Histone-binding protein RBBP7

Overview
NameHistone-binding protein RBBP7
Smed IDSMED30028689
Length (bp)1525
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone-binding protein RBBP7 (SMED30028689) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone-binding protein RBBP7 (SMED30028689) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-binding protein RBBP7 (SMED30028689) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-binding protein RBBP7 (SMED30028689) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028689

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028689 SmedASXL_010755SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028689 SmedASXL_010755SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30028689 dd_Smed_v4_2065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028689 dd_Smed_v4_2065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028689 dd_Smed_v4_2065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028689 dd_Smed_v4_2065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028689 dd_Smed_v4_2065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028689 dd_Smed_v4_2065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30028689 isotig07452be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone-binding protein RBBP7 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 333/418 (79.67%), Postives = 382/418 (91.39%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNS 1424
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG+LLSASDD+TIC+WDI+  P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + +     Q S
Sbjct:    8 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS 425          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 333/418 (79.67%), Postives = 382/418 (91.39%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNS 1424
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG+LLSASDD+TIC+WDI+  P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + +     Q S
Sbjct:    7 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS 424          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Human
Match: RBBP7 (RB binding protein 7, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9890])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 326/414 (78.74%), Postives = 373/414 (90.10%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEV 1412
            F+D +EERVINEEYKIWKKNTPFLYDLVMTHAL+WPSLT QWLP+V  PEGKDY LH L+LGTHTSDEQNHL++A  HIP D  +FD +  + DKGEFGGFGSV GKIE  IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHPAKPDP+G C PDLRL+GHQKEGYGLSWN   SG+LLSASDD+T+C+WDIN  P++ +I+DA +IFTGHS+VVEDV+WHLLHE +FGSVADD++LMIWDTR++ T++PS  VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLH+FESHKDEIFQV WSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+Q+WQMAENIYNDE+ D  T E+
Sbjct:    7 FEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL 420          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Human
Match: RBBP7 (RB binding protein 7, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9890])

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 326/414 (78.74%), Postives = 373/414 (90.10%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEV 1412
            F+D +EERVINEEYKIWKKNTPFLYDLVMTHAL+WPSLT QWLP+V  PEGKDY LH L+LGTHTSDEQNHL++A  HIP D  +FD +  + DKGEFGGFGSV GKIE  IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHPAKPDP+G C PDLRL+GHQKEGYGLSWN   SG+LLSASDD+T+C+WDIN  P++ +I+DA +IFTGHS+VVEDV+WHLLHE +FGSVADD++LMIWDTR++ T++PS  VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLH+FESHKDEIFQV WSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+Q+WQMAENIYNDE+ D  T E+
Sbjct:   51 FEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL 464          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 322/397 (81.11%), Postives = 369/397 (92.95%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQM 1361
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG+LLSASDD+TIC+WDI+  P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQM
Sbjct:    8 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQM 404          

HSP 2 Score: 51.2174 bits (121), Expect = 2.954e-6
Identity = 41/148 (27.70%), Postives = 65/148 (43.92%), Query Frame = 3
Query:  963 HAAEVNCISFNPFSEYILATGSADRTVALWDLR------------NLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAEN 1370
            H  EVN   + P +  I+AT +    V ++D              N +L+L     H+ E + + W+P+    L S+  D  + +WD+S + +E    DA+        I  GHTA + D SW      L  SV++D  L +W    N
Sbjct:  123 HEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRL---RGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKT-------IFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSN 260          

HSP 3 Score: 50.0618 bits (118), Expect = 7.163e-6
Identity = 38/165 (23.03%), Postives = 69/165 (41.82%), Query Frame = 3
Query:  942 PSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHS------FESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQ 1418
            P   +  H  E   +S+NP     L + S D T+ LWD+  +  +         F  H   +  V W   HE++  S   D++L +WD +R      P  + D           HTA+++  S++P + +++ + S D  + +W +          +S   E+ Q
Sbjct:  169 PDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWD-TRSNNTSKPSHSVDA----------HTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQ 322          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Celegans
Match: lin-53 (Probable histone-binding protein lin-53 [Source:UniProtKB/Swiss-Prot;Acc:P90916])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 284/407 (69.78%), Postives = 340/407 (83.54%), Query Frame = 3
Query:  171 FDDGI-EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDED 1388
             +DG  E+RV N+EYKIWKKNTPFLYDLVMTHALEWPSL+ QWLPDV   +  D+ +HRLILGTHTSDEQNHLLI+   +PTD  +FD ++Y+ ++ E+GGFG+VNGK+E +I+INH+GEVNRARY+PQ   IIATKSP +DV +FDY KH A P  N    P +RLKGH KEGYGLSWNP + G +LSASDD T+C WDIN +      + A  +F GH SVVEDV+WH+LH+ +FGSV DD++L+IWD RTS    P   +DAH+AEVNC++FNP+SE+ILATGSAD+TVALWDLRNL +KLHSFESH+DEIFQVQWSPH+ETILASSGTD+RLHVWDLS+IGE+QS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW++CSVSEDNILQVWQMA+NIYN+ D
Sbjct:    4 LEDGTSEDRVANDEYKIWKKNTPFLYDLVMTHALEWPSLSVQWLPDV-AKDNSDHTIHRLILGTHTSDEQNHLLISKICMPTDDAQFDASRYDTERSEYGGFGAVNGKVEPDIRINHEGEVNRARYMPQKSNIIATKSPHADVYIFDYLKHSAVPRDNTF-NPLIRLKGHTKEGYGLSWNPNKEGLILSASDDQTVCHWDINANQNVAGELQAKDVFKGHESVVEDVAWHVLHDGVFGSVGDDKKLLIWDVRTST---PGHCIDAHSAEVNCLAFNPYSEFILATGSADKTVALWDLRNLRMKLHSFESHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSKIGEDQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVVCSVSEDNILQVWQMADNIYNEVD 405          

HSP 2 Score: 54.299 bits (129), Expect = 1.294e-7
Identity = 42/165 (25.45%), Postives = 69/165 (41.82%), Query Frame = 3
Query:  516 HDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLK-----GHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDA-------LSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAE 974
            H  EVN   + P +  I+AT S    V ++D                +LR+K      H+ E + + W+P     L S+  D  + +WD++    DQ   DA       L I  GH++ + D SW+     +  SV++D  L +W    ++ N   +   A   E
Sbjct:  264 HSAEVNCLAFNPYSEFILATGSADKTVALWDLR--------------NLRMKLHSFESHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSKIGEDQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVVCSVSEDNILQVWQMADNIYNEVDEETPADVVE 414          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Celegans
Match: rba-1 (Probable histone-binding protein rba-1 [Source:UniProtKB/Swiss-Prot;Acc:P90917])

HSP 1 Score: 440.654 bits (1132), Expect = 4.681e-152
Identity = 216/403 (53.60%), Postives = 286/403 (70.97%), Query Frame = 3
Query:  201 NEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDE-QNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNG-KIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDG--PPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDS 1397
            ++E++IWKKN P+LYD V+T  +EWPSL+ QW+PDV   E  D  +HR+I GTHT    QNHL+I+   I TD+ EFD  K++ ++ EFGG+G  +  K +  IKINH GEV+RARY+P NP IIA++ PS DV +FDYTKHP++P      +P LRLKGH+ EGYG+SW+  R G+LL+A DD  IC WDIN +      I   S F GHSS  EDVS+H LH  +FGSV DDR+L +WD R S   +P  +   H AEVNCI+FNPFSEYILATGS D+TVALWD+RN+  K+++ + H DEIFQV +SPH+ET+LASSG+D R+ VWD+S+I +  S   A     PPE++FIH GHT K++DFSW+PN PW ICS  E N LQVW+++ ++ + E  ++
Sbjct:   11 SKEHRIWKKNVPYLYDTVVTKEVEWPSLSVQWMPDVTKTENSDSSMHRMIHGTHTCGGVQNHLMISKFTITTDTPEFDDAKWDSEREEFGGYGEGSAAKWDTEIKINHPGEVHRARYMPHNPFIIASRGPSDDVYIFDYTKHPSEPKDTKF-RPQLRLKGHEGEGYGMSWSNTREGHLLTAGDDGMICHWDINANQTISGQIVPQSKFKGHSSNAEDVSFHALHNFVFGSVGDDRKLNLWDLRQS---KPQLTAVGHTAEVNCITFNPFSEYILATGSVDKTVALWDMRNMRKKMYTLKHHNDEIFQVSFSPHYETVLASSGSDDRVIVWDISKIQDPSSSSAASSDSVPPEVIFIHAGHTGKVADFSWNPNRPWTICSSDEFNALQVWEVSNSLVSSEKWET 409          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Celegans
Match: Y54H5A.1 (pep chromosome:WBcel235:III:5153543:5155465:1 gene:WBGene00021899.1 transcript:Y54H5A.1.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54H5A.1)

HSP 1 Score: 108.227 bits (269), Expect = 4.597e-25
Identity = 80/293 (27.30%), Postives = 136/293 (46.42%), Query Frame = 3
Query:  504 IKINHDGEVNRARY-LPQNPTIIATKSPSSDVLVFDYT---------KHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVD-AHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLK--LHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNI 1343
            + I H G +NR R     + T+ A  S    V V++ T            +K +   + +P     G  KEGYGL+W+  ++G L +      I +W +      Q  + A +  TGH   VED++W      +  S + D  + +WDTR++  +    +V  AH ++VN IS+N   E ++ +G  D  + +W L+ +     +  F+ H   I  V W PH  T   +SG D +  +WD++   + Q+  + E  PP+L+F+H G   ++ +  W    P L  + S D  
Sbjct:  160 VSIPHYGGINRIRSDRLGDSTVCACWSDQGRVQVWNITDALNYTHGMSGESKTEVQKIDRPLFTNNGSGKEGYGLAWSSLKTGDLATGDIIKKIYLWQMKEG--GQWAVGA-NPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWNRH-ENLIVSGGDDGELKIWSLKTIQFGQPVALFKYHNSPITSVDWHPHETTTFMASGEDDQTTIWDIATEADGQT--NIEGVPPQLMFVHMGQN-EVKEVHWHQQIPGLAINTSIDGF 445          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Celegans
Match: Y54H5A.1 (pep chromosome:WBcel235:III:5153464:5155465:1 gene:WBGene00021899.1 transcript:Y54H5A.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54H5A.1)

HSP 1 Score: 108.227 bits (269), Expect = 4.597e-25
Identity = 80/293 (27.30%), Postives = 136/293 (46.42%), Query Frame = 3
Query:  504 IKINHDGEVNRARY-LPQNPTIIATKSPSSDVLVFDYT---------KHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVD-AHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLK--LHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNI 1343
            + I H G +NR R     + T+ A  S    V V++ T            +K +   + +P     G  KEGYGL+W+  ++G L +      I +W +      Q  + A +  TGH   VED++W      +  S + D  + +WDTR++  +    +V  AH ++VN IS+N   E ++ +G  D  + +W L+ +     +  F+ H   I  V W PH  T   +SG D +  +WD++   + Q+  + E  PP+L+F+H G   ++ +  W    P L  + S D  
Sbjct:  160 VSIPHYGGINRIRSDRLGDSTVCACWSDQGRVQVWNITDALNYTHGMSGESKTEVQKIDRPLFTNNGSGKEGYGLAWSSLKTGDLATGDIIKKIYLWQMKEG--GQWAVGA-NPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWNRH-ENLIVSGGDDGELKIWSLKTIQFGQPVALFKYHNSPITSVDWHPHETTTFMASGEDDQTTIWDIATEADGQT--NIEGVPPQLMFVHMGQN-EVKEVHWHQQIPGLAINTSIDGF 445          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Celegans
Match: Y54H5A.1 (pep chromosome:WBcel235:III:5153406:5155436:1 gene:WBGene00021899.1 transcript:Y54H5A.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54H5A.1)

