD        R    +K R     E  L  LL+ K ++  F++ FFQ++L                            ++    V YFF  LD+ A++  +  E+T+ +WK   L LRFW
Sbjct: 1310 ESRRPIVEQALYQFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLK-DSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQ------DEGIDA-------IPVKVLNCDTISQVKEKIIDQ----------VYRTQPCSCWPKPDSVVLEWRPGSTAQILSDLDLTS---QREGRWKRINTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLV-----RPTDEVDEGKSKRGSMKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLA-------------------------PGHAVPPAVKYFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFW 1693          
BLAST of Plexin B-4 vs. UniProt/SwissProt
Match: sp|O15031|PLXB2_HUMAN (Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3)

HSP 1 Score: 109.768 bits (273), Expect = 5.846e-23
Identity = 105/441 (23.81%), Postives = 191/441 (43.31%), Query Frame = 2
Query:  908 EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPG-----IQKLTPI-HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFW 2200
            E R+     ++    NLL +K      I        F  + K   A L+T+ L    +Y+  IM  L   ++ Q  +    + +  + + + E ++ NW+++C+Y   K D AG+ L+ L +AI+ +++ G +D    KA+Y L+   L  +  +Y  L++ V VQ +              +  + V VL+ D+ISQVK KI+D+          +        +   ++++L     S   IL D D T+   + +  + +VNTL HY +++   L      + +   + +  LPG     +++   + H++     R TD        R    +K R     E  L  LL+ K ++  F++ FFQ++L                            ++    V YFF  LD+ A++ ++  E+T+ +WK   L LRFW
Sbjct: 1306 EPRRPVVEQALYQFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELLEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLK-DSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDE-------------GVDAIPVKVLNCDTISQVKEKIIDQ----------VYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTS---QREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLV-----RPTDEVDEGKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLA-------------------------PGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFW 1689          
BLAST of Plexin B-4 vs. TrEMBL
Match: A0A0K0LJ73 (Plexin B-4 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=plxnB-4 PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 3.392e-51
Identity = 153/432 (35.42%), Postives = 241/432 (55.79%), Query Frame = 2
Query: 1160 KYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSK----LGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPGIQKLTPIHII--QSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINST--SVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKE 2428
            K + I E+I++NW+T+CMY +FK  E G+ LF L RA++C++ SG++D ++ K++Y LS   L   + DY+ L++ V V +Q+K++++ IN W I+L N+ + +LSLD++SQVK KILDKAIM Y K    L     N   I   N +  LL+   +  +V L +FD+T++ +   K++I  NT++HY IK+  KL   S  L    +  + L    KLT IH++  +  +    ++K  S    + Q    + ++N  S L  LL TKK+I  FI+ FF+++        +    NS   +   S   + +  + + V+Y FSML+DIA  +S+ + E ++ WK    I  FW   I NPN IFS++    +  SL  I  +L  S S  S+  S    SSI  Q+F+E+I   Y  WW  F+NSK  + E
Sbjct:    2 KPESIAELIVENWLTICMYENFKACEEGQTLFSLYRALKCQINSGLVDEFSKKSQYSLSPSYLLPNNLDYETLNVFVSVNVQIKMMDASINPWTISLINIPIIILSLDTVSQVKAKILDKAIMMYLKGEHSLFTDSENKQTIAESNLDNFLLYFFHNKVKVNLANFDKTSILLPGKKKFIVANTMKHYNIKSDNKLLLTSENLLN--FNERHLLTDDKLTKIHLLIPKEAEISTIENKKNSKKKLIFQPAVDKENIN--SSLFILLTTKKNINDFIHNFFKSLT-----TDIPCQSNSKVFSSQSSYQINQERKFFH-VFYLFSMLEDIATSISINDTEEIKSWKINSFINAFWSKAIRNPNKIFSVEVDSSLFASLNVIAEVLLTSCSQESSILSFKTGSSISTQIFHEDITTTYIHWWNSFLNSKRKIPE 423          
BLAST of Plexin B-4 vs. TrEMBL
Match: A0A0K0LJ04 (Plexin B-5 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=plxnB-5 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 7.695e-36
Identity = 92/250 (36.80%), Postives = 148/250 (59.20%), Query Frame = 2
Query: 1025 KNKCALL--ITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDAND----YVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTL 1756
            K+KC L   +TL L ++PKYF+ ++K L+  ++ +     +E +   K   I+E II  W ++CM+ + K    G+  F L R I+ K +SG++D +++KA+Y LS+D L     DY  L IDV+V++++ L+N +     I +  + V +LSLDSISQ+K KI+DKAIME SKL  I  ++      I   + +A  L  I  + ++ LDDFD T++   +DK  I +NT +HY IK+  KL    +++
Sbjct:   14 KDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNGE--ELIIEMERINVTILSLDSISQIKEKIIDKAIMENSKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKRCIIINTAKHYNIKSGTKLLLTQDSM 261          
BLAST of Plexin B-4 vs. TrEMBL
Match: A0A1A8PH08 (Plexin b1b (Fragment) OS=Nothobranchius rachovii OX=451742 GN=PLXNB1B PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.168e-28
Identity = 131/489 (26.79%), Postives = 224/489 (45.81%), Query Frame = 2
Query:  794 KMAFLDYQTAPDSLSTLTKLN----IGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            ++ FLDY+T  D +  L   +    + I   L+I        E RKA    ++    NLL +K      I     +H F+ + K   A L+T+ L    +Y+  IM+ L+  ++ +       + +  + + + E ++ NW+++C+Y +F  D AG++L+ L RAI+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++V VQ      +  +N  ++    L + VL  D+I+QVK K+LD+     S       N   +++ +  A           +IL D D T+V   L   + ++NTLQHY++ +   +           Y+    LPG  + TP+            H++++ +      K R   LR    ++ RA    E  L  LL+ K ++  F++  F  IL                     STS+ +  S    V YFF +LDD A Q  +T+ ET+ +WK   L LRFW
Sbjct:  402 RIPFLDYKTYTDRVFFLPSKDGANDVMITGKLDI-------PEARKAMVTQALNQFSNLLNSKTFLINFIRTLERSHDFNARAKVYFASLLTVALHGKLEYYTDIMRTLLLELMEEYVQSKNPKLMLRRTETVVEKLLTNWMSICLY-AFLRDSAGESLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYKTLTLNVLVQ------SGGVNETQL----LPIKVLDCDTITQVKEKLLDQVYKGTSFSHRPHGNSLDLEWRSGVA---------GHLILSDEDLTSV---LQGNWKRLNTLQHYKVPDGATVALVPRHTKNIHYDSHDFLPG--EKTPMLEDADEGGVKLWHLVKASEEPEL-PKHRRGSLR----ERERAKAIPEIYLTRLLSMKGTLQKFVDDLFTVIL---------------------STSRPVPLS----VKYFFDLLDDQAGQHCITDSETIHIWKTNSLPLRFW 828          
BLAST of Plexin B-4 vs. TrEMBL
Match: A0A1A8EK64 (Plexin b1b (Fragment) OS=Nothobranchius korthausae OX=1143690 GN=PLXNB1B PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 7.262e-27
Identity = 123/448 (27.46%), Postives = 210/448 (46.88%), Query Frame = 2
Query:  908 EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIY--EVKALPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            E R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q  +    + +  + + + E ++ NW+++C+Y +F  D AG++L+ L RAI+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++V VQ      +  +N  ++    L + VL  D+I+QVK K+LD+     S       N   +++ +  A           +IL D D T+V   L   + ++NTLQHY++ +   +        KSI+      LPG  + TP+            H++++ +      K R   LR    ++ RA    E  L  LL+ K ++  F++  F  IL                     STS+ +  S    V YFF +LDD A Q  +T+ ET+ +WK   L LRFW
Sbjct:   81 ECRRQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLNDLVEQY-VAKNPKLMLRRTETVVEKLLTNWMSICLY-AFLRDSAGESLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYKTLTLNVLVQ------SGGVNDTQL----LPIKVLDCDTITQVKEKLLDQVYKGTSFSHRPHGNSLDLEWRSGVA---------GHLILSDEDLTSV---LQGNWKRLNTLQHYKVPDGATVALVPRHT-KSIHYDSHDCLPG--EKTPMLEDADEGGVKLWHLVKASEEPEL-PKHRRGSLR----ERERAKAIPEIYLTRLLSMKGTLQKFVDDLFTVIL---------------------STSRPVPLS----VKYFFDLLDDQAGQHCITDSETIHIWKTNSLPLRFW 471          
BLAST of Plexin B-4 vs. TrEMBL
Match: A0A1A8IM24 (Plexin b1b (Fragment) OS=Nothobranchius kuhntae OX=321403 GN=PLXNB1B PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 7.752e-27
Identity = 121/447 (27.07%), Postives = 208/447 (46.53%), Query Frame = 2
Query:  908 EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            E R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q  +    + +  + + + E ++ NW+++C+Y +F  D AG++L+ L RAI+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++V VQ      +  +N  ++    L + VL  D+I+QVK K+LD+     S       N   +++ +  A           +IL D D T+V   L   + ++NTLQHY++ +   +           Y+    LPG  + TP+            H++++ +      K R   LR    ++ RA    E  L  LL+ K ++  F++  F  IL                     STS+ +  S    V YFF +LDD A Q  +T+ ET+ +WK   L LRFW
Sbjct:  432 ECRRQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLNDLVEQY-VAKNPKLMLRRTETVVEKLLTNWMSICLY-AFLRDSAGESLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYKTLTLNVLVQ------SGGVNETQL----LPIKVLDCDTITQVKEKLLDQVYKGTSFSHRPHGNSLDLEWRSGVA---------GHLILSDEDLTSV---LQGNWKRLNTLQHYKVPDGATVALVPRHTKNIHYDSHDFLPG--EKTPMLEDADEGGVKLWHLVKASEEPEL-PKHRRGSLR----ERERAKAIPEIYLTRLLSMKGTLQKFVDDLFTVIL---------------------STSRPVPLS----VKYFFDLLDDQAGQHCITDSETIHIWKTNSLPLRFW 822          
BLAST of Plexin B-4 vs. Ensembl Cavefish
Match: plxnb1a (plexin b1a [Source:ZFIN;Acc:ZDB-GENE-050302-63])