HSP 1 Score: 108.227 bits (269), Expect = 4.597e-25
Identity = 80/293 (27.30%), Postives = 136/293 (46.42%), Query Frame = 3
Query:  504 IKINHDGEVNRARY-LPQNPTIIATKSPSSDVLVFDYT---------KHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVD-AHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLK--LHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNI 1343
            + I H G +NR R     + T+ A  S    V V++ T            +K +   + +P     G  KEGYGL+W+  ++G L +      I +W +      Q  + A +  TGH   VED++W      +  S + D  + +WDTR++  +    +V  AH ++VN IS+N   E ++ +G  D  + +W L+ +     +  F+ H   I  V W PH  T   +SG D +  +WD++   + Q+  + E  PP+L+F+H G   ++ +  W    P L  + S D  
Sbjct:  160 VSIPHYGGINRIRSDRLGDSTVCACWSDQGRVQVWNITDALNYTHGMSGESKTEVQKIDRPLFTNNGSGKEGYGLAWSSLKTGDLATGDIIKKIYLWQMKEG--GQWAVGA-NPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWNRH-ENLIVSGGDDGELKIWSLKTIQFGQPVALFKYHNSPITSVDWHPHETTTFMASGEDDQTTIWDIATEADGQT--NIEGVPPQLMFVHMGQN-EVKEVHWHQQIPGLAINTSIDGF 445          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Fly
Match: Caf1-55 (gene:FBgn0263979 transcript:FBtr0301845)

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 330/419 (78.76%), Postives = 382/419 (91.17%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS 1427
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV   +GKDY +HRLILGTHTSDEQNHLLIA+  +P++  +FD + Y+ +KGEFGGFGSV GKIEI IKINH+GEVNRARY+PQN  +IATK+PSSDVLVFDYTKHP+KP+P+G CQPDLRL+GHQKEGYGLSWNP  +GYLLSASDD+TIC+WDIN +P++ R+IDA +IFTGH++VVEDV+WHLLHE +FGSVADD++LMIWDTR + T++PS +VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRLHVWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAEN+YNDE+ +    E+  N++
Sbjct:   11 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPEIPASELETNTA 429          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Fly
Match: Caf1-55 (gene:FBgn0263979 transcript:FBtr0083052)

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 330/419 (78.76%), Postives = 382/419 (91.17%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS 1427
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV   +GKDY +HRLILGTHTSDEQNHLLIA+  +P++  +FD + Y+ +KGEFGGFGSV GKIEI IKINH+GEVNRARY+PQN  +IATK+PSSDVLVFDYTKHP+KP+P+G CQPDLRL+GHQKEGYGLSWNP  +GYLLSASDD+TIC+WDIN +P++ R+IDA +IFTGH++VVEDV+WHLLHE +FGSVADD++LMIWDTR + T++PS +VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRLHVWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAEN+YNDE+ +    E+  N++
Sbjct:   12 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPEIPASELETNTA 430          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Fly
Match: l(2)09851 (gene:FBgn0022288 transcript:FBtr0335269)

HSP 1 Score: 127.487 bits (319), Expect = 1.088e-31
Identity = 94/296 (31.76%), Postives = 139/296 (46.96%), Query Frame = 3
Query:  510 INHDGEVNRARYLPQNPTIIATK-SPSSDVLVFDYTK--------HPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMW---DINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSV-DAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLK--LHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLS---RIGEEQSPEDAEDG----PPELLFIHGGHTAKISDFSWSPNTPWLICSVS 1331
            + H G VNR R      ++ A   S    V ++D T+          AK       +P     GHQ+EG+ + W+P   G L +      I +W   +  T   DQR +       GHS  VED+ W      +  S + D+ + IWD R S       +  DAH ++VN IS+N  +E  +A+G  D  + +WDLR    K  + +F+ H D I  V+WSP   T+LAS G D ++ +WDL+    I +   P   ED     PP+LLFIH G   +I +  W P  P ++ S +
Sbjct:  157 VKHQGCVNRVRARRLGNSVYAASWSELGRVNIWDLTQPLQAVENAQLAKQYEQSEARPVFTFGGHQQEGFAIDWSPSADGVLATGDCRRDIHVWTPVEDGTWKVDQRPL------AGHSQSVEDLQWSPNERSVLASCSVDKTIRIWDCRASPQKACMLTCEDAHQSDVNVISWN-RNEPFIASGGDDGYLHIWDLRQFQSKKPIATFKHHTDHITTVEWSPAEATVLASGGDDDQIALWDLAVEKDIDQAVDPAQNEDVLNKLPPQLLFIHQGQK-EIKELHWHPQLPGVLLSTA 444          

HSP 2 Score: 49.2914 bits (116), Expect = 5.793e-6
Identity = 27/96 (28.12%), Postives = 43/96 (44.79%), Query Frame = 3
Query: 1077 LHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGE---EQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVW 1355
            + +F  H+ E F + WSP  + +LA+    R +HVW     G    +Q P               GH+  + D  WSPN   ++ S S D  +++W
Sbjct:  215 VFTFGGHQQEGFAIDWSPSADGVLATGDCRRDIHVWTPVEDGTWKVDQRP-------------LAGHSQSVEDLQWSPNERSVLASCSVDKTIRIW 297          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Fly
Match: l(2)09851 (gene:FBgn0022288 transcript:FBtr0086043)

HSP 1 Score: 127.487 bits (319), Expect = 1.088e-31
Identity = 94/296 (31.76%), Postives = 139/296 (46.96%), Query Frame = 3
Query:  510 INHDGEVNRARYLPQNPTIIATK-SPSSDVLVFDYTK--------HPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMW---DINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSV-DAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLK--LHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLS---RIGEEQSPEDAEDG----PPELLFIHGGHTAKISDFSWSPNTPWLICSVS 1331
            + H G VNR R      ++ A   S    V ++D T+          AK       +P     GHQ+EG+ + W+P   G L +      I +W   +  T   DQR +       GHS  VED+ W      +  S + D+ + IWD R S       +  DAH ++VN IS+N  +E  +A+G  D  + +WDLR    K  + +F+ H D I  V+WSP   T+LAS G D ++ +WDL+    I +   P   ED     PP+LLFIH G   +I +  W P  P ++ S +
Sbjct:  157 VKHQGCVNRVRARRLGNSVYAASWSELGRVNIWDLTQPLQAVENAQLAKQYEQSEARPVFTFGGHQQEGFAIDWSPSADGVLATGDCRRDIHVWTPVEDGTWKVDQRPL------AGHSQSVEDLQWSPNERSVLASCSVDKTIRIWDCRASPQKACMLTCEDAHQSDVNVISWN-RNEPFIASGGDDGYLHIWDLRQFQSKKPIATFKHHTDHITTVEWSPAEATVLASGGDDDQIALWDLAVEKDIDQAVDPAQNEDVLNKLPPQLLFIHQGQK-EIKELHWHPQLPGVLLSTA 444          

HSP 2 Score: 49.2914 bits (116), Expect = 5.793e-6
Identity = 27/96 (28.12%), Postives = 43/96 (44.79%), Query Frame = 3
Query: 1077 LHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGE---EQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVW 1355
            + +F  H+ E F + WSP  + +LA+    R +HVW     G    +Q P               GH+  + D  WSPN   ++ S S D  +++W
Sbjct:  215 VFTFGGHQQEGFAIDWSPSADGVLATGDCRRDIHVWTPVEDGTWKVDQRP-------------LAGHSQSVEDLQWSPNERSVLASCSVDKTIRIW 297          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Fly
Match: Pex7 (gene:FBgn0035922 transcript:FBtr0076568)

HSP 1 Score: 96.6709 bits (239), Expect = 1.143e-21
Identity = 67/238 (28.15%), Postives = 115/238 (48.32%), Query Frame = 3
Query:  651 QPDLRLKGHQKEGYGLSWNPKRSGY-LLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDE--IFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVW 1355
            QP + L+ H+ E Y L W  K + + LLS S D T+ +WD N         ++++ F GH+ ++    +  L  ++F SV+ D  L +W++      +P  S++AHA+E  C  ++ F   +L TG +D  +  WDLR   ++ H FE +  E  + ++  SPH   +LAS+  D    +W+L R GE     +A             HT  +    W+P+    +     D++  V+
Sbjct:  114 QPLICLQEHKNEVYSLDWGEKWNYHTLLSGSWDCTLKLWDCNRQ-------NSITTFVGHNDLIYGAKFSPLIANLFASVSTDGHLNLWNS-LDFAGKPLMSIEAHASEALCCDWSHFDRNVLVTGGSDGLIRGWDLR--KMRTHVFELYSGEFAVRRLACSPHSAAVLASANYDFTTRIWNLER-GESAQEVNAR------------HTEFVCGLDWNPHRTHQLADCGWDSLANVY 328          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Zebrafish
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:321726])

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 334/416 (80.29%), Postives = 382/416 (91.83%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQ 1418
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+P+SDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+T P++ +I+DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS +VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + A    VQ
Sbjct:    8 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGAADTEVQ 423          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 332/419 (79.24%), Postives = 382/419 (91.17%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS 1427
            +DD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLT QWLPDV  PEGKDY +HRL+LGTHTSDEQNHL+IA+  IP D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+P+SDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+ +P++ +I+DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDE+ D+   E+   +S
Sbjct:    7 YDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGAPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEEPDTPASELEGQAS 425          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 332/420 (79.05%), Postives = 382/420 (90.95%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKG-EFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS 1427
            +DD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLT QWLPDV  PEGKDY +HRL+LGTHTSDEQNHL+IA+  IP D  +FD + Y+ +KG EFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+P+SDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+ +P++ +I+DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDE+ D+   E+   +S
Sbjct:    7 YDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGAPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEEPDTPASELEGQAS 426          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 332/420 (79.05%), Postives = 382/420 (90.95%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKG-EFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS 1427
            +DD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLT QWLPDV  PEGKDY +HRL+LGTHTSDEQNHL+IA+  IP D  +FD + Y+ +KG EFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+P+SDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+ +P++ +I+DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDE+ D+   E+   +S
Sbjct:    7 YDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGAPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEEPDTPASELEGQAS 426          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Zebrafish
Match: CR450764.7 (pep chromosome:GRCz11:CHR_ALT_CTG11_3_1:12801933:12802332:1 gene:ENSDARG00000110109.1 transcript:ENSDART00000179997.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR450764.7)

HSP 1 Score: 162.54 bits (410), Expect = 4.806e-48
Identity = 73/96 (76.04%), Postives = 83/96 (86.46%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKG 458
            +DD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLT QWLPDV  PEGKDY +HRL+LGTHTSDEQNHL+IA+  IP D  +FD + Y+ +KG
Sbjct:    7 YDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKG 102          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 332/418 (79.43%), Postives = 381/418 (91.15%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNS 1424
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  P+GKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+  P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED +       Q+S
Sbjct:   38 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDTEGGVDPEGQSS 455          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 333/429 (77.62%), Postives = 384/429 (89.51%), Query Frame = 3
Query:  138 YCSMRSRIFIDFDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNS 1424
            Y  +   +   FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  P+GKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+  P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED +       Q+S
Sbjct:    3 YAGILRALRSAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDTEGGVDPEGQSS 431          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Xenopus
Match: rbbp7 (retinoblastoma binding protein 7 [Source:NCBI gene;Acc:394900])

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 325/419 (77.57%), Postives = 375/419 (89.50%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS 1427
            F+D +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLT QWLPDV  PEGKDY LH L+LGTHTSDEQNHL++A   IP D  +FD + Y+ +KGEFGGFGSV+GKIE  IKINH+GEVNRARY+PQNP IIATK+PS+DVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWN   SG+LLSASDD+T+C+WDI+  P++ +++DA +IFTGHS+VVEDV+WHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQV WSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+Q+WQMAENIYNDE+ D    E+    S
Sbjct:    7 FEDTVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVTRPEGKDYALHWLVLGTHTSDEQNHLVVARVQIPNDDAQFDASHYDSEKGEFGGFGSVSGKIETEIKINHEGEVNRARYMPQNPCIIATKTPSADVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDISAGPKEGKVVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEEPDIPASELEAQGS 425          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Xenopus
Match: rbbp7 (retinoblastoma binding protein 7 [Source:NCBI gene;Acc:394900])

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 325/419 (77.57%), Postives = 375/419 (89.50%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS 1427
            F+D +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLT QWLPDV  PEGKDY LH L+LGTHTSDEQNHL++A   IP D  +FD + Y+ +KGEFGGFGSV+GKIE  IKINH+GEVNRARY+PQNP IIATK+PS+DVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWN   SG+LLSASDD+T+C+WDI+  P++ +++DA +IFTGHS+VVEDV+WHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQV WSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+Q+WQMAENIYNDE+ D    E+    S
Sbjct:   23 FEDTVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVTRPEGKDYALHWLVLGTHTSDEQNHLVVARVQIPNDDAQFDASHYDSEKGEFGGFGSVSGKIETEIKINHEGEVNRARYMPQNPCIIATKTPSADVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDISAGPKEGKVVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEEPDIPASELEAQGS 441          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 332/451 (73.61%), Postives = 381/451 (84.48%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDN---------------------------------TICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNS 1424
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  P+GKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+                                 TIC+WDI+  P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED +       Q+S
Sbjct:    6 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHVSRRSYFYFPPLLRSPYLIIFLFYFFSLQFCLQTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDTEGGVDPEGQSS 456          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Mouse
Match: Rbbp4 (retinoblastoma binding protein 4, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194912])

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 333/418 (79.67%), Postives = 382/418 (91.39%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNS 1424
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG+LLSASDD+TIC+WDI+  P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + +     Q S
Sbjct:    8 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS 425          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 325/414 (78.50%), Postives = 372/414 (89.86%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEV 1412
            F+D +EERVINEEYKIWKKNTPFLYDLVMTHAL+WPSLT QWLP+V  PEGKDY LH L+LGTHTSDEQNHL++A  HIP D  +FD +  + DKGEFGGFGSV GKIE  IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHPAKPDP+G C PDLRL+GHQKEGYGLSWN   SG+LLSASDD+T+C+WDIN  P++ +I+DA +IFTGHS+VVEDV+WHLLHE +FGSVADD++LMIWDTR++ T++PS  VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLH+FESHKDEIFQV WSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+Q+WQMAENIYNDE+ D    E+
Sbjct:    7 FEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTASEL 420          

HSP 2 Score: 52.373 bits (124), Expect = 8.323e-7
Identity = 42/165 (25.45%), Postives = 69/165 (41.82%), Query Frame = 3
Query:  516 HDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLK-----GHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDA-------LSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAE 974
            H  EVN   + P +  I+AT S    V ++D                +L+LK      H+ E + + W+P     L S+  D  + +WD++    +Q   DA       L I  GH++ + D SW+     +  SV++D  + IW    ++ N     V A   E
Sbjct:  271 HTAEVNCLSFNPYSEFILATGSADKTVALWDLR--------------NLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTASELE 421          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 317/414 (76.57%), Postives = 364/414 (87.92%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEV 1412
            F+D +EERVINEEYKIWKKNTPFLYDLVMTHAL+WPSLT QWLP+V  PEGKDY LH L+LGTHTSDEQNHL++A  HIP D  +FD +  + DKG         GKIE  IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHPAKPDP+G C PDLRL+GHQKEGYGLSWN   SG+LLSASDD+T+C+WDIN  P++ +I+DA +IFTGHS+VVEDV+WHLLHE +FGSVADD++LMIWDTR++ T++PS  VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLH+FESHKDEIFQV WSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+Q+WQMAENIYNDE+ D    E+
Sbjct:    7 FEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKG---------GKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTASEL 411          

HSP 2 Score: 52.373 bits (124), Expect = 8.244e-7
Identity = 42/165 (25.45%), Postives = 69/165 (41.82%), Query Frame = 3
Query:  516 HDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLK-----GHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDA-------LSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAE 974
            H  EVN   + P +  I+AT S    V ++D                +L+LK      H+ E + + W+P     L S+  D  + +WD++    +Q   DA       L I  GH++ + D SW+     +  SV++D  + IW    ++ N     V A   E
Sbjct:  262 HTAEVNCLSFNPYSEFILATGSADKTVALWDLR--------------NLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTASELE 412          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 283/360 (78.61%), Postives = 324/360 (90.00%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELL 1250
            F+D +EERVINEEYKIWKKNTPFLYDLVMTHAL+WPSLT QWLP+V  PEGKDY LH L+LGTHTSDEQNHL++A  HIP D  +FD +  + DKGEFGGFGSV GKIE  IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHPAKPDP+G C PDLRL+GHQKEGYGLSWN   SG+LLSASDD+T+C+WDIN  P++ +I+DA +IFTGHS+VVEDV+WHLLHE +FGSVADD++LMIWDTR++ T++PS  VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLH+FESHKDEIFQV WSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELL
Sbjct:    7 FEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELL 366          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 341.658 bits (875), Expect = 1.073e-115
Identity = 159/206 (77.18%), Postives = 180/206 (87.38%), Query Frame = 3
Query:  156 RIFIDFDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDIN 773
            R ++ F+D +EERVINEEYKIWKKNTPFLYDLVMTHAL+WPSLT QWLP+V  PEGKDY LH L+LGTHTSDEQNHL++A  HIP D  +FD +  + DKGEFGGFGSV GKIE  IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHPAKPDP+G C PDLRL+GHQKEGYGLSWN   SG+LLSASDD+T+C+WDIN
Sbjct:   30 RSWLVFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDIN 235          
BLAST of Histone-binding protein RBBP7 vs. UniProt/SwissProt
Match: sp|Q60972|RBBP4_MOUSE (Histone-binding protein RBBP4 OS=Mus musculus OX=10090 GN=Rbbp4 PE=1 SV=5)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 333/418 (79.67%), Postives = 382/418 (91.39%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNS 1424
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG+LLSASDD+TIC+WDI+  P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + +     Q S
Sbjct:    8 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS 425          
BLAST of Histone-binding protein RBBP7 vs. UniProt/SwissProt
Match: sp|Q09028|RBBP4_HUMAN (Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 333/418 (79.67%), Postives = 382/418 (91.39%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNS 1424
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG+LLSASDD+TIC+WDI+  P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + +     Q S
Sbjct:    8 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS 425          
BLAST of Histone-binding protein RBBP7 vs. UniProt/SwissProt
Match: sp|Q3MHL3|RBBP4_BOVIN (Histone-binding protein RBBP4 OS=Bos taurus OX=9913 GN=RBBP4 PE=1 SV=3)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 333/418 (79.67%), Postives = 382/418 (91.39%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNS 1424
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG+LLSASDD+TIC+WDI+  P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + +     Q S
Sbjct:    8 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS 425          
BLAST of Histone-binding protein RBBP7 vs. UniProt/SwissProt
Match: sp|Q5M7K4|RBBP4_XENTR (Histone-binding protein RBBP4 OS=Xenopus tropicalis OX=8364 GN=rbbp4 PE=2 SV=3)

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 332/418 (79.43%), Postives = 381/418 (91.15%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNS 1424
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  P+GKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+PSSDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+  P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED +       Q+S
Sbjct:    8 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDTEGGVDPEGQSS 425          
BLAST of Histone-binding protein RBBP7 vs. UniProt/SwissProt
Match: sp|Q6P3H7|RBBP4_DANRE (Histone-binding protein RBBP4 OS=Danio rerio OX=7955 GN=rbbp4 PE=2 SV=3)

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 332/416 (79.81%), Postives = 380/416 (91.35%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQ 1418
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+P+SDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP     LLSASDD+TIC+WDI+T P++ +I+DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS +VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + A    VQ
Sbjct:    8 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLRSCLLSASDDHTICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGAADTEVQ 423          
BLAST of Histone-binding protein RBBP7 vs. TrEMBL
Match: D2T0G1 (Retinoblastoma-associated proteins 46/48 OS=Dugesia japonica OX=6161 GN=48 PE=2 SV=1)

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 386/391 (98.72%), Postives = 388/391 (99.23%), Query Frame = 3
Query:  255 MTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS 1427
            MTHALEWPSLTAQWLP+V CPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAH+AEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQ  EDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS
Sbjct:    1 MTHALEWPSLTAQWLPEVTCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHSAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQFAEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS 391          
BLAST of Histone-binding protein RBBP7 vs. TrEMBL
Match: T1JFL0 (WD_REPEATS_REGION domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 333/419 (79.47%), Postives = 388/419 (92.60%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS 1427
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKDY +HRLILGTHTSDEQNHLLIA+  +P++  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRAR++PQNP +IATK+PSSDVLVFDYTKHP+KPDP+G CQPDLRL+GHQKEGYGLSWNP  +G+LLSASDD+TIC+WDIN++PR+ R+IDA ++FTGH++VVEDV+WHLLHE +FGSVADD++LMIWDTR++ T++PS +VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRLHVWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDE+ ++   E+  ++S
Sbjct:  445 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDASHYDNEKGEFGGFGSVSGKIEIEIKINHEGEVNRARFMPQNPCVIATKTPSSDVLVFDYTKHPSKPDPSGECQPDLRLRGHQKEGYGLSWNPNLNGHLLSASDDHTICLWDINSAPRENRVIDAKTVFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEEPETPASELEASTS 863          
BLAST of Histone-binding protein RBBP7 vs. TrEMBL
Match: A0A556TPH8 (Histone-binding protein RBBP4 OS=Bagarius yarrelli OX=175774 GN=Baya_3521 PE=4 SV=1)

HSP 1 Score: 734.947 bits (1896), Expect = 0.000e+0
Identity = 335/416 (80.53%), Postives = 382/416 (91.83%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQ 1418
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKDY +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+P+SDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+T P++ +I+DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS +VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + A    VQ
Sbjct:  456 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLVLGTHTSDEQNHLVIASVQLPNDDTQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGAADTEVQ 871          
BLAST of Histone-binding protein RBBP7 vs. TrEMBL
Match: A0A3N0XZH6 (Histone-binding protein RBBP4 OS=Anabarilius grahami OX=495550 GN=DPX16_17504 PE=4 SV=1)

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 334/416 (80.29%), Postives = 382/416 (91.83%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQ 1418
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+P+SDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+T P++ +I+DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS +VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + A    VQ
Sbjct:  409 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGAADTEVQ 824          
BLAST of Histone-binding protein RBBP7 vs. TrEMBL
Match: A0A498MLJ2 (Histone-binding RBBP4 OS=Labeo rohita OX=84645 GN=ROHU_006765 PE=4 SV=1)

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 334/416 (80.29%), Postives = 382/416 (91.83%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQ 1418
            FDD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKD+ +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+P+SDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+T P++ +I+DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS +VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + A    VQ
Sbjct:  405 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGAADTEVQ 820          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Cavefish
Match: rbbp4 (RB binding protein 4, chromatin remodeling factor [Source:NCBI gene;Acc:103039809])

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 332/412 (80.58%), Postives = 379/412 (91.99%), Query Frame = 3
Query:  183 IEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQ 1418
            +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKDY +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+P+SDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+T P++ +I+DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS +VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + A    VQ
Sbjct:   12 VEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGAADTEVQ 423          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Cavefish
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:103023991])

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 332/420 (79.05%), Postives = 381/420 (90.71%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKG-EFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS 1427
            +DD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLT QWLPDV  PEGKDY +HRL+LGTHTSDEQNHL+IA+  IP D  +FD + Y+ +KG EFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+P+SDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+ SP++ +I+DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T +PS +VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDE+ D+   E+   +S
Sbjct:    7 YDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGSPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTAKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEEPDTPASELESQAS 426          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Cavefish
Match: grwd1 (glutamate rich WD repeat containing 1 [Source:NCBI gene;Acc:103032799])