HSP 1 Score: 121.324 bits (303), Expect = 2.117e-27
Identity = 124/462 (26.84%), Postives = 214/462 (46.32%), Query Frame = 2
Query:  887 LSRNYKVEV-RKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQ-----AKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKA--IMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            L R+  V   R+A     +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q      KL+        + + + E ++ NW+++C+Y +F  D AG++ + L RAI+ ++  G +D  T KA+Y L+ ++L  E  +Y  L      +  L +++  I    + +P  V+D    D+I+QVK KIL++      YS+    D+    +       M  HL       IL D D T+V   +   + ++NTLQHY++ +   +   S    +  ++    +PG  + TP+            H++++ +     SK R   LR  + ++ RA    E  L  LL+ K ++  F++  F  IL                     STS+ +  +    V YFF +LDD A Q ++T+ ET+ +WK   L LRFW
Sbjct: 1553 LRRDLDVPACRRATVEQGLVQLSNLLNSKLFLTKFIHTLEGQRTFSPRDRANVASLLTVALHGKLEYFTDILKTLLSHLVEQYTNKNPKLM------LRRTESVVEKLLTNWMSICLY-TFLRDSAGESFYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYRTLPSFQFGKTLLTMISPGIGK-ALTVPTKVLDC---DTITQVKEKILEQTWKGTSYSQRPSTDS----VHLEWRAGMAGHL-------ILSDEDLTSV---VQGTWKRLNTLQHYKVPDGATVTLVSRQSKQVHHDSHDYIPG--EKTPMLEDGDEGGMRLWHLVKA-NEEPELSKHRRGSLR--ERERERAKAIPEIYLTRLLSMKGTLQKFVDDLFTVIL---------------------STSRPVPLA----VKYFFDLLDDQAAQHNITDPETIHIWKTNSLPLRFW 1959          
BLAST of Plexin B-4 vs. Ensembl Cavefish
Match: plxnb1b (plexin b1b [Source:ZFIN;Acc:ZDB-GENE-090812-4])

HSP 1 Score: 118.242 bits (295), Expect = 1.839e-26
Identity = 123/457 (26.91%), Postives = 210/457 (45.95%), Query Frame = 2
Query:  887 LSRNYKVE-VRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAI--MEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKN---------HMKLYFRSN----TLDKSIYEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            L R+  V+  R+A     +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q  +    + +  + + + E ++ NW+++C+Y +F  D AG+ L+ L RAI+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++V +Q         +N  +     +   VL  D+I+QVK KILD+      YS     D+    +D    + +  HL       IL D D T+V   +   + ++NTLQHY++ +         H K     N      +K+     A  G  +L   H++++ +      K R   LR    ++ RA    E  L  LL+ K ++  F++  F  IL                     STS+ +  +    V YFF +LDD A    +++ ET+ +WK   L LRFW
Sbjct: 1549 LRRDLDVQDCRRATVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLNDLVEQ-YVAKNPKLMLRRTETVVEKLLTNWMSICLY-AFLRDSAGECLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDLEYRTLTVNVLMQ------GVGVNETQ----PVAAKVLDCDTITQVKEKILDQVYKGTSYSHRPHTDS----LDLEWRSGVAGHL-------ILSDEDLTSV---VQGNWKRLNTLQHYKVPDGATVALVPRHSKHIHHDNHDYVAGEKTPMLEDADEGGVRL--WHLVKASEEP-ELPKHRRGSLR----ERERAKAIPEIYLTRLLSMKGTLQKFVDDLFTVIL---------------------STSRPVPLA----VKYFFDLLDDQAAHHGISDSETIHIWKTNSLPLRFW 1947          
BLAST of Plexin B-4 vs. Ensembl Cavefish
Match: plxnb3 (plexin B3 [Source:ZFIN;Acc:ZDB-GENE-081104-53])

HSP 1 Score: 110.923 bits (276), Expect = 2.901e-24
Identity = 121/487 (24.85%), Postives = 212/487 (43.53%), Query Frame = 2
Query:  797 MAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNK--CALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDK--AIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNH--MKLYFRSNTLDKSIYEVKALPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            + FLDY+T  + +        G  L  N+ L  + +  V +     +      L L +      I    E  +F  +++   A L+T+ L    +YF  +MK L+ ++V Q  +    + +  + + + E ++ NW+++C+Y SF  + AG+ L+ L RAI+ ++  G +D  T KA+  L+   L  E  DY  +++ V V+  +++                V VL  D+I+QVK KILD+      +S+    D+ D     G +     HL        L D D T +   +   + ++NTLQHY++ +   + L  RS++    I  +  +    + TP+            H+I+S +      K R   +R    ++ RA    E  L  LL+ K ++  F++  F  IL+ K    +                          V +FF  LDD+A++  + + ETV +WK   L LRFW
Sbjct: 1336 IPFLDYRTYAERI--FFPGQRGAPLSQNLDLPESRRPTVEQGLGQLNNLLNNRLFLTR-----FIHTLEEQQNFSQRDRGYVASLLTMALHDKLEYFTDVMKTLLGDLVQQ-YVAKNPKLMLRRTETVVEKMLTNWMSICLY-SFLKEVAGEPLYMLYRAIKYQVDKGPVDAVTGKAKRTLNDSHLLREDIDYCSITLTVLVKSGMEVQPCP------------VKVLDTDTITQVKDKILDQIYKGAPFSQRPSADSLDLEWRSGQAG----HL-------TLSDDDVTAI---VQGHWKRLNTLQHYKVPDGATVALIPRSSS---GILSINQIYQTGEKTPMLEGGEDEGLRLWHLIKSSEEP-EIPKHRKSSMR----ERERAKAIPEIYLTRLLSMKGTLQKFVDDVFVAILSTKRPPPI-------------------------AVRFFFDFLDDMAEKHGIDDPETVHIWKTNSLPLRFW 1754          
BLAST of Plexin B-4 vs. Ensembl Cavefish
Match: plxnb3 (plexin B3 [Source:ZFIN;Acc:ZDB-GENE-081104-53])