HSP 1 Score: 119.013 bits (297), Expect = 1.401e-28
Identity = 86/294 (29.25%), Postives = 139/294 (47.28%), Query Frame = 3
Query:  510 INHDGEVNRARYLPQN-PTIIATKSPSSDVLVFDYTKH----------PAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRI---IDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNL--NLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLS----RIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVS 1331
            + H G +NR R   +   ++ A  S    V +FD               A    N    P     GH  EG+ + W+PK  G L+S      I +W+    PR+  +   ID    F+ H+  VED+ W      +F S + D+ + +WD R    +  S + +AH+++VN IS+N  +E  L +G  D  + +WDLR       + SF+ H   +  V+W+P   ++ A++G D  +  WDLS     +GE  +  D +D PP+LLF+H G T ++ +  W P  P  + S +
Sbjct:  160 VPHYGGINRVRVTRRGEQSLAAVWSEKGQVEIFDLRPQLEAVYNSSVMAAFIKQNKEITPLFSFSGHMAEGFAVDWSPKVPGRLVSGDCKKNIHVWE----PREGGVSWQIDQRP-FSSHTKSVEDLQWSPTEATVFASCSVDQSIRVWDIRAPPNSMLSVN-EAHSSDVNVISWN-RTEPFLLSGGDDGLLKVWDLRQFKSGRAVASFKQHSAPVTSVEWNPVDSSVFAAAGADDVVSQWDLSVESCDMGERAN--DVKDLPPQLLFLHQGQT-EVKELHWHPQLPGTLISTA 443          

HSP 2 Score: 59.6918 bits (143), Expect = 3.887e-9
Identity = 37/146 (25.34%), Postives = 70/146 (47.95%), Query Frame = 3
Query:  942 PSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLR----NLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAE 1367
            P  S   H AE   + ++P     L +G   + + +W+ R    +  +    F SH   +  +QWSP   T+ AS   D+ + VWD+      ++P      P  +L ++  H++ ++  SW+   P+L+ S  +D +L+VW + +
Sbjct:  219 PLFSFSGHMAEGFAVDWSPKVPGRLVSGDCKKNIHVWEPREGGVSWQIDQRPFSSHTKSVEDLQWSPTEATVFASCSVDQSIRVWDI------RAP------PNSMLSVNEAHSSDVNVISWNRTEPFLL-SGGDDGLLKVWDLRQ 351          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Cavefish
Match: taf5 (TATA-box binding protein associated factor 5 [Source:NCBI gene;Acc:103038729])

HSP 1 Score: 93.5893 bits (231), Expect = 1.047e-19
Identity = 79/249 (31.73%), Postives = 121/249 (48.59%), Query Frame = 3
Query:  666 LKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSR---IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSAT 1403
            L GH    YG+S++P R+ YLLS+S+D TI +W + T          L  + GH+  V D  +   + + F S   DR   +W T      +P +    H A++ C  F+P S Y+ ATGSADRT+ LWD+ N +  +     HK  I  + +SP+ +  LAS  TD R+ +WD+     IGE +                 GHT  I    +S +   ++ S S DN +++W  A   ++D + D  T
Sbjct:  467 LYGHSGPVYGVSFSPDRN-YLLSSSEDGTIRLWSLQT-------FTCLVAYKGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHY---QPLRMFAGHLADITCTRFHPNSNYV-ATGSADRTIRLWDVLNGHC-VRVLTGHKGPIHSLAFSPNGK-YLASGSTDGRVLLWDIGHGLMIGELK-----------------GHTDTIYALRFSRDGE-ILASGSMDNTVRLWD-AIRAFDDVETDDFT 681          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Cavefish
Match: taf5 (TATA-box binding protein associated factor 5 [Source:NCBI gene;Acc:103038729])

HSP 1 Score: 93.5893 bits (231), Expect = 1.047e-19
Identity = 79/249 (31.73%), Postives = 121/249 (48.59%), Query Frame = 3
Query:  666 LKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSR---IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSAT 1403
            L GH    YG+S++P R+ YLLS+S+D TI +W + T          L  + GH+  V D  +   + + F S   DR   +W T      +P +    H A++ C  F+P S Y+ ATGSADRT+ LWD+ N +  +     HK  I  + +SP+ +  LAS  TD R+ +WD+     IGE +                 GHT  I    +S +   ++ S S DN +++W  A   ++D + D  T
Sbjct:  467 LYGHSGPVYGVSFSPDRN-YLLSSSEDGTIRLWSLQT-------FTCLVAYKGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHY---QPLRMFAGHLADITCTRFHPNSNYV-ATGSADRTIRLWDVLNGHC-VRVLTGHKGPIHSLAFSPNGK-YLASGSTDGRVLLWDIGHGLMIGELK-----------------GHTDTIYALRFSRDGE-ILASGSMDNTVRLWD-AIRAFDDVETDDFT 681          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008002.1 (pep scaffold:Pmarinus_7.0:GL477852:421:9512:1 gene:ENSPMAG00000007189.1 transcript:ENSPMAT00000008002.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 322/416 (77.40%), Postives = 377/416 (90.62%), Query Frame = 3
Query:  165 IDFDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEV 1412
            +  DD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKDY +HRLILGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV  KIE+ IKINH+GEVNRARY+PQNP IIATK+P+S+VLVFDYTKHP+ PDP+G C PDLRL+GHQKEGYGLSWNP  SG+LLSASDD+T+C+WDI+ +PR+ ++++A +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESH+DEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQ+ ED EDGPPELLF+HGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED +    +V
Sbjct:    6 VAMDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLILGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVGTKIEVEIKINHEGEVNRARYMPQNPYIIATKTPTSEVLVFDYTKHPSVPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTVCLWDISGTPREGKVVEAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADQTVALWDLRNLKLKLHSFESHRDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQAAEDVEDGPPELLFVHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDTEPGVADV 421          

HSP 2 Score: 50.0618 bits (118), Expect = 7.513e-7
Identity = 39/165 (23.64%), Postives = 69/165 (41.82%), Query Frame = 3
Query:  942 PSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFES------HKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQ 1418
            P   +  H  E   +S+NP     L + S D TV LWD+     +    E+      H   +  V W   HE++  S   D++L +WD +R      P  + D           HTA+++  S++P + +++ + S D  + +W +          +S   E+ Q
Sbjct:  169 PDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTVCLWDISGTPREGKVVEAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWD-TRSNNTSKPSHSVDA----------HTAEVNCLSFNPYSEFILATGSADQTVALWDLRNLKLKLHSFESHRDEIFQ 322          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Sea Lamprey
Match: taf5l (TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-5987])

HSP 1 Score: 81.6481 bits (200), Expect = 1.114e-16
Identity = 67/230 (29.13%), Postives = 106/230 (46.09%), Query Frame = 3
Query:  666 LKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVW 1355
            L+ H    Y + + P  +G LLS S+D ++  WD        R     +++ GH+  V DV    L  + F S + DR   +W    +    P +    H ++VN + F+P   Y+ ATGSADRTV LW  +        F  H+  +  + +SP    +LAS G D+R+ +WD+              G   ++    GH+  I+  S+SP+   L  S S D  ++VW
Sbjct:  339 LRAHSGPVYAVRFLPGGAG-LLSCSEDASVRFWD-------PRTFTNTAVYQGHAYPVWDVDVSALGLY-FCSGSHDRTARLWVPERAF---PLRVYAGHVSDVNVVRFHPNGSYV-ATGSADRTVRLWSAQQ-GSAARLFTGHRGAVLALAFSPGGR-LLASGGEDQRVRLWDI--------------GSGAIVKELRGHSDDITCLSFSPDGSAL-ASGSSDGSVRVW 538          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Sea Lamprey
Match: pex7 (peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:ZDB-GENE-050320-105])

HSP 1 Score: 78.1814 bits (191), Expect = 4.173e-16
Identity = 54/184 (29.35%), Postives = 86/184 (46.74%), Query Frame = 3
Query:  651 QPD--LRL-KGHQKEGYGLSWNPKRS-GYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDL 1190
            QP+  LR+ +GH KE Y + W+  R    ++S S D+T  +WD          + +L+ + GH  VV    W       F S + D+ L +WD ++    R    + AH  EV    +  + + +L + + D  +  WDLRN+   + S   H   I +V+ SP   T+LAS   D  +  WD 
Sbjct:   99 QPEGPLRVYQGHTKEVYSVDWSQTRGENLVVSGSWDHTARVWD-------PAFLSSLAEYRGHEGVVYSTVWSPHIPSCFASASGDQTLRVWDVKSPHAAR--IVIPAHQEEVLSCDWCKYDQNLLVSAAVDCGIRGWDLRNIRQPVFSLLGHSYAIRRVRCSPFQPTVLASCSYDFSVRFWDF 273          

HSP 2 Score: 56.6102 bits (135), Expect = 4.197e-9
Identity = 45/174 (25.86%), Postives = 76/174 (43.68%), Query Frame = 3
Query:  843 DVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPF-SEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQM 1361
            DV+W   +EH+  + + D  L +WD   S    P +    H  EV  + ++    E ++ +GS D T  +WD   L+  L  +  H+  ++   WSPH  +  AS+  D+ L VWD+      +SP  A    P        H  ++    W      L+ S + D  ++ W +
Sbjct:   72 DVAWSEDNEHVLVTGSGDGSLQLWD--ASQPEGPLRVYQGHTKEVYSVDWSQTRGENLVVSGSWDHTARVWDPAFLS-SLAEYRGHEGVVYSTVWSPHIPSCFASASGDQTLRVWDV------KSPHAARIVIP-------AHQEEVLSCDWCKYDQNLLVSAAVDCGIRGWDL 229          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Sea Lamprey
Match: cop1 (COP1 E3 ubiquitin ligase [Source:ZFIN;Acc:ZDB-GENE-070410-134])

HSP 1 Score: 75.485 bits (184), Expect = 8.276e-15
Identity = 70/313 (22.36%), Postives = 128/313 (40.89%), Query Frame = 3
Query:  267 LEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEF-DINKYEPDKGEFGGFGSVN--GKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSR 1196
             +   + A+ LP   C         R  L  H  D +          P+D N+   + +++    +F  + SV     +     I +   +  +    ++    A    +  + VF+Y       D   +  P + +  + K    +SW+    G L S+  + T+ +WD  T  R +       +F  H      V ++L+   I  S +DD ++ +W T     +     ++A  A V C+ F+P S Y LA G AD  V  +DLRN  L +  F+ H+  +   ++    E + AS  TD +L +W +++
Sbjct:  250 FKMKRVKAKRLP---CHGNNSMAARRKKLSAHFDDLEQCYFTCRLSSPSDENKCGQLEEFQDCLAKFTRYSSVRPLATLSYASDIYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVFEYG--TVIRDAVDIHYPVIEMTCNSKIS-CISWSNYHKGILASSDYEGTVILWDGFTGQRTK-------VFQEHEKRCWSVDFNLMDPKILASGSDDAKVKLWSTHL---DNSVACIEA-KANVCCVKFSPTSRYHLAFGCADHCVHYYDLRNTKLPVMVFKGHRKAVSYAKFVSGEEIVSAS--TDSQLKLWSVNK 543          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Sea Lamprey
Match: cop1 (COP1 E3 ubiquitin ligase [Source:ZFIN;Acc:ZDB-GENE-070410-134])

HSP 1 Score: 75.0998 bits (183), Expect = 1.087e-14
Identity = 48/167 (28.74%), Postives = 79/167 (47.31%), Query Frame = 3
Query:  696 LSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSR 1196
            +SW+    G L S+  + T+ +WD  T  R +       +F  H      V ++L+   I  S +DD ++ +W T        S +     A V C+ F+P S Y LA G AD  V  +DLRN  L +  F+ H+  +   ++    E + AS  TD +L +W +++
Sbjct:  380 ISWSNYHKGILASSDYEGTVILWDGFTGQRTK-------VFQEHEKRCWSVDFNLMDPKILASGSDDAKVKLWSTHLD----NSVACIEAKANVCCVKFSPTSRYHLAFGCADHCVHYYDLRNTKLPVMVFKGHRKAVSYAKFVSGEEIVSAS--TDSQLKLWSVNK 533          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Yeast
Match: HAT2 (Subunit of the Hat1p-Hat2p histone acetyltransferase complex; required for high affinity binding of the complex to free histone H4, thereby enhancing Hat1p activity; similar to human RbAp46 and 48; has a role in telomeric silencing [Source:SGD;Acc:S000000782])

HSP 1 Score: 256.529 bits (654), Expect = 4.022e-81
Identity = 139/393 (35.37%), Postives = 218/393 (55.47%), Query Frame = 3
Query:  198 INEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTS-DEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENI 1373
            ++EEY +WK N P +YD V    L WPSLT QWLP  V      +    LI+GTHTS +E+N+L  A  ++P +    +  + E  +       +    I I  K  H+ E+ RARY+PQ+P I+AT +    V ++  ++        GL      LK H+  GY LS++    G LLS SDD+T+ +W++ +     + +   +    HS ++ D  WH  ++ +FG+V++D  L I D R + T   +          N ++F+  S  +LA    D  V L+DLRN+   LH    H+D +  +++S H + ++ SSG+D RL +WDL +IG EQ+P+DAEDG PEL+ +H GH + ++DF  +P  PWL+ S  E+NILQVW+ + ++
Sbjct:   10 VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLYSRSE--------GLQS---TLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDL--HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKC---PQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Yeast
Match: MSI1 (Subunit of chromatin assembly factor I (CAF-1); chromatin assembly by CAF-1 affects multiple processes including silencing at telomeres, mating type loci, and rDNA; maintenance of kinetochore structure; deactivation of DNA damage checkpoint after DNA repair; chromatin dynamics during transcription; and repression of divergent noncoding transcription; Msi1p localizes to nucleus and cytoplasm and independently regulates the RAS/cAMP pathway via sequestration of Npr1p kinase [Source:SGD;Acc:S000000399])

HSP 1 Score: 188.348 bits (477), Expect = 6.500e-55
Identity = 131/420 (31.19%), Postives = 205/420 (48.81%), Query Frame = 3
Query:  198 INEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTS-----DEQNHL--LIATAHIPTDS-NEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPA-KPDPNGLCQP-DLRLKGHQ----------------KEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDA-LSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGT-DRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENI 1373
            + E Y  WKKNT  LYD + T++ +WPSLT Q+ PD+     +    HR++L + TS     DE  ++  +    HI   S N FD+++ E        F S +   +I+I    +GE NRARYLPQNP IIA  S    + +FD TKH + +   + +  P + +L G                   E   L+WN ++   LLS+  +  + +WDI     +  IID  L       + V DV+W   H+ +F +  +   + + D RT      S   + H   VN   FN  +  ILA+  ++  + LWD+RN+N    +   H   +  ++WSP+ +T+LA++G  D  + +WD S                E +F HGGH   ++D SW  + PWL+CSV+ DN + +W+ A N+
Sbjct:   19 LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDE----HRILLSSFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFF-PNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNR-EKHDGGVNSCRFNYKNSLILASADSNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAGQEDGLVKLWDTS--------------CEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGNL 418          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Yeast
Match: RRB1 (Specific chaperone for ribosomal protein Rpl3p; binds to nascent Rpl3p during translation; essential gene [Source:SGD;Acc:S000004738])

HSP 1 Score: 109.383 bits (272), Expect = 5.058e-26
Identity = 102/402 (25.37%), Postives = 175/402 (43.53%), Query Frame = 3
Query:  234 PFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLIL-GTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLP----QNPTIIATKSPSSDVLVFDYTKH------PAKPDPNGLCQPDLRLKGHQK-EGYGLSWNPK-RSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLN-------LKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGE-----EQSPEDAE--DGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQ 1358
            P +Y+++    + WP LT   +PD +  E ++Y    L+   T +S ++ + L+  A   ++  +  +      + +          +  N  I      NR +  P        + AT S + DV +++          P    P    +P   +K H   EGYGL W+P  ++G LLS      I     +TS   + + D       ++  +ED+ W      +F +   D  + IWDTR S  ++P+ SV A   +VN IS++    Y+LA+G  + T  +WDLR            +  ++ HK  I  + ++P  E+I+A    D  + +WDLS   +     +Q+ E  E  + PP+LLF+H     ++ D  W    P  + S   D  L VW+
Sbjct:  115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLAL--SNLAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTATMSENGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTS---RWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTR-SKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 507          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Yeast
Match: PEX7 (Peroxisomal signal receptor for peroxisomal matrix proteins; recognizes the N-terminal nonapeptide signal (PTS2); WD repeat protein; defects in human homolog cause lethal rhizomelic chondrodysplasia punctata (RCDP) [Source:SGD;Acc:S000002549])

HSP 1 Score: 67.3958 bits (163), Expect = 1.269e-12
Identity = 68/276 (24.64%), Postives = 112/276 (40.58%), Query Frame = 3
Query:  654 PDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWD-------INTSPRD---QRIIDALSI-------FTGHS---SVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNL------------KLHSFE-------SHKDEIFQVQWSPHHETILASSGTDRRLHVW-DLSRIG-EEQSPEDAEDGPPELLFIHGGHTAKISDFSWSP-NTPWLICSVSEDNILQVW 1355
            P    K H++E +  +WN       LS+S D +I +W        +  +PR     +++D L+        FTG S   + V    +    +++  S + +    ++D R       +  +     E     FN +  Y++ATG  D  + +WD+R LN             +LH+         +H   I +V WSPHH  IL S+  D    +W DLS  G +E    ++ D     +F    H+  +    WS    P  + S + D  L VW
Sbjct:   96 PIAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMTLTPRPLEITKMVDPLNAIILKKKSFTGISKNRNCVYQAQFSPHDQNLVLSCSGNSYASLFDIRLPSGKNQNNFLVHSGLEALTCDFNKYRPYVVATGGVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLAIRKVTWSPHHSNILMSASYDMTCRIWRDLSNDGAKETYKTNSTDATKGSIFNFTQHSEFVFGADWSLWGKPGYVASTAWDGNLFVW 371          

HSP 2 Score: 55.4546 bits (132), Expect = 7.740e-9
Identity = 58/277 (20.94%), Postives = 116/277 (41.88%), Query Frame = 3
Query:  690 YGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIW-----DTRTSVTNRP----------------SQSVDAHAAEVNCI---SFNPFSEYILATGSADRTVALWDLRNLNLK-LHSFESHKD-EIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLF------IHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNS 1424
            + L+WN      +L A  D T+ ++D  T+ ++  I    +IF  H   V   +W+L++   F S + D  + IW      +  ++T RP                 +S    +   NC+    F+P  + ++ + S +   +L+D+R  + K  ++F  H   E     ++ +   ++A+ G D  + +WD+  + + +S       P +L        I   H   I   +WSP+   ++ S S D   ++W+   N    E   + + +  + S
Sbjct:   64 FDLAWNESHENQVLVAQGDGTLRLFD--TTFKEFPI----AIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMTLTPRPLEITKMVDPLNAIILKKKSFTGISKNRNCVYQAQFSPHDQNLVLSCSGNSYASLFDIRLPSGKNQNNFLVHSGLEALTCDFNKYRPYVVATGGVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLAIRKVTWSPHHSNILMSASYDMTCRIWRDLSNDGAKETYKTNSTDATKGS 334          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Yeast
Match: ASC1 (G-protein beta subunit and guanine dissociation inhibitor for Gpa2p; ortholog of RACK1 that inhibits translation; core component of the small (40S) ribosomal subunit; required to prevent frameshifting at ribosomes stalled at repeated CGA codons; regulates P-body formation induced by replication stress; represses Gcn4p in the absence of amino acid starvation [Source:SGD;Acc:S000004722])

HSP 1 Score: 66.6254 bits (161), Expect = 1.358e-12
Identity = 62/239 (25.94%), Postives = 111/239 (46.44%), Query Frame = 3
Query:  666 LKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFG-SVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHE-----TILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMA 1364
            L+GH      L+ +  +   LLSAS D T+  W +  +  DQ+    +  F GHS +V+D +  L  +  +  S + D+ L +WD  T  T    Q    H ++V  +  +  +  I+ +GS D+T+ +W ++   L   +   H D + QV+  P+ +       + S+G D+ +  W+L++   E              FI  GH + I+  + SP+   LI S  +D  + +W +A
Sbjct:   13 LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKL--TGDDQKFGVPVRSFKGHSHIVQDCT--LTADGAYALSASWDKTLRLWDVATGET---YQRFVGHKSDVMSVDIDKKASMII-SGSRDKTIKVWTIKGQCLA--TLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEAD------------FI--GHNSNINTLTASPDGT-LIASAGKDGEIMLWNLA 226          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Nematostella
Match: EDO42058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2K4])

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 319/407 (78.38%), Postives = 368/407 (90.42%), Query Frame = 3
Query:  195 VINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTS-PRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEV 1412
            +INEEYKIWKKNTPFLYDLVMTHALEWPSLT QWLPDV  PEGKDY +HRLILGTHTSDEQNH++IA+  +P D  +FD + Y+ DKGEFGGF SV+GKI+I IKINH+GEVNRAR++PQNP IIATK+PS+DVLVFDYTKHP+KPDPNG C PDLRLKGH KEGYGLSWNP  +G LLSASDD+TIC+WDI++   ++Q+ +DA+ IFTGHS+VVEDVSWHLLHE +FGSVADD +LMIWDTR + +N+ + +VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRLHVWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+PN PW++CSVSEDNI+QVWQMAENIYNDE+L++   E+
Sbjct:    1 MINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVTKPEGKDYSVHRLILGTHTSDEQNHVVIASVQLPNDEAQFDASHYDNDKGEFGGFASVSGKIDIEIKINHEGEVNRARFMPQNPCIIATKTPSADVLVFDYTKHPSKPDPNGECSPDLRLKGHTKEGYGLSWNPNVNGNLLSASDDHTICLWDISSGISKEQKTVDAMRIFTGHSAVVEDVSWHLLHESLFGSVADDHKLMIWDTRQTNSNKAAHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVLCSVSEDNIMQVWQMAENIYNDEELETPASEL 407          

HSP 2 Score: 51.9878 bits (123), Expect = 3.740e-7
Identity = 36/166 (21.69%), Postives = 68/166 (40.96%), Query Frame = 3
Query:  942 PSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLK-------LHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQ 1418
            P   +  H  E   +S+NP     L + S D T+ LWD+ +   K       +  F  H   +  V W   HE++  S   D +L +WD  +    ++    +            HTA+++  S++P + +++ + S D  + +W +          +S   E+ Q
Sbjct:  154 PDLRLKGHTKEGYGLSWNPNVNGNLLSASDDHTICLWDISSGISKEQKTVDAMRIFTGHSAVVEDVSWHLLHESLFGSVADDHKLMIWDTRQTNSNKAAHTVD-----------AHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQ 308          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Nematostella
Match: EDO34980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMS9])