HSP 1 Score: 110.538 bits (275), Expect = 3.491e-24
Identity = 121/487 (24.85%), Postives = 212/487 (43.53%), Query Frame = 2
Query:  797 MAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNK--CALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDK--AIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNH--MKLYFRSNTLDKSIYEVKALPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            + FLDY+T  + +        G  L  N+ L  + +  V +     +      L L +      I    E  +F  +++   A L+T+ L    +YF  +MK L+ ++V Q  +    + +  + + + E ++ NW+++C+Y SF  + AG+ L+ L RAI+ ++  G +D  T KA+  L+   L  E  DY  +++ V V+  +++                V VL  D+I+QVK KILD+      +S+    D+ D     G +     HL        L D D T +   +   + ++NTLQHY++ +   + L  RS++    I  +  +    + TP+            H+I+S +      K R   +R    ++ RA    E  L  LL+ K ++  F++  F  IL+ K    +                          V +FF  LDD+A++  + + ETV +WK   L LRFW
Sbjct: 1331 IPFLDYRTYAERI--FFPGQRGAPLSQNLDLPESRRPTVEQGLGQLNNLLNNRLFLTR-----FIHTLEEQQNFSQRDRGYVASLLTMALHDKLEYFTDVMKTLLGDLVQQ-YVAKNPKLMLRRTETVVEKMLTNWMSICLY-SFLKEVAGEPLYMLYRAIKYQVDKGPVDAVTGKAKRTLNDSHLLREDIDYCSITLTVLVKSGMEVQPCP------------VKVLDTDTITQVKDKILDQIYKGAPFSQRPSADSLDLEWRSGQAG----HL-------TLSDDDVTAI---VQGHWKRLNTLQHYKVPDGATVALIPRSSS---GILSINQIYQTGEKTPMLEGGEDEGLRLWHLIKSSEEP-EIPKHRKSSMR----ERERAKAIPEIYLTRLLSMKGTLQKFVDDVFVAILSTKRPPPI-------------------------AVRFFFDFLDDMAEKHGIDDPETVHIWKTNSLPLRFW 1749          
BLAST of Plexin B-4 vs. Ensembl Cavefish
Match: plxnb2a (plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917])

HSP 1 Score: 108.227 bits (269), Expect = 1.924e-23
Identity = 132/542 (24.35%), Postives = 245/542 (45.20%), Query Frame = 2
Query:  794 KMAFLDYQTAPDSLSTLTKLNIG--ILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAI--MEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKN----------HMKLYFRSNTLDKSIYEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIA-KQLSVTEETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEI 2368
            ++ FLDY+T  D +  L   +    +++   + +  N     R+A  + ++    NLL +K      I        F+ ++K   A L+T+ L    +Y+  IM+ L+  ++ +       + +  + + + E ++ NW+++C+Y  F  D AG+ L+ L +AI+ +++ G +D    KA+Y L+   L  +  +Y VL++ V V  +      D+           V VL+ D+ISQVK KI+++    + YS+   +D            ++ L     S   IL D D T+   + +  + ++NTL HY +++          H +  F  N    S  E  AL    K+   H+++  D    D K +   ++   + K   ++     L  LL+ K ++  F++ FF+++L                      T   +  +    V YFF  LD+ A K  +V EET+ +WK   L LRFW++I+ NP+ IF +  +E +  SL  I +   ++ +     +T  S   + L+ +EI
Sbjct: 1272 RIPFLDYKTYTDRVFFLPSKDGANDVMITGKLDIPEN-----RRAIVDQALNQFSNLLNSKTFLINFIRTLESQQEFNARSKVYFASLLTVALHGKLEYYTDIMRTLLLELMEEYIHSKNPKLMLRRSETVVERMLCNWMSICLY-QFLKDSAGEPLYKLFKAIKHQVEKGPVDAKMKKAKYTLNDTGLLGDDVEYFVLTLQVLVHGE----GPDVTP---------VKVLNCDTISQVKEKIIEQVYRNLPYSQRPTVD------------SVALEWRPGSTGQILSDLDLTS---QKEGRWKRLNTLAHYNVRDNATLVLSRVLHTQQSFDQN--QDSHEERSALLEDDKV--FHLVRPAD-ELDDVKSKRGSMKDKATTKAITEIY----LTRLLSMKGTLQQFVDDFFRSVL---------------------CTGTVVPPA----VKYFFDFLDEQAHKHENVDEETIHIWKTNSLPLRFWVNILKNPHFIFDVHVTEVVDASLSVIAQTFMDACTKTEHKLTRESPSNKLLYAKEI 1745          
BLAST of Plexin B-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009284.1 (pep scaffold:Pmarinus_7.0:GL476385:264710:288126:-1 gene:ENSPMAG00000008378.1 transcript:ENSPMAT00000009284.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 3.155e-21
Identity = 99/374 (26.47%), Postives = 178/374 (47.59%), Query Frame = 2
Query:  671 GMIGIFGTIYVKMYKRKTFSILAEACSVELTVEEMR-NIKLQ-KMAFLDYQTAPDSLST-LTKLNIGIL---------------LPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNK--CALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAI--MEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNH 1726
            G++ +   I + +Y+RK+   L +   V+  +E++  +++ Q K  F D  T  + +S+ L    I  L                PL   LS     + R+A     +  + NLL +K     +I        F  +++   A L+T+ L    +Y+  I+K L+ ++V Q  +    + +  + + + E ++ NW+++C+Y  F  D AG+ LF L RAI+ +++ G +D    KA+Y L+  +L  E  DY  L I+  V+          NS E     ++V VL  DSI QVK KILD+    + YS+   +D  +  +++ ++ A          Q  L D D T+V   +   ++++NTL+HY++  H
Sbjct:  275 GVVALLVIIVIVVYRRKSKKALRDYRKVQNQLEDLEISVRDQCKKQFSDLMTDMEDMSSDLVVTGIPFLEYRTYRERIFFPGQEAPLAKSLS---VADSRRATMEQGLFHLSNLLNSKLFLTTMIHTLEGQPKFSARDRGCVASLLTVALQDKLEYYTDILKTLLGDLVGQY-VAKNPKLMLRRTETVAEKMLTNWMSVCLY-KFLKDTAGEPLFMLFRAIKQQVEKGPVDGVLRKAKYSLNDTRLLGEDVDYQSLVINATVE----------NSGEEG--PVIVRVLDCDSIGQVKDKILDQVYRNVPYSQRPSVDTVE--LEWRSTFA---------GQFTLSDEDLTSV---VQGRWLRINTLRHYRVSGH 617          
BLAST of Plexin B-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006876.1 (pep scaffold:Pmarinus_7.0:GL486582:611:5415:1 gene:ENSPMAG00000006217.1 transcript:ENSPMAT00000006876.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 8.656e-14
Identity = 41/159 (25.79%), Postives = 81/159 (50.94%), Query Frame = 2
Query:  908 EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVL 1378
            E+R+    + +     LL N++     I    +   F  K++C  A  +T  L  + +Y+  ++KEL+ +++ ++      + +  + + + E ++ NW+++CMY  F  D  G+  F L+ AIR ++  G +D  T +A+Y LS D L  E+ +   L
Sbjct:   48 ELRRQMMEEGIGIFSTLLNNQKFLITFIHTLEQQKDFTVKDRCYLASWLTAALQGNLEYYTAVLKELLVDLI-RSSTNKHPKLMLRRTESVVEKMLTNWMSICMY-GFLRDRVGEPFFLLLTAIRQQISKGPVDAVTGRAKYTLSEDWLLRENIEATAL 204          
BLAST of Plexin B-4 vs. Ensembl Nematostella
Match: EDO39009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBD7])

HSP 1 Score: 127.102 bits (318), Expect = 1.138e-29
Identity = 130/504 (25.79%), Postives = 228/504 (45.24%), Query Frame = 2
Query:  935 SVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPK--YFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKN--HMKLYFRSNTLDKSI------YEVKALPGIQ----KLTPIHIIQSCDSRCTDSKLRSIG----------LRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQ 2371
             ++    L+ NKE     +       +F  K++C L   L++    K  Y   I+ +L+ +++ ++   S  + L  + + + E ++ NW+  CMY   K  E+G+ LF + +AI+ ++  G +D  T +ARY LS D+L  ++ DY+ + ++V  + Q               P  +V VL  DS+SQ K K+LD           ++A    +D+        HL   S + + DD D ++V   ++ ++ ++NTL HY++ +  ++KL  R +    S       +  ++LP +       TPI       SR +   L   G             D+     + +  E  L  LLATK ++  F++G F ++ N      V                          V Y F +LD  AK+L++++ E +  WK   L LRFWI+I+ NPN IF ++KS  +   L  I +L  ++ SI+   + IHS   + L+ +EI 
Sbjct: 1350 GLRKFSQLIYNKEFLLIFVRTVESQKTFSMKDRCNLASLLMVTLQGKMDYATEILWQLLCDLIRKSVAQSHPKLLLRRTESVAEKLLTNWLAFCMYNHLKV-ESGEPLFMMFKAIKRQVGKGPVDAVTGEARYSLSEDKLLRQTIDYEEIRVNVTFEDQ---------------PPTMVTVLDCDSVSQAKSKMLDAVYKNVPFSSRVEAETLQLDW--------HLTDGSVKPLRDD-DASSV---VEGQWRKLNTLGHYKVTDGANLKLSPRQSYFYSSSNNSERQHHHRSLPRVVFSPFNYTPI-------SRGSREDLDEGGRIWHLVKLLDYPTDKDDTQHSKMLAEIYLTRLLATKGTLQQFVDGLFNSMFNSNCRPPVP-------------------------VKYLFDLLDSQAKELNLSDSEVLHTWKNNSLPLRFWINIVKNPNFIFDIEKSGTVDSCLSVIAQLFMDACSISEHRLGIHSPSNKLLYAKEIP 1793          
BLAST of Plexin B-4 vs. Ensembl Medaka
Match: plxnb1b (plexin-B1 [Source:NCBI gene;Acc:101159664])

HSP 1 Score: 121.709 bits (304), Expect = 1.292e-27
Identity = 121/449 (26.95%), Postives = 210/449 (46.77%), Query Frame = 2
Query:  908 EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAI--MEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKN---------HMKLYFRSN----TLDKSIYEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            E R+      +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q  +    + +  + + + E ++ NW+++C+Y +F  D AG+ L+ L RAI+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++V VQ         +N  +  +P+ V+D    D+I+QVK K+L++      +S    +D+    +D    + +  HL       IL D D T+V   +   + ++NTLQHY++ +         H K     N      +K+     A  G  +L   H++++ +      K R   LR    ++ RA    E  L  LL+ K ++  F++  F  IL                     STS+ +  +    V YFF +LDD A Q  +T+ ET+ +WK   L LRFW
Sbjct: 1571 ESRRQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVALHEKLEYFTDILKTLLNDLVEQ-YVAKNPKLMLRRTETVVEKLLTNWMSICLY-TFLRDSAGEGLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYKTLTLNVLVQ------GGGVNETQ-PVPSKVLDC---DTITQVKEKLLEQVYKGTSFSHRPHVDS----LDLEWRSGVAGHL-------ILSDEDLTSV---IQGSWKRLNTLQHYKVPDGATVALVPRHTKNLHHDNHDYIAGEKTPMLEDADEGGVRL--WHLVKASEEP-ELPKHRRGSLR----ERERAKAIPEIYLTRLLSMKGTLQKFVDDLFMVIL---------------------STSRPVPLA----VKYFFDLLDDQAGQHGITDPETIHIWKTNSLPLRFW 1961          
BLAST of Plexin B-4 vs. Ensembl Medaka
Match: plxnb1a (plexin-B1 [Source:NCBI gene;Acc:101162124])

HSP 1 Score: 119.783 bits (299), Expect = 5.615e-27
Identity = 123/486 (25.31%), Postives = 222/486 (45.68%), Query Frame = 2
Query:  797 MAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKC--ALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKA--IMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKA-LPGIQKLTPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            + FLDY+   + +         +   L+I  SR   VE         +  + NLL +K    K I       +F  +++   A L+T+ L    +YF  I+K L+ ++V Q  +    + +  + + + E ++ NW+++C+Y +F  + AG++ + L RAI+ ++  G +D  T KA+Y L+ ++L  E  +Y  L+++V       ++ +   S    +  +   VL  D+I+QVK K+L++      YS+   ID+ +     G +     HL       IL D D T+V   L   + ++NTLQHY++ +   +   S      +++    +PG  + TP+            H++++ +      K R   +R    +  RA    E  L  LL+ K ++  F++  F  IL                     STS+ +  +    V YFF +LD+ A+Q  +T+ ET+ +WK   L LRFW
Sbjct: 1627 IPFLDYRAYAERIFFPGHQESPLRRDLDIPESRRQTVE-------QGLVQLSNLLNSKLFLIKFIHTLEAQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLNDLVEQ-YVAKNPKLMLRRTESVVEKLLTNWMSICLY-TFLRESAGESFYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYRTLTLNV-------VMPAADASGGSTVQTVPAKVLDCDTITQVKEKVLEQTWKGTSYSQRPHIDSLNLEWRAGVAG----HL-------ILSDEDLTSV---LQGSWKRLNTLQHYKVPDGATVALVSRNNKHLLHDSHDYMPG--EKTPMLDDGDEGGVRLWHLVKAGEEP-EMQKHRRGSMRERGGE--RAKAIPEIYLTRLLSMKGTLQKFVDDLFTAIL---------------------STSRPVPLA----VKYFFDLLDEQAQQHGITDAETIHIWKTNSLPLRFW 2052          
BLAST of Plexin B-4 vs. Ensembl Medaka
Match: plxnb3 (plexin-B1-like [Source:NCBI gene;Acc:101165957])

HSP 1 Score: 115.161 bits (287), Expect = 1.410e-25
Identity = 138/544 (25.37%), Postives = 234/544 (43.01%), Query Frame = 2
Query:  695 IYVKMYKRKTFSILAEACSVELTVEEMR-NIKLQ-KMAFLDYQTAPDSLSTLTKLNIGILLPL--------NIF--------LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNK--CALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAI--MEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPGIQKL------TPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            + + MY+RK+   L +   V L +E M  N+  Q +  F D  T    LS+      G  LPL         +F        LSR   + E R+      ++ + NLL N+    + I        F  +++   A L+T+ L    +YF  +MK L+ ++V Q  +    + +  + + + E ++ NW+++C+Y SF  + AG+ L+ L RAI+ ++  G +D  T KA+  L+   L  E  DY  +++ V V+          N  E+      V VL +D+I+QVK KILD+      +S+    D+ D     G +     HL        L D D T +   +   + ++NTLQHY++ +   +          I   ++  GI ++      TP+            H+++S +      K R   +R    ++ RA    E  L  LL+ K ++  F++  F  ILN K    +                          V +FF  LDD+A++  + + +TV +WK   L LRFW
Sbjct: 1268 VVILMYRRKSKQALRDYKKVLLQLETMEINVGDQCRKEFTDLMTEMMDLSSDVG---GPGLPLLDYRVYAERVFFPGQQMALLSRQLDLPESRRLTVEQGLQQLINLLNNRLFLTRFIHTLEAQQGFSQRDRGYVASLLTIALHDKLEYFTEVMKSLLQDLVQQ-YVTKNPKLMLRRTETVVEKMLTNWMSICLY-SFLKEVAGEPLYMLYRAIKYQVDKGPVDAVTGKAKRTLNDSHLLREDIDYCAMTLTVLVK----------NGVEVQ--PCPVKVLDVDTITQVKDKILDQVYRGAPFSQRPAADSLDLEWRSGQAG----HL-------TLSDDDVTAI---VQGHWKRLNTLQHYKVPDGATVAL--------IPRSQSSGGISQVFQTGEKTPMLEGEEEEGFRLWHLVKSSEDP-EIPKHRKSSMR----ERERAKAIPEIYLTRLLSMKGTLQKFVDDVFVAILNTKRPPPI-------------------------AVRFFFDFLDDMAEKHGIDDPDTVHIWKTNSLPLRFW 1742          
BLAST of Plexin B-4 vs. Ensembl Medaka
Match: plxnb3 (plexin-B1-like [Source:NCBI gene;Acc:101165957])