HSP 1 Score: 121.709 bits (304), Expect = 3.479e-30
Identity = 88/293 (30.03%), Postives = 138/293 (47.10%), Query Frame = 3
Query:  504 IKINHDGEVNRARY--LPQNPTIIATKSPSSDVLVFDYTKHP-AKPDPNGLCQPD-----LRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPR---DQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLK---LHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLS--RIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSE 1334
            + + H+G VNR R+  +P N  I+A+ S    V ++D      A  +P    QP          GH  EG+ + W+    G LL+    + + +W+         DQR       F  H+  VEDV W     ++F S + D+ + IWD R   +     S +AH A+VN IS+N    +I+ +G  D  + +WDLR L  +   +  F+     I  V+W P   ++ A+S  D ++ +WDL+  R    + P    D PP+LLFIH G    I +  W P  P ++ S +E
Sbjct:  123 VMLKHNGGVNRIRHGHIP-NRHIVASWSERGSVHIWDVEAQIIASDNPGSSSQPRESSPLFTFSGHASEGFAMDWSRNTHGRLLTGDCKHNVHLWNPQEGGSWHVDQRP------FNAHTDSVEDVQWSPNENNVFASCSVDKTIRIWDARAMPSKACMISTNAHDADVNVISWNRNEPFIV-SGGDDGILKVWDLRQLQKQGQPVALFKHSTGPITSVEWHPTDGSVFAASSADNQITLWDLAVERDEAAEGPGRHLDVPPQLLFIHMGQK-DIKELHWHPQLPGVLISTAE 406          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Nematostella
Match: EDO38818 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBS0])

HSP 1 Score: 103.219 bits (256), Expect = 1.728e-24
Identity = 63/191 (32.98%), Postives = 99/191 (51.83%), Query Frame = 3
Query:  624 AKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWD-INTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLS 1193
            A P+P    QP    KGH  E YG+ W  +   ++LSAS D+TI +WD + T       I  +++FTGH +VV    W       F S + D+ + IWD   +   RP Q + AH  EV    +  + ++++ +GS D  +  WD+RN N  + SF++H   + +++ SPH   I+AS   D  +  WD +
Sbjct:   91 ALPEP----QPVRVFKGHTAEVYGVDWC-REQDFVLSASWDHTIRLWDPLRTE------IPTVAMFTGHQNVVYSSIWSPHIPRTFASASGDQHIGIWDM--ACPGRPQQLIRAHEGEVLTCDWAKYDQHLVVSGSVDTLIKGWDVRNTNAPVFSFKAHPYAVRRLKCSPHQGNIIASCSYDFTIKTWDTT 268          

HSP 2 Score: 63.5438 bits (153), Expect = 4.225e-11
Identity = 49/179 (27.37%), Postives = 73/179 (40.78%), Query Frame = 3
Query:  666 LKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIG 1202
              GHQ   Y   W+P       SAS D  I +WD+    R Q++I A      H   V    W    +H+  S + D  +  WD R   TN P  S  AH   V  +  +P    I+A+ S D T+  WD  +    L + E H +    + ++ H    +A    D  + V+    +G
Sbjct:  145 FTGHQNVVYSSIWSPHIPRTFASASGDQHIGIWDMACPGRPQQLIRA------HEGEVLTCDWAKYDQHLVVSGSVDTLIKGWDVRN--TNAPVFSFKAHPYAVRRLKCSPHQGNIIASCSYDFTIKTWDTTSTLAPLETIEHHSEFATGLDFNIHQPGQIADCSFDGMVTVYSPRSLG 315          

HSP 3 Score: 55.8398 bits (133), Expect = 1.417e-8
Identity = 42/174 (24.14%), Postives = 79/174 (45.40%), Query Frame = 3
Query:  843 DVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWD-LRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQM 1361
            D +W   ++ +  S + D  L +W+       +P +    H AEV  + +    +++L + S D T+ LWD LR     +  F  H++ ++   WSPH     AS+  D+ + +WD++  G           P +L+  H G   ++    W+     L+ S S D +++ W +
Sbjct:   65 DCTWSEYNKDVVISASGDGSLQLWNLALP-EPQPVRVFKGHTAEVYGVDWCREQDFVL-SASWDHTIRLWDPLRTEIPTVAMFTGHQNVVYSSIWSPHIPRTFASASGDQHIGIWDMACPGR----------PQQLIRAHEG---EVLTCDWAKYDQHLVVSGSVDTLIKGWDV 223          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Nematostella
Match: EDO33060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST98])

HSP 1 Score: 88.9669 bits (219), Expect = 9.662e-19
Identity = 76/255 (29.80%), Postives = 117/255 (45.88%), Query Frame = 3
Query:  663 RLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQNSS 1427
            RL GH    + +S +   + +LLS S+D TI +W + T          L  + GH+  V DV +     H F S + DR   +W T      +P +    H ++VN I+F+P   YI ATGS+DRTV LWD++     +  F  HK  +  + +S +   ++ SSG D RL VWDL+                 L+    GHT  +    +S +   ++ S   DN +++W  +     DED D      +  SS
Sbjct:  342 RLVGHSGPVFAVSID-HDNKFLLSCSEDKTIRLWSLFT-------FTTLVAYRGHNYPVWDVQF-CPRGHYFASTSHDRTARLWSTDH---QQPLRIFAGHVSDVNVIAFHPNCNYI-ATGSSDRTVRLWDIQT-GSSVRLFTGHKAAVQSLAFSRNGRHLI-SSGVDTRLLVWDLAE--------------GTLVAELKGHTDTVYSLCFSRDGT-ILASAGLDNCIKLWNTSVFCNQDEDDDDGRHAGLDKSS 566          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Nematostella
Match: EDO29288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T426])

HSP 1 Score: 80.8777 bits (198), Expect = 1.433e-17
Identity = 73/255 (28.63%), Postives = 114/255 (44.71%), Query Frame = 3
Query:  591 DVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVW 1355
            D   FD T   ++           RL GH    + +S +     +LLS S+D TI +W + T          L  + GH+  V DV +     H F S + DR   +W T      +P +    H ++VN ++F+P   YI ATGS+DRTV LWD++     +  F  HK  +  + +S +   ++ SSG D RL VWDL+                 L+    GHT  +    +S +   ++ S   DN +++W
Sbjct:    3 DAFCFDRTASESR-----------RLVGHSGPVFAVSIDHDNK-FLLSCSEDKTIRLWSLFT-------FTTLVAYRGHNYPVWDVQF-CPRGHYFASTSHDRTARLWSTDH---QQPLRIFAGHVSDVNKVAFHPNCNYI-ATGSSDRTVRLWDIQT-GSSVRLFTGHKAAVQSLAFSRNGRHLI-SSGVDTRLLVWDLA--------------EGTLVAELKGHTDTVYSLCFSRDGT-ILASAGLDNCIKLW 216          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Medaka
Match: rbbp4 (RB binding protein 4, chromatin remodeling factor [Source:NCBI gene;Acc:101155071])

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 332/412 (80.58%), Postives = 379/412 (91.99%), Query Frame = 3
Query:  183 IEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVVQ 1418
            +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDV  PEGKDY +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KGEFGGFGSV+GKIEI IKINH+GEVNRARY+PQNP IIATK+P+SDVLVFDYTKHP+KPDP+G C PDLRL+GHQKEGYGLSWNP  SG LLSASDD+TIC+WDI+T P++ +I+DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++PS +VDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSW+PN PW+ICSVSEDNI+QVWQMAENIYNDED + A    VQ
Sbjct:   12 VEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGAADSEVQ 423          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Medaka
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:101156710])

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 329/410 (80.24%), Postives = 374/410 (91.22%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKG-EFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDS 1397
            +DD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLT QWLPDV  PEGKDY +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KG EFGGFGSV+GKIEI IKINHDGEVNRARY+PQNP IIATK+P+SDVLVFDYTKHPAKPDP+G C PDLRLKGHQKEGYGLSWNP  SG LLSASDD+TIC+WDI   P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++ S SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELLFIHGGHTAKISDFSW+P  PW+ICSVSEDNI+QVWQMAENIYNDE+ D+
Sbjct:   44 YDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVSRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQVPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHDGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPAKPDPSGECSPDLRLKGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDIGAGPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPGEPWIICSVSEDNIMQVWQMAENIYNDEEPDN 453          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Medaka
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:101156710])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 320/424 (75.47%), Postives = 363/424 (85.61%), Query Frame = 3
Query:  171 FDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKG-EFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELL--------------------------FIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQM 1361
            +DD +EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLT QWLPDV  PEGKDY +HRL+LGTHTSDEQNHL+IA+  +P D  +FD + Y+ +KG EFGGFGSV+GKIEI IKINHDGEVNRARY+PQNP IIATK+P+SDVLVFDYTKHPAKPDP+G C PDLRLKGHQKEGYGLSWNP  SG LLSASDD+TIC+WDI   P++ +++DA +IFTGH++VVEDVSWHLLHE +FGSVADD++LMIWDTR++ T++ S SVDAH AEVNC+SFNP+SE+ILATGSAD+TVALWDLRNL LKLHSFESHKDEIFQVQWSPH+ETILASSGTDRRL+VWDLS+IGEEQS EDAEDGPPELL                          FIHGGHTAKISDFSW+P  PW+ICSVSEDNI+QVWQM
Sbjct:   44 YDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVSRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQVPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHDGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPAKPDPSGECSPDLRLKGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDIGAGPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLVGPLASRLVGGLLKVLMWSFPVVLHQFIHGGHTAKISDFSWNPGEPWIICSVSEDNIMQVWQM 467          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Medaka
Match: grwd1 (glutamate rich WD repeat containing 1 [Source:NCBI gene;Acc:101163517])

HSP 1 Score: 118.627 bits (296), Expect = 1.554e-28
Identity = 93/296 (31.42%), Postives = 136/296 (45.95%), Query Frame = 3
Query:  516 HDGEVNRARYLP-QNPTIIATKSPSSDVLVFDY-----TKHPAKPDPNGLCQ-----PDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPR--------DQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVD-AHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNL--KLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSP--EDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVS 1331
            H G VNR R       ++ A  S    V +FD        H +      L Q     P     GH  EG+ + W+PK  G L+S      I +W+    PR        DQR       F+ HS  VED+ W      +F S + D+ + +WD R    +    SVD AHA+++N IS+N  SE  L +G  D  + +WDLR       + +F+ H   I  V+WSP   ++ A+SG D  +  WDLS    +     E  +D PP+LLF+H G + +I +  W P  P ++ S +
Sbjct:  154 HYGGVNRVRVTQCGQQSLAAVWSEKGQVEIFDLRPQLEAVHSSAAMSAFLQQQKEAKPLFSFSGHMSEGFAIDWSPKAPGRLVSGDCKKNIHVWE----PREGGSAWQIDQRP------FSSHSKSVEDLQWSPTEATVFASCSVDQSIRVWDIRAPPNSM--LSVDGAHASDINVISWNR-SEPFLLSGGDDGLLKVWDLRQFKTGRAVANFKQHSAPITSVEWSPADSSVFAASGADDVISQWDLSVESSDVGARVEGLKDLPPQLLFLHQGQS-EIKEIHWHPQIPGVMISTA 435          

HSP 2 Score: 63.1586 bits (152), Expect = 2.498e-10
Identity = 39/147 (26.53%), Postives = 71/147 (48.30%), Query Frame = 3
Query:  939 RPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRN----LNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAE 1367
            +P  S   H +E   I ++P +   L +G   + + +W+ R       +    F SH   +  +QWSP   T+ AS   D+ + VWD+      ++P      P  +L + G H + I+  SW+ + P+L+ S  +D +L+VW + +
Sbjct:  210 KPLFSFSGHMSEGFAIDWSPKAPGRLVSGDCKKNIHVWEPREGGSAWQIDQRPFSSHSKSVEDLQWSPTEATVFASCSVDQSIRVWDI------RAP------PNSMLSVDGAHASDINVISWNRSEPFLL-SGGDDGLLKVWDLRQ 343          