HSP 1 Score: 115.161 bits (287), Expect = 1.410e-25
Identity = 138/544 (25.37%), Postives = 234/544 (43.01%), Query Frame = 2
Query:  695 IYVKMYKRKTFSILAEACSVELTVEEMR-NIKLQ-KMAFLDYQTAPDSLSTLTKLNIGILLPL--------NIF--------LSRNYKV-EVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNK--CALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAI--MEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPGIQKL------TPI------------HIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTE-ETVELWKCKGLILRFW 2200
            + + MY+RK+   L +   V L +E M  N+  Q +  F D  T    LS+      G  LPL         +F        LSR   + E R+      ++ + NLL N+    + I        F  +++   A L+T+ L    +YF  +MK L+ ++V Q  +    + +  + + + E ++ NW+++C+Y SF  + AG+ L+ L RAI+ ++  G +D  T KA+  L+   L  E  DY  +++ V V+          N  E+      V VL +D+I+QVK KILD+      +S+    D+ D     G +     HL        L D D T +   +   + ++NTLQHY++ +   +          I   ++  GI ++      TP+            H+++S +      K R   +R    ++ RA    E  L  LL+ K ++  F++  F  ILN K    +                          V +FF  LDD+A++  + + +TV +WK   L LRFW
Sbjct: 1268 VVILMYRRKSKQALRDYKKVLLQLETMEINVGDQCRKEFTDLMTEMMDLSSDVG---GPGLPLLDYRVYAERVFFPGQQMALLSRQLDLPESRRLTVEQGLQQLINLLNNRLFLTRFIHTLEAQQGFSQRDRGYVASLLTIALHDKLEYFTEVMKSLLQDLVQQ-YVTKNPKLMLRRTETVVEKMLTNWMSICLY-SFLKEVAGEPLYMLYRAIKYQVDKGPVDAVTGKAKRTLNDSHLLREDIDYCAMTLTVLVK----------NGVEVQ--PCPVKVLDVDTITQVKDKILDQVYRGAPFSQRPAADSLDLEWRSGQAG----HL-------TLSDDDVTAI---VQGHWKRLNTLQHYKVPDGATVAL--------IPRSQSSGGISQVFQTGEKTPMLEGEEEEGFRLWHLVKSSEDP-EIPKHRKSSMR----ERERAKAIPEIYLTRLLSMKGTLQKFVDDVFVAILNTKRPPPI-------------------------AVRFFFDFLDDMAEKHGIDDPDTVHIWKTNSLPLRFW 1742          
BLAST of Plexin B-4 vs. Ensembl Medaka
Match: plxnb2b (plexin-B2 [Source:NCBI gene;Acc:101169201])

HSP 1 Score: 114.39 bits (285), Expect = 2.768e-25
Identity = 137/549 (24.95%), Postives = 245/549 (44.63%), Query Frame = 2
Query:  797 MAFLDYQTAPDSLSTLTKLN----IGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNK--CALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAI--MEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFR--SNTL------DKSIYEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESC--------LMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIA-KQLSVTEETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEI 2368
            + FLDY+T  D +  L   +    + I   L+I        E RK   N ++    NLL +K      I     +H F+ + +  CA L+T+ L    +Y+  IM+ L+  ++ +       + +  + + + E ++ NW+++C+Y  F  D AG+ L+ L RAI+ +++ G +D    KA+Y L+   L  +  +Y VL++ V VQ +              L    V VL+ D+ISQVK KI+++    + YS+    D             + L     S   IL D D T+   + +  + ++NTL HY ++++  +     S+TL       ++  E  AL    K+   H+++  +              +D+ +  R  +  +S         L  LL+ K ++  F++ FF+++L      +V                          V YFF  LD+ A K  +V EET+ +WK   L LRFW++I+ NP+ IF +  SE +  SL  I +   ++ + +   ++  S   + L+ +EI
Sbjct: 1277 IPFLDYKTYTDRVFFLPSKDGANDVMITGKLDI-------PEARKNTVNAALNQFSNLLNSKTFLINFIRTLERSHDFNARARVYCASLLTVALHGKLEYYTDIMRTLLLELMEEYVHSKNPKLMLRRSETVVERMLCNWMSICLY-QFLKDSAGEPLYKLFRAIKHQIEKGPVDARVKKAKYTLNDTGLLGDDVEYSVLNLQVLVQGE-------------GLDVTYVKVLNCDTISQVKEKIIEQVYRNLPYSQRPKAD------------GVTLEWRPGSTGQILSDLDLTS---QKEGRWRRINTLAHYNVRDNATVVLSKVSHTLHNYDQNQENHEERNALLDDDKV--FHLVRPAE-------------ELDEFKSKRGSIKDKSMTKAITEIYLTRLLSVKGTLQQFVDNFFRSVL---CSGAV----------------------VPPAVKYFFDFLDEQALKHNNVDEETIHIWKTNSLPLRFWVNILKNPHFIFDVHVSEVVDASLSVIAQTFMDACTKSEHKLSRDSPSNKLLYAKEI 1749          
BLAST of Plexin B-4 vs. Planmine SMEST
Match: SMESG000033282.1 (SMESG000033282.1)

HSP 1 Score: 1536.16 bits (3976), Expect = 0.000e+0
Identity = 798/806 (99.01%), Postives = 802/806 (99.50%), Query Frame = 2
Query:  101 ESIEYFNRGGYISLFCINKTDDNIILHKQNSYAVNISCNKMKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEAPIFAISELEYYQNRSNLTIGXXXXXXXXXXRLENYHFNFSDVNVLCRQIWNTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGNLYFIVLICIFLIGMIGIFGTIYVKMYKRKTFSILAEACSVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTEETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECKXXXXXXXXXXXXALHSYISKMEKTFILK 2518
            ESIEYFNRGGYISLFCINKTDDNIILHKQNSYAVNISCNKMKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEAPIFAISELEYYQNRSNLTIGVS+KVSISSIRLENYHFNFSDVNVLCRQIWNTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGNLYF VLICIFLIGMIGIFGTIYVKMYKRKTFSILAEA SVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVF +VSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAI+CKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTL+HYQIKNHMKLYFRSNTLDKSI EVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTEETVELWKCKGLILRFWISIISNPNSIFSMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECKIIEIMNNLIEEEALHSYISKMEKTFILK
Sbjct:   23 ESIEYFNRGGYISLFCINKTDDNIILHKQNSYAVNISCNKMKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEAPIFAISELEYYQNRSNLTIGVSNKVSISSIRLENYHFNFSDVNVLCRQIWNTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGNLYFFVLICIFLIGMIGIFGTIYVKMYKRKTFSILAEARSVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVFKLVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIKCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLKHYQIKNHMKLYFRSNTLDKSIDEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTEETVELWKCKGLILRFWISIISNPNSIFSMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECKIIEIMNNLIEEEALHSYISKMEKTFILK 828          
BLAST of Plexin B-4 vs. Planmine SMEST
Match: SMESG000033282.1 (SMESG000033282.1)

HSP 1 Score: 1506.89 bits (3900), Expect = 0.000e+0
Identity = 798/859 (92.90%), Postives = 802/859 (93.36%), Query Frame = 2
Query:  101 ESIEYFNRGGYISLFCINKTDDNIILHKQNSYAVNISCNKMKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEAPIFAISELEYYQNRSNLTIGXXXXXXXXXXRLENYHFNFSDVNVLCRQIWNTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGNLYFIVLICIFLIGMIGIFGTIYVKMYKRKTFSILAEACSVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVL-----------------------------------------------------SIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTEETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECKXXXXXXXXXXXXALHSYISKMEKTFILK 2518
            ESIEYFNRGGYISLFCINKTDDNIILHKQNSYAVNISCNKMKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEAPIFAISELEYYQNRSNLTIGVS+KVSISSIRLENYHFNFSDVNVLCRQIWNTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGNLYF VLICIFLIGMIGIFGTIYVKMYKRKTFSILAEA SVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVF +VSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAI+CKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVL                                                     SIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTL+HYQIKNHMKLYFRSNTLDKSI EVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTEETVELWKCKGLILRFWISIISNPNSIFSMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECKIIEIMNNLIEEEALHSYISKMEKTFILK
Sbjct:   23 ESIEYFNRGGYISLFCINKTDDNIILHKQNSYAVNISCNKMKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEAPIFAISELEYYQNRSNLTIGVSNKVSISSIRLENYHFNFSDVNVLCRQIWNTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGNLYFFVLICIFLIGMIGIFGTIYVKMYKRKTFSILAEARSVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVFKLVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIKCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLIIWKNMIYFSYNETTAYKACVDLYHILCSSCLNCRISGIRTFLFVESYFPRYSSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLKHYQIKNHMKLYFRSNTLDKSIDEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTEETVELWKCKGLILRFWISIISNPNSIFSMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECKIIEIMNNLIEEEALHSYISKMEKTFILK 881          
BLAST of Plexin B-4 vs. Planmine SMEST
Match: SMESG000033282.1 (SMESG000033282.1)

HSP 1 Score: 1455.27 bits (3766), Expect = 0.000e+0
Identity = 758/766 (98.96%), Postives = 762/766 (99.48%), Query Frame = 2
Query:  221 MKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEAPIFAISELEYYQNRSNLTIGXXXXXXXXXXRLENYHFNFSDVNVLCRQIWNTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGNLYFIVLICIFLIGMIGIFGTIYVKMYKRKTFSILAEACSVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTEETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECKXXXXXXXXXXXXALHSYISKMEKTFILK 2518
            MKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEAPIFAISELEYYQNRSNLTIGVS+KVSISSIRLENYHFNFSDVNVLCRQIWNTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGNLYF VLICIFLIGMIGIFGTIYVKMYKRKTFSILAEA SVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVF +VSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAI+CKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTL+HYQIKNHMKLYFRSNTLDKSI EVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTEETVELWKCKGLILRFWISIISNPNSIFSMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECKIIEIMNNLIEEEALHSYISKMEKTFILK
Sbjct:    1 MKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEAPIFAISELEYYQNRSNLTIGVSNKVSISSIRLENYHFNFSDVNVLCRQIWNTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGNLYFFVLICIFLIGMIGIFGTIYVKMYKRKTFSILAEARSVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVFKLVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIKCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLKHYQIKNHMKLYFRSNTLDKSIDEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTEETVELWKCKGLILRFWISIISNPNSIFSMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECKIIEIMNNLIEEEALHSYISKMEKTFILK 766          
BLAST of Plexin B-4 vs. Planmine SMEST
Match: SMESG000033282.1 (SMESG000033282.1)

HSP 1 Score: 1428.69 bits (3697), Expect = 0.000e+0
Identity = 758/819 (92.55%), Postives = 762/819 (93.04%), Query Frame = 2
Query:  221 MKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEAPIFAISELEYYQNRSNLTIGXXXXXXXXXXRLENYHFNFSDVNVLCRQIWNTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGNLYFIVLICIFLIGMIGIFGTIYVKMYKRKTFSILAEACSVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVL-----------------------------------------------------SIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTEETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECKXXXXXXXXXXXXALHSYISKMEKTFILK 2518
            MKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEAPIFAISELEYYQNRSNLTIGVS+KVSISSIRLENYHFNFSDVNVLCRQIWNTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGNLYF VLICIFLIGMIGIFGTIYVKMYKRKTFSILAEA SVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVF +VSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAI+CKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVL                                                     SIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTL+HYQIKNHMKLYFRSNTLDKSI EVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTEETVELWKCKGLILRFWISIISNPNSIFSMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECKIIEIMNNLIEEEALHSYISKMEKTFILK
Sbjct:    1 MKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEAPIFAISELEYYQNRSNLTIGVSNKVSISSIRLENYHFNFSDVNVLCRQIWNTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGNLYFFVLICIFLIGMIGIFGTIYVKMYKRKTFSILAEARSVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVFKLVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIKCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLIIWKNMIYFSYNETTAYKACVDLYHILCSSCLNCRISGIRTFLFVESYFPRYSSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLKHYQIKNHMKLYFRSNTLDKSIDEVKALPGIQKLTPIHIIQSCDSRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAKQLSVTEETVELWKCKGLILRFWISIISNPNSIFSMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECKIIEIMNNLIEEEALHSYISKMEKTFILK 819          
BLAST of Plexin B-4 vs. Planmine SMEST
Match: SMESG000033280.1 (SMESG000033280.1)