HSP 3 Score: 51.9878 bits (123), Expect = 8.795e-7
Identity = 45/200 (22.50%), Postives = 83/200 (41.50%), Query Frame = 3
Query:  783 RDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTS-----VTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNL-NLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMA 1364
            + Q+    L  F+GH S    + W         S    + + +W+ R       +  RP  S   H+  V  + ++P    + A+ S D+++ +WD+R   N  L    +H  +I  + W+   E  L S G D  L VWDL +    ++  + +            H+A I+   WSP    +  +   D+++  W ++
Sbjct:  204 QQQKEAKPLFSFSGHMSEGFAIDWSPKAPGRLVSGDCKKNIHVWEPREGGSAWQIDQRPFSS---HSKSVEDLQWSPTEATVFASCSVDQSIRVWDIRAPPNSMLSVDGAHASDINVISWN-RSEPFLLSGGDDGLLKVWDLRQFKTGRAVANFKQ-----------HSAPITSVEWSPADSSVFAASGADDVISQWDLS 388          
BLAST of Histone-binding protein RBBP7 vs. Ensembl Medaka
Match: taf5l (TATA-box binding protein associated factor 5 like [Source:NCBI gene;Acc:101159161])

HSP 1 Score: 97.0561 bits (240), Expect = 5.796e-21
Identity = 89/297 (29.97%), Postives = 142/297 (47.81%), Query Frame = 3
Query:  534 RARYLPQNP--TIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLR-LKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSATKEVV 1415
            RAR L   P    ++    + DVL  D      + D NG C  +++ L+GH    Y  ++    SG LLS S+D TI  WD+ +            ++ GH+  V DV       + FGS + DR   +W   T     P +    H ++V+CI F+P S Y LATGS D+TV LW  +     +  F  H+  +  + +SP+ +  LAS+G D+R+ +WDL+                 L     GHT  ++  S+SP++  L+ S S DN ++VW +  + ++    D ++ E+V
Sbjct:  310 RARKLKATPHQVDVSRIHLACDVLEED------RDDENG-CGSEIKTLRGHSGPVYRTAFLTDSSG-LLSCSEDTTIRYWDLGS-------FTNTVLYQGHAYPVWDVDVSPCSLY-FGSCSQDRTARLW---TFSRTYPLRIYAGHLSDVDCIKFHPNSNY-LATGSTDKTVRLWSTQQ-GASVRLFTGHRGPVLSLAFSPNGK-YLASAGEDQRVKLWDLA--------------SGTLFKDLRGHTDSVTSLSFSPDSS-LVASSSMDNSVRVWDIRSS-HSGTPADGSSSELV 568          
BLAST of Histone-binding protein RBBP7 vs. Planmine SMEST
Match: SMESG000062893.1 (SMESG000062893.1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 269/408 (65.93%), Postives = 332/408 (81.37%), Query Frame = 3
Query:  192 RVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGL-CQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINT---SPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDEDLDSAT 1403
            R+INE+YKIWK++TPFLYD +M H LEWPSLTAQWLP +  P  KDY +HRLILGTHTSDEQNHLLIA+ ++P D  EFD + Y+ ++ ++GGFG  NGK+EI + INH+GEVNRARY+PQN T +ATK+P++DVL+F+Y  HPA+P   G+  +P+LRLKGH KEGYGLSWNP ++GY+LSASDD TICMWD NT   S  +   I+ L  F GH++VVEDV+WHL H  +FGSVADD++LMIWD R+  T++P   VDAH AEVNCI+FNPF+++++ TGSAD+TVA+WD+RNL LKLHSFE+H+DEIFQVQWSPH+ETI ASSGTDRRLH+WD S+IG EQ   +  DGPPELLFIH GHTAKISDFSW+   PW ICSV+EDNILQVWQMA+ +YND D DS  
Sbjct:   19 RIINEDYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARP--FGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTV 424          
BLAST of Histone-binding protein RBBP7 vs. Planmine SMEST
Match: SMESG000007931.1 (SMESG000007931.1)

HSP 1 Score: 430.639 bits (1106), Expect = 2.886e-148
Identity = 203/391 (51.92%), Postives = 274/391 (70.08%), Query Frame = 3
Query:  204 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPR---DQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAE 1367
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+   E KDY   R+I+GT   +EQ++LLIA+  +P +   F+   Y+ +K EFGG+G V    +I+IKINHDG +NRARYLPQ P +IATKS + +V +FDYT+HP+KPD +G C+PDL LKGH +EG+GLSWN K +G LLS++ D TI +WD+N +P    D +++++LS + GH   VEDV WH   + +FGSV  D+ L+IWD R S   +P+  V AH+ +V  + FNPFSEYILATGS D+T+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++H+WDL + G  +    +E    EL FIH GH +++ DF+W+ N P ++ SVS DNILQ+WQ +E
Sbjct:   14 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDVNCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRES---KPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKEKNYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 397          
BLAST of Histone-binding protein RBBP7 vs. Planmine SMEST
Match: SMESG000007931.1 (SMESG000007931.1)

HSP 1 Score: 409.838 bits (1052), Expect = 2.326e-140
Identity = 196/391 (50.13%), Postives = 262/391 (67.01%), Query Frame = 3
Query:  204 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPR---DQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAE 1367
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+   E KDY   R+I+GT   +EQ++LLIA+  +P +   F+   Y+ +K EFGG+G V    +I+IKINHDG +NRARYLPQ P +IATKS + +V +FDYT+HP+KPD +G C+PDL LKGH +EG+GLSWN K +G LLS++ D TI +WD+N +P    D +++++LS + GH   VEDV WH   + +FGSV  D+ L+IWD                        FNPFSEYILATGS D+T+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++H+WDL + G  +    +E    EL FIH GH +++ DF+W+ N P ++ SVS DNILQ+WQ +E
Sbjct:   14 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDVNCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRH----------------------FNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKEKNYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 378          
BLAST of Histone-binding protein RBBP7 vs. Planmine SMEST
Match: SMESG000037114.1 (SMESG000037114.1)

HSP 1 Score: 301.212 bits (770), Expect = 6.462e-98
Identity = 168/408 (41.18%), Postives = 241/408 (59.07%), Query Frame = 3
Query:  174 DDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTR---TSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDE 1385
            DD IEER      +IWK N P +Y+L     L+WPS T QWLP     + +D+ +++++LGTH  +E+N L+ A  +I ++SNE D    + +  +      +NGK+ I   +NH G+VNRARY+PQN +I+ATKS   D  ++         D N L    L L GH  EGYG+SWN +  G LL+ S D TIC +DI+ S     +  A +I TGH   VEDV WH    +IFGSV DD++L+IWD R    S ++ P Q V AHA + NC+S++P +  +L TG AD  V LWD R L   LH F++    +++V WSP  ET+  S+G   ++H+WD+ +IG++    D ED  P EL  IH GH   ++D  W P     + SV+EDN++ VWQ+ ++I+ DE
Sbjct:    3 DDTIEER------RIWKINCPLMYNLAHFDTLDWPSFTCQWLP--FEEKHEDHTIYKILLGTHADEEENKLIYAD-YIISNSNEAD--SIQINGADNKSRLPLNGKLVITKTVNHKGDVNRARYMPQNSSIVATKSSEKDSFIY--------SDGNCL----LTLSGHSDEGYGISWNQQVEGRLLTCSFDQTICAFDISQSAGGSTLNPARTI-TGHQDKVEDVCWHPAEANIFGSVGDDQRLLIWDYRRKEASSSSGPVQQVVAHAGDANCLSWHPVTSCLLLTGGADGLVHLWDQRKLVSALHVFDTEA-SVYRVAWSPLQETLFLSAGLQHKIHIWDVEKIGDDVLSYDEEDRFPAELAMIHSGHADAVTDIDWHPYLKATVASVAEDNMVNVWQIKDSIFADE 385          
BLAST of Histone-binding protein RBBP7 vs. Planmine SMEST
Match: SMESG000037114.1 (SMESG000037114.1)