HSP 1 Score: 431.409 bits (1108), Expect = 2.784e-140
Identity = 269/608 (44.24%), Postives = 388/608 (63.82%), Query Frame = 2
Query:  650 LICIFLIGMIGIFGTIYVKMYKRKTFSILAEACSVELTVEEMRNIKLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADENDSVKDIENL---LLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFLTIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHDEAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSIDVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEYSKLGG-IDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEYIQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPGIQKLTP----IHIIQSCDSRCTDSKLRSIGLRVDQSQK-----IRADLNKESCLMFLLATKKSILPFINGFFQNILNWKSENSVDNSLNSLFGNDYEST-SKDLKNSYLNIVYYFFSMLDDIAKQLSVT-EETVELWKCKGLILRFWXXXXXXXXXXXXMDKSEYISDSLVTIWRLLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKE 2428
            ++   LIG +     +Y +++K KT S +  A S E+  +EM+ IKL KMAFL+YQTA DS + L +L+   +L  N F+SR   VE+ K++E+   +D+EN+   LLNK+   K I + N +     ++  A L+T+ILF+HPKYF+ I+K+L+  +V + K  SEE+ LF + + + E +I NWIT+CMY S K  E GK  F L RAI+CK++SGIID+YT K+++ LSYDQL   + DYDVL+I  DV++Q K++NS     +I L NL ++VLSLD+ISQVK KILD+A ME+ +L       +  ID  N++ + L+ +  S++++L DFD TN    LDKEYI+VNT +H+ I++  K    S    KS  ++ +   I    P    +H+  S ++   +  L+   L    S+K     I  ++NKESCLM +LATKKS+ PFI+GFFQ+I NWK +N  ++S NSLF +  ES    + +++YL  VYYFFSMLDDIAKQL +T +ET ++WK    ILRFWI++I NPN IFS+D+++YI  +L TI  +L +S SI    + I S II  LF +EIQNKYS WW+ F N    V E
Sbjct:    4 IVISLLIGFL-----VYFRIFKAKTVSSMNRAYSTEIVQKEMKYIKLNKMAFLEYQTAMDSFANLGRLHEHHILSFNNFISRTLNVELHKSEEDKHDEDLENIKSYLLNKKFLLKWIEDLNNSKRAQERSLIASLLTIILFQHPKYFIQIIKDLIKQLVIKMKDKSEEKLLFRRSEALVEKMIGNWITMCMYQSLKTGEIGKRFFNLCRAIKCKIESGIIDVYTKKSKFGLSYDQLLIGNLDYDVLTIQADVEVQFKMINSANGFIDIKLKNLSIEVLSLDTISQVKAKILDRAFMEHYELDNKCSYENSGIDLNNNDKLFLYFLSSSSKLLLSDFDSTNDSTVLDKEYIRVNTFKHFNIQSGSKFLLCS----KSENDLSSFSRISSQGPKKPYVHLQTSHETISPNFDLKFPSLSETNSKKPSVELISENINKESCLMLILATKKSLNPFIDGFFQSIFNWKFQNHFNSSSNSLFESFSESQIFFNAEDNYLLFVYYFFSMLDDIAKQLGITDQETTQIWKSNSFILRFWINLIKNPNFIFSIDRTDYIETNLTTIASVLMQSCSIGMKHINIDSPIITLLFPQEIQNKYSQWWKYFANCTPFVNE 602          
The following BLAST results are available for this feature:
BLAST of Plexin B-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLXNB12.328e-2724.49plexin B1 [Source:HGNC Symbol;Acc:HGNC:9103][more]
PLXNB13.588e-2724.49plexin B1 [Source:HGNC Symbol;Acc:HGNC:9103][more]
PLXNB13.588e-2724.49plexin B1 [Source:HGNC Symbol;Acc:HGNC:9103][more]
PLXNB21.217e-2323.81plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104][more]
PLXNB21.217e-2323.81plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104][more]
back to top
BLAST of Plexin B-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plx-11.681e-1723.09PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-11.733e-1723.09PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-12.394e-1723.09PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-15.074e-1622.79PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-17.384e-1622.79PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
back to top
BLAST of Plexin B-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PlexA6.438e-2124.40gene:FBgn0025741 transcript:FBtr0309865[more]
PlexA1.164e-2025.15gene:FBgn0025741 transcript:FBtr0089224[more]
PlexA1.164e-2025.15gene:FBgn0025741 transcript:FBtr0089225[more]
PlexA1.254e-2025.15gene:FBgn0025741 transcript:FBtr0089223[more]
PlexB5.914e-1724.36gene:FBgn0025740 transcript:FBtr0308297[more]
back to top
BLAST of Plexin B-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plxnb1a5.684e-2927.41plexin b1a [Source:ZFIN;Acc:ZDB-GENE-050302-63][more]
plxnb2b5.702e-2623.82plexin b2b [Source:ZFIN;Acc:ZDB-GENE-080902-1][more]
plxnb1b3.146e-2526.64plexin b1b [Source:ZFIN;Acc:ZDB-GENE-090812-4][more]
plxnb1b3.146e-2526.64plexin b1b [Source:ZFIN;Acc:ZDB-GENE-090812-4][more]
plxnb32.635e-2325.06plexin B3 [Source:ZFIN;Acc:ZDB-GENE-081104-53][more]
back to top
BLAST of Plexin B-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLXNB11.522e-2625.47plexin B1 [Source:NCBI gene;Acc:100498269][more]
PLXNB11.672e-2626.21plexin B1 [Source:NCBI gene;Acc:100498269][more]
PLXNB11.899e-2626.21plexin B1 [Source:NCBI gene;Acc:100498269][more]
PLXNB12.103e-2626.21plexin B1 [Source:NCBI gene;Acc:100498269][more]
PLXNB12.177e-2626.21plexin B1 [Source:NCBI gene;Acc:100498269][more]
back to top
BLAST of Plexin B-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plxnb14.901e-2625.11plexin B1 [Source:MGI Symbol;Acc:MGI:2154238][more]
Plxnb32.023e-2522.78plexin B3 [Source:MGI Symbol;Acc:MGI:2154240][more]
Plxnb24.562e-2423.81plexin B2 [Source:MGI Symbol;Acc:MGI:2154239][more]
Plxnb24.562e-2423.81plexin B2 [Source:MGI Symbol;Acc:MGI:2154239][more]
Plxnd12.027e-2224.27plexin D1 [Source:MGI Symbol;Acc:MGI:2154244][more]
back to top
BLAST of Plexin B-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43157|PLXB1_HUMAN1.723e-2624.49Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 S... [more]
sp|Q8CJH3|PLXB1_MOUSE3.428e-2525.11Plexin-B1 OS=Mus musculus OX=10090 GN=Plxnb1 PE=1 ... [more]
sp|Q9QY40|PLXB3_MOUSE1.415e-2422.78Plexin-B3 OS=Mus musculus OX=10090 GN=Plxnb3 PE=1 ... [more]
sp|B2RXS4|PLXB2_MOUSE3.191e-2323.81Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 ... [more]
sp|O15031|PLXB2_HUMAN5.846e-2323.81Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 S... [more]
back to top
BLAST of Plexin B-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K0LJ733.392e-5135.42Plexin B-4 (Fragment) OS=Schmidtea mediterranea OX... [more]
A0A0K0LJ047.695e-3636.80Plexin B-5 (Fragment) OS=Schmidtea mediterranea OX... [more]
A0A1A8PH081.168e-2826.79Plexin b1b (Fragment) OS=Nothobranchius rachovii O... [more]
A0A1A8EK647.262e-2727.46Plexin b1b (Fragment) OS=Nothobranchius korthausae... [more]
A0A1A8IM247.752e-2727.07Plexin b1b (Fragment) OS=Nothobranchius kuhntae OX... [more]
back to top
BLAST of Plexin B-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plxnb1a2.117e-2726.84plexin b1a [Source:ZFIN;Acc:ZDB-GENE-050302-63][more]
plxnb1b1.839e-2626.91plexin b1b [Source:ZFIN;Acc:ZDB-GENE-090812-4][more]
plxnb32.901e-2424.85plexin B3 [Source:ZFIN;Acc:ZDB-GENE-081104-53][more]
plxnb33.491e-2424.85plexin B3 [Source:ZFIN;Acc:ZDB-GENE-081104-53][more]
plxnb2a1.924e-2324.35plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917][more]
back to top
BLAST of Plexin B-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009284.13.155e-2126.47pep scaffold:Pmarinus_7.0:GL476385:264710:288126:-... [more]
ENSPMAT00000006876.18.656e-1425.79pep scaffold:Pmarinus_7.0:GL486582:611:5415:1 gene... [more]
back to top
BLAST of Plexin B-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Plexin B-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO390091.138e-2925.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Plexin B-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plxnb1b1.292e-2726.95plexin-B1 [Source:NCBI gene;Acc:101159664][more]
plxnb1a5.615e-2725.31plexin-B1 [Source:NCBI gene;Acc:101162124][more]
plxnb31.410e-2525.37plexin-B1-like [Source:NCBI gene;Acc:101165957][more]
plxnb31.410e-2525.37plexin-B1-like [Source:NCBI gene;Acc:101165957][more]
plxnb2b2.768e-2524.95plexin-B2 [Source:NCBI gene;Acc:101169201][more]
back to top
BLAST of Plexin B-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033282.10.000e+099.01SMESG000033282.1[more]
SMESG000033282.10.000e+092.90SMESG000033282.1[more]
SMESG000033282.10.000e+098.96SMESG000033282.1[more]
SMESG000033282.10.000e+092.55SMESG000033282.1[more]
SMESG000033280.12.784e-14044.24SMESG000033280.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028696 ID=SMED30028696|Name=Plexin B-4|organism=Schmidtea mediterranea sexual|type=transcript|length=2620bp
CAAATAATTTACATTATATTTTTAATTCGAAGTTATGAAGAAAATTTTAC
TTTTTATTTTCCTAATAATAATTCAGTGGTTTCAATTTATAAATTTATTT
GAAAGCATTGAATATTTTAATCGTGGGGGTTATATATCTTTGTTTTGTAT
AAATAAAACTGACGACAACATTATTTTGCACAAGCAAAACTCTTATGCCG
TAAATATCAGTTGCAATAAAATGAAAATTGTCTGCAAAAGTGGAAATTTT
TATAAATGCAATTTGCCTTGCAATTTTAATCTTACAGCACTTGAAAACAA
TAAAAAAATATTCAGGTTACAAAGATTCGAAGCTCCAATTTTTGCGATAT
CTGAGCTTGAATATTATCAAAATAGAAGTAATTTAACTATTGGCGTCAGC
AGTAAAGTTTCGATTTCATCGATAAGGCTGGAAAATTACCATTTCAACTT
TTCCGATGTAAATGTTCTTTGCAGGCAAATTTGGAATACAGACAGTTCAA
TAATATGCTTATTGCATTTGAAGATGACCTGTGTCTATTACAAAATTTTG
AATGTTTCCATTCTAATCAGCTACGGCAATAGCTCATGCAATGAAAGACA
AAATCTTGGATTTATACTAATTAGATGTGGCAATCTTTATTTTATTGTTT
TAATTTGTATTTTCCTAATTGGTATGATTGGAATATTCGGAACGATTTAT
GTCAAAATGTATAAAAGAAAAACATTTTCTATTCTTGCTGAGGCATGCAG
CGTTGAGCTAACTGTGGAAGAGATGAGAAATATAAAATTACAAAAGATGG
CATTTCTTGATTATCAAACCGCTCCAGATTCATTAAGTACTTTGACGAAG
TTAAATATTGGAATTTTATTGCCTCTCAATATATTCTTATCAAGAAATTA
TAAAGTTGAAGTTAGGAAAGCAGATGAAAATGATTCTGTAAAGGATATTG
AAAATTTGTTATTAAATAAGGAAAAATGTTTCAAATTGATATCCAATTTT
AATGAAAATCATTCCTTCGATAATAAGAATAAATGTGCTTTATTAATAAC
TTTAATTTTATTTCGTCACCCGAAATATTTTCTAACAATAATGAAAGAAT
TGGTTTTCAACATGGTGTCTCAAGCAAAATTATTATCAGAAGAAAGAAAT
TTGTTCACTAAATATGATGATATTACCGAAATTATTATTAAAAATTGGAT
TACATTGTGTATGTATTATTCGTTCAAACATGATGAAGCCGGTAAAAATC
TTTTTTACTTAATTCGGGCAATAAGATGCAAAATGCAATCGGGAATAATT
GATATATATACCAATAAAGCAAGATATTGTTTATCATATGATCAATTATT
TTTTGAATCTCCGGACTATGACGTTTTGAGCATAGACGTTGATGTTCAAA
TCCAATTGAAACTGTTAAATTCAGACATTAACTCATGGGAAATAAATTTA
CCGAATTTAGTAGTGGATGTTTTATCTTTGGATTCAATTTCTCAAGTGAA
GGGGAAAATATTGGATAAGGCAATTATGGAATATTCTAAATTAGGTGGCA
TTGATGCCAATGATTATGTTATAGACTTTGGGAACTCTAACGCGATGCTG
CTTCATTTGATCTTGGATTCTGCACAAGTAATATTAGATGATTTTGATCA
AACAAATGTTCCCATAAAGCTGGATAAAGAATATATTCAAGTAAATACAT
TACAACATTATCAGATCAAAAACCACATGAAATTGTATTTTCGATCAAAT
ACTCTTGATAAATCGATTTATGAAGTGAAAGCATTACCGGGAATTCAAAA
GCTTACCCCTATACACATCATTCAAAGTTGCGATTCTAGATGCACTGATT
CGAAATTGCGGTCAATCGGTCTTAGAGTTGATCAGTCACAAAAAATCAGA
GCTGATTTGAATAAAGAATCCTGTCTCATGTTTTTGCTTGCAACTAAGAA
AAGTATTTTGCCTTTTATTAATGGGTTTTTTCAAAATATTTTAAATTGGA
AGTCTGAAAACTCAGTAGATAATTCTTTAAATTCATTATTCGGAAATGAT
TATGAATCAACAAGTAAAGATCTGAAGAACAGTTATTTGAATATTGTATA
TTATTTCTTTTCAATGCTTGATGATATTGCAAAACAATTGTCGGTGACAG
AGGAAACAGTTGAGTTGTGGAAGTGTAAAGGTTTGATTCTTCGGTTCTGG
ATCAGCATTATTTCAAACCCAAATTCTATATTTTCTATGGATAAATCGGA
GTACATTTCTGACAGCCTTGTAACAATTTGGAGGTTACTAGACGAATCAT
CCTCCATTAATAGTACCAGTGTTACCATTCATTCATCAATCATACAACAA
CTTTTTTACGAAGAGATACAAAATAAATATTCGGCTTGGTGGCGGGATTT
TGTAAACTCGAAGTCTGATGTTAAAGAATGCAAAATAATCGAAATAATGA
ATAATTTGATTGAGGAAGAAGCACTACACAGTTATATTTCGAAAATGGAG
AAAACATTTATTTTAAAATAAATATTCAATTCAAAATTCCAAGAAGACAA
TCAGTTTTTCTTTTTTATTAATTTGGTTTAGTTAAATTTTCTTTAATTTT
TATAATAAATTAGTTGTCAC
back to top

protein sequence of SMED30028696-orf-1

>SMED30028696-orf-1 ID=SMED30028696-orf-1|Name=SMED30028696-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=829bp
MKKILLFIFLIIIQWFQFINLFESIEYFNRGGYISLFCINKTDDNIILHK
QNSYAVNISCNKMKIVCKSGNFYKCNLPCNFNLTALENNKKIFRLQRFEA
PIFAISELEYYQNRSNLTIGVSSKVSISSIRLENYHFNFSDVNVLCRQIW
NTDSSIICLLHLKMTCVYYKILNVSILISYGNSSCNERQNLGFILIRCGN
LYFIVLICIFLIGMIGIFGTIYVKMYKRKTFSILAEACSVELTVEEMRNI
KLQKMAFLDYQTAPDSLSTLTKLNIGILLPLNIFLSRNYKVEVRKADEND
SVKDIENLLLNKEKCFKLISNFNENHSFDNKNKCALLITLILFRHPKYFL
TIMKELVFNMVSQAKLLSEERNLFTKYDDITEIIIKNWITLCMYYSFKHD
EAGKNLFYLIRAIRCKMQSGIIDIYTNKARYCLSYDQLFFESPDYDVLSI
DVDVQIQLKLLNSDINSWEINLPNLVVDVLSLDSISQVKGKILDKAIMEY
SKLGGIDANDYVIDFGNSNAMLLHLILDSAQVILDDFDQTNVPIKLDKEY
IQVNTLQHYQIKNHMKLYFRSNTLDKSIYEVKALPGIQKLTPIHIIQSCD
SRCTDSKLRSIGLRVDQSQKIRADLNKESCLMFLLATKKSILPFINGFFQ
NILNWKSENSVDNSLNSLFGNDYESTSKDLKNSYLNIVYYFFSMLDDIAK
QLSVTEETVELWKCKGLILRFWISIISNPNSIFSMDKSEYISDSLVTIWR
LLDESSSINSTSVTIHSSIIQQLFYEEIQNKYSAWWRDFVNSKSDVKECK
IIEIMNNLIEEEALHSYISKMEKTFILK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR031148Plexin
IPR013548Plexin_cytoplasmic_RasGAP_dom
Vocabulary: molecular function
TermDefinition
GO:0017154semaphorin receptor activity
Vocabulary: biological process
TermDefinition
GO:0071526semaphorin-plexin signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 461..571
e-value: 4.3E-11
score: 44.7
NoneNo IPR availableGENE3DG3DSA:1.10.506.10coord: 282..460
e-value: 4.5E-26
score: 93.5
NoneNo IPR availableGENE3DG3DSA:1.10.506.10coord: 608..827
e-value: 6.5E-22
score: 79.8
NoneNo IPR availablePANTHERPTHR22625:SF33PLEXIN-B3coord: 688..780
NoneNo IPR availablePANTHERPTHR22625:SF33PLEXIN-B3coord: 292..563
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.715
NoneNo IPR availableTMHMMTMhelixcoord: 4..22
NoneNo IPR availableTMHMMTMhelixcoord: 201..223
IPR013548Plexin, cytoplasmic RasGAP domainPFAMPF08337Plexin_cytoplcoord: 291..816
e-value: 6.5E-60
score: 203.3
IPR031148Plexin familyPANTHERPTHR22625PLEXINcoord: 292..563
IPR031148Plexin familyPANTHERPTHR22625PLEXINcoord: 688..780