HSP 1 Score: 301.212 bits (770), Expect = 7.113e-98
Identity = 168/408 (41.18%), Postives = 241/408 (59.07%), Query Frame = 3
Query:  174 DDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYEPDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDVLVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDDNTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADDRQLMIWDTR---TSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVALWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSRIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNILQVWQMAENIYNDE 1385
            DD IEER      +IWK N P +Y+L     L+WPS T QWLP     + +D+ +++++LGTH  +E+N L+ A  +I ++SNE D    + +  +      +NGK+ I   +NH G+VNRARY+PQN +I+ATKS   D  ++         D N L    L L GH  EGYG+SWN +  G LL+ S D TIC +DI+ S     +  A +I TGH   VEDV WH    +IFGSV DD++L+IWD R    S ++ P Q V AHA + NC+S++P +  +L TG AD  V LWD R L   LH F++    +++V WSP  ET+  S+G   ++H+WD+ +IG++    D ED  P EL  IH GH   ++D  W P     + SV+EDN++ VWQ+ ++I+ DE
Sbjct:    4 DDTIEER------RIWKINCPLMYNLAHFDTLDWPSFTCQWLP--FEEKHEDHTIYKILLGTHADEEENKLIYAD-YIISNSNEAD--SIQINGADNKSRLPLNGKLVITKTVNHKGDVNRARYMPQNSSIVATKSSEKDSFIY--------SDGNCL----LTLSGHSDEGYGISWNQQVEGRLLTCSFDQTICAFDISQSAGGSTLNPARTI-TGHQDKVEDVCWHPAEANIFGSVGDDQRLLIWDYRRKEASSSSGPVQQVVAHAGDANCLSWHPVTSCLLLTGGADGLVHLWDQRKLVSALHVFDTEA-SVYRVAWSPLQETLFLSAGLQHKIHIWDVEKIGDDVLSYDEEDRFPAELAMIHSGHADAVTDIDWHPYLKATVASVAEDNMVNVWQIKDSIFADE 386          
The following BLAST results are available for this feature:
BLAST of Histone-binding protein RBBP7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBBP40.000e+079.67RB binding protein 4, chromatin remodeling factor ... [more]
RBBP40.000e+079.67RB binding protein 4, chromatin remodeling factor ... [more]
RBBP70.000e+078.74RB binding protein 7, chromatin remodeling factor ... [more]
RBBP70.000e+078.74RB binding protein 7, chromatin remodeling factor ... [more]
RBBP42.954e-681.11RB binding protein 4, chromatin remodeling factor ... [more]
back to top
BLAST of Histone-binding protein RBBP7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-531.294e-769.78Probable histone-binding protein lin-53 [Source:U... [more]
rba-14.681e-15253.60Probable histone-binding protein rba-1 [Source:Un... [more]
Y54H5A.14.597e-2527.30pep chromosome:WBcel235:III:5153543:5155465:1 gene... [more]
Y54H5A.14.597e-2527.30pep chromosome:WBcel235:III:5153464:5155465:1 gene... [more]
Y54H5A.14.597e-2527.30pep chromosome:WBcel235:III:5153406:5155436:1 gene... [more]
back to top
BLAST of Histone-binding protein RBBP7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Caf1-550.000e+078.76gene:FBgn0263979 transcript:FBtr0301845[more]
Caf1-550.000e+078.76gene:FBgn0263979 transcript:FBtr0083052[more]
l(2)098511.088e-3131.76gene:FBgn0022288 transcript:FBtr0335269[more]
l(2)098511.088e-3131.76gene:FBgn0022288 transcript:FBtr0086043[more]
Pex71.143e-2128.15gene:FBgn0035922 transcript:FBtr0076568[more]
back to top
BLAST of Histone-binding protein RBBP7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp40.000e+080.29retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbb4l0.000e+079.24retinoblastoma binding protein 4, like [Source:NCB... [more]
rbb4l0.000e+079.05retinoblastoma binding protein 4, like [Source:NCB... [more]
rbb4l0.000e+079.05retinoblastoma binding protein 4, like [Source:NCB... [more]
CR450764.74.806e-4876.04pep chromosome:GRCz11:CHR_ALT_CTG11_3_1:12801933:1... [more]
back to top
BLAST of Histone-binding protein RBBP7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp40.000e+079.43retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbbp40.000e+077.62retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbbp70.000e+077.57retinoblastoma binding protein 7 [Source:NCBI gene... [more]
rbbp70.000e+077.57retinoblastoma binding protein 7 [Source:NCBI gene... [more]
rbbp40.000e+073.61retinoblastoma binding protein 4 [Source:NCBI gene... [more]
back to top
BLAST of Histone-binding protein RBBP7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbbp40.000e+079.67retinoblastoma binding protein 4, chromatin remode... [more]
Rbbp78.323e-778.50retinoblastoma binding protein 7, chromatin remode... [more]
Rbbp78.244e-776.57retinoblastoma binding protein 7, chromatin remode... [more]
Rbbp70.000e+078.61retinoblastoma binding protein 7, chromatin remode... [more]
Rbbp71.073e-11577.18retinoblastoma binding protein 7, chromatin remode... [more]
back to top
BLAST of Histone-binding protein RBBP7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60972|RBBP4_MOUSE0.000e+079.67Histone-binding protein RBBP4 OS=Mus musculus OX=1... [more]
sp|Q09028|RBBP4_HUMAN0.000e+079.67Histone-binding protein RBBP4 OS=Homo sapiens OX=9... [more]
sp|Q3MHL3|RBBP4_BOVIN0.000e+079.67Histone-binding protein RBBP4 OS=Bos taurus OX=991... [more]
sp|Q5M7K4|RBBP4_XENTR0.000e+079.43Histone-binding protein RBBP4 OS=Xenopus tropicali... [more]
sp|Q6P3H7|RBBP4_DANRE0.000e+079.81Histone-binding protein RBBP4 OS=Danio rerio OX=79... [more]
back to top
BLAST of Histone-binding protein RBBP7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2T0G10.000e+098.72Retinoblastoma-associated proteins 46/48 OS=Dugesi... [more]
T1JFL00.000e+079.47WD_REPEATS_REGION domain-containing protein OS=Str... [more]
A0A556TPH80.000e+080.53Histone-binding protein RBBP4 OS=Bagarius yarrelli... [more]
A0A3N0XZH60.000e+080.29Histone-binding protein RBBP4 OS=Anabarilius graha... [more]
A0A498MLJ20.000e+080.29Histone-binding RBBP4 OS=Labeo rohita OX=84645 GN=... [more]
back to top
BLAST of Histone-binding protein RBBP7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp40.000e+080.58RB binding protein 4, chromatin remodeling factor ... [more]
rbb4l0.000e+079.05histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
grwd11.401e-2829.25glutamate rich WD repeat containing 1 [Source:NCBI... [more]
taf51.047e-1931.73TATA-box binding protein associated factor 5 [Sour... [more]
taf51.047e-1931.73TATA-box binding protein associated factor 5 [Sour... [more]
back to top
BLAST of Histone-binding protein RBBP7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008002.17.513e-777.40pep scaffold:Pmarinus_7.0:GL477852:421:9512:1 gene... [more]
taf5l1.114e-1629.13TAF5-like RNA polymerase II, p300/CBP-associated f... [more]
pex74.173e-1629.35peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:Z... [more]
cop18.276e-1522.36COP1 E3 ubiquitin ligase [Source:ZFIN;Acc:ZDB-GENE... [more]
cop11.087e-1428.74COP1 E3 ubiquitin ligase [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Histone-binding protein RBBP7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HAT24.022e-8135.37Subunit of the Hat1p-Hat2p histone acetyltransfera... [more]
MSI16.500e-5531.19Subunit of chromatin assembly factor I (CAF-1); ch... [more]
RRB15.058e-2625.37Specific chaperone for ribosomal protein Rpl3p; bi... [more]
PEX71.269e-1224.64Peroxisomal signal receptor for peroxisomal matrix... [more]
ASC11.358e-1225.94G-protein beta subunit and guanine dissociation in... [more]
back to top
BLAST of Histone-binding protein RBBP7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420583.740e-778.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349803.479e-3030.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388181.728e-2432.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330609.662e-1929.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292881.433e-1728.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone-binding protein RBBP7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp40.000e+080.58RB binding protein 4, chromatin remodeling factor ... [more]
rbb4l0.000e+080.24histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
rbb4l0.000e+075.47histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
grwd11.554e-2831.42glutamate rich WD repeat containing 1 [Source:NCBI... [more]
taf5l5.796e-2129.97TATA-box binding protein associated factor 5 like ... [more]
back to top
BLAST of Histone-binding protein RBBP7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062893.10.000e+065.93SMESG000062893.1[more]
SMESG000007931.12.886e-14851.92SMESG000007931.1[more]
SMESG000007931.12.326e-14050.13SMESG000007931.1[more]
SMESG000037114.16.462e-9841.18SMESG000037114.1[more]
SMESG000037114.17.113e-9841.18SMESG000037114.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028689 ID=SMED30028689|Name=Histone-binding protein RBBP7|organism=Schmidtea mediterranea sexual|type=transcript|length=1525bp
TCATCGTGCATTTATATCTTTATGAATATTTTATATACAATTTTTCTTTT
GTTTAACTTTGACTAATACTTTAAAAATTTTAAATATTTTTAATTTGGAA
ACCATTTTACAACCATGACTGAGAAAGGTTTATAATTTATTGTTCAATGA
GGTCACGTATTTTCATAGACTTTGATGACGGTATTGAAGAACGAGTTATT
AATGAAGAATATAAAATTTGGAAGAAAAATACACCATTTTTATATGATTT
GGTAATGACACATGCTCTTGAATGGCCAAGCTTAACTGCTCAGTGGTTAC
CGGATGTAGTTTGTCCAGAGGGAAAAGATTATGGTTTGCATAGGCTTATA
CTTGGTACTCACACGTCAGATGAACAAAATCATTTATTAATAGCTACTGC
TCATATACCTACAGATTCTAATGAATTTGATATAAATAAATATGAACCTG
ATAAAGGTGAATTTGGTGGTTTCGGATCTGTCAATGGAAAAATCGAAATC
AATATTAAAATTAATCATGATGGGGAAGTAAACCGAGCTCGATATCTCCC
TCAAAACCCCACAATCATAGCCACAAAATCACCCAGCTCCGATGTACTGG
TTTTTGACTACACAAAGCATCCAGCAAAACCGGATCCCAACGGGCTGTGT
CAACCAGATCTGAGATTAAAAGGTCATCAGAAAGAAGGTTACGGTCTCAG
TTGGAATCCTAAGCGAAGCGGGTATTTGTTGAGTGCTTCGGATGACAACA
CGATTTGTATGTGGGATATTAACACTTCTCCTCGTGATCAACGGATTATT
GATGCACTTAGCATCTTCACCGGGCATTCTAGTGTCGTTGAGGATGTCAG
TTGGCATCTACTGCATGAGCACATATTCGGTTCCGTAGCTGATGACAGAC
AACTAATGATTTGGGACACGCGTACTAGTGTTACCAATCGTCCGAGTCAG
TCAGTTGACGCACATGCGGCAGAAGTCAATTGCATCAGTTTTAATCCATT
TTCCGAGTACATTCTGGCAACCGGTAGTGCCGATCGAACTGTAGCACTCT
GGGATCTTCGGAATCTAAATCTTAAGCTGCATTCCTTTGAGTCACACAAA
GACGAAATATTCCAAGTTCAGTGGTCACCGCATCATGAAACAATCCTGGC
TTCTAGTGGCACTGACAGGCGTTTGCACGTTTGGGATTTAAGCAGAATTG
GTGAAGAACAGTCGCCTGAAGATGCGGAAGACGGTCCTCCGGAATTGCTG
TTTATCCACGGAGGCCATACAGCTAAAATATCCGATTTCAGTTGGAGCCC
AAACACGCCGTGGCTTATATGCTCGGTTTCAGAAGACAATATTCTACAGG
TCTGGCAAATGGCGGAGAATATTTACAACGATGAAGATTTAGATAGTGCT
ACTAAGGAAGTTGTTCAAAATAGCTCATAATATGGCTTTTGTTATTTATT
ATATGGAATAAATTTGTGCTTATTGTATGTTCACTTTTATTATGTAAATT
GATGATCTGTCGTTTGTACTAGGAC
back to top

protein sequence of SMED30028689-orf-1

>SMED30028689-orf-1 ID=SMED30028689-orf-1|Name=SMED30028689-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=428bp
MRSRIFIDFDDGIEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQW
LPDVVCPEGKDYGLHRLILGTHTSDEQNHLLIATAHIPTDSNEFDINKYE
PDKGEFGGFGSVNGKIEINIKINHDGEVNRARYLPQNPTIIATKSPSSDV
LVFDYTKHPAKPDPNGLCQPDLRLKGHQKEGYGLSWNPKRSGYLLSASDD
NTICMWDINTSPRDQRIIDALSIFTGHSSVVEDVSWHLLHEHIFGSVADD
RQLMIWDTRTSVTNRPSQSVDAHAAEVNCISFNPFSEYILATGSADRTVA
LWDLRNLNLKLHSFESHKDEIFQVQWSPHHETILASSGTDRRLHVWDLSR
IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWSPNTPWLICSVSEDNIL
QVWQMAENIYNDEDLDSATKEVVQNSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR022052Histone-bd_RBBP4_N
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0000980RNA polymerase II distal enhancer sequence-specific DNA binding
GO:0008094DNA-dependent ATPase activity
GO:0031492nucleosomal DNA binding
GO:0042826histone deacetylase binding
Vocabulary: biological process
TermDefinition
GO:0000183chromatin silencing at rDNA
GO:0006260DNA replication
GO:0006335DNA replication-dependent nucleosome assembly
GO:0006336DNA replication-independent nucleosome assembly
GO:0006338chromatin remodeling
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0007049cell cycle
GO:0016569covalent chromatin modification
GO:0031497chromatin assembly
GO:0043044ATP-dependent chromatin remodeling
GO:0060416response to growth hormone
Vocabulary: cellular component
TermDefinition
GO:0000790nuclear chromatin
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005829cytosol
GO:0016581NuRD complex
GO:0016589NURF complex
GO:0033186CAF-1 complex
GO:0035098ESC/E(Z) complex
GO:0043234protein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 290..304
score: 46.78
coord: 194..208
score: 40.44
coord: 334..348
score: 36.17
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 167..207
e-value: 6.7E-6
score: 35.6
coord: 307..347
e-value: 3.6E-7
score: 39.8
coord: 217..257
e-value: 0.081
score: 22.0
coord: 263..303
e-value: 1.2E-8
score: 44.7
coord: 364..404
e-value: 3.3E-5
score: 33.3
coord: 113..154
e-value: 5.1
score: 12.5
IPR001680WD40 repeatPFAMPF00400WD40coord: 221..257
e-value: 0.011
score: 16.6
coord: 311..347
e-value: 2.6E-4
score: 21.7
coord: 266..303
e-value: 5.2E-6
score: 27.1
coord: 368..403
e-value: 1.1E-4
score: 22.9
coord: 182..207
e-value: 0.26
score: 12.2
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 270..306
score: 13.683
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 224..266
score: 9.339
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 314..349
score: 12.848
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 371..405
score: 9.606
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 174..216
score: 12.848
IPR022052Histone-binding protein RBBP4, N-terminalPFAMPF12265CAF1C_H4-bdcoord: 20..88
e-value: 3.0E-25
score: 88.3
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 7..425
e-value: 8.0E-163
score: 544.3
NoneNo IPR availablePANTHERPTHR22850:SF90HISTONE-BINDING PROTEIN RBBP4coord: 6..420
NoneNo IPR availablePANTHERPTHR22850WD40 REPEAT FAMILYcoord: 6..420
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 334..348
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 290..304
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 194..208
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 174..413
score: 36.701
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 115..410