Zinc finger and BTB domain containing 41

Overview
NameZinc finger and BTB domain containing 41
Smed IDSMED30028681
Length (bp)3271
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger and BTB domain containing 41 (SMED30028681) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger and BTB domain containing 41 (SMED30028681) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger and BTB domain containing 41 (SMED30028681) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger and BTB domain containing 41 (SMED30028681) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028681

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30028681SMESG000022366.1 dd_Smed_v4_10911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30028681SMESG000022366.1 dd_Smed_v4_10911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30028681SMESG000022366.1 dd_Smed_v4_10911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028681SMESG000022366.1 dd_Smed_v4_10911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028681SMESG000022366.1 dd_Smed_v4_10911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Human
Match: ZNF596 (zinc finger protein 596 [Source:HGNC Symbol;Acc:HGNC:27268])

HSP 1 Score: 85.1149 bits (209), Expect = 2.107e-16
Identity = 40/80 (50.00%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K FT ++VLK H+RIHTGEKPY C +CGKAF +S  L RH  TH      +  Y C  C   F H S+L  HE+T
Sbjct:  365 CHLCGKAFTESSVLKRHERIHTGEKPYECHVCGKAFTESSDLRRHERTH----TGEKPYECHLCGKAFNHSSVLRRHERT 440          

HSP 2 Score: 74.7146 bits (182), Expect = 4.644e-13
Identity = 37/80 (46.25%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K FT  + L+ H+R HTGEKPY C +CGKAF++S +L RH   H    A     IC  C   F H S L  HE+T
Sbjct:  225 CHLCGKAFTHCSDLRKHERTHTGEKPYGCHLCGKAFSKSSNLRRHEMIHTREKAQ----ICHLCGKAFTHCSDLRKHERT 300          

HSP 3 Score: 70.0922 bits (170), Expect = 1.453e-11
Identity = 35/81 (43.21%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            +C  C K F  ++VL+ H+R HTGEKPY C ICGKAFN+S +   HR  H      +  Y+C  C   F     L  HE+T
Sbjct:  420 ECHLCGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVH----TGEKPYVCPLCGKAFSKFFNLRQHERT 496          

HSP 4 Score: 67.0106 bits (162), Expect = 1.281e-10
Identity = 32/69 (46.38%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            +C  C K FT ++ L+ H+R HTGEKPY C +CGKAFN S  L RH  TH      +  Y C  C   F
Sbjct:  392 ECHVCGKAFTESSDLRRHERTHTGEKPYECHLCGKAFNHSSVLRRHERTH----TGEKPYECNICGKAF 456          

HSP 5 Score: 65.855 bits (159), Expect = 2.652e-10
Identity = 32/80 (40.00%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K FT  + L+ H+R H G+KPY C +CGKAF++   L +H  TH      +  Y C  C   F H S L  HE++
Sbjct:  281 CHLCGKAFTHCSDLRKHERTHLGDKPYGCLLCGKAFSKCSYLRQHERTHN----GEKPYECHLCGKAFSHCSHLRQHERS 356          

HSP 6 Score: 64.3142 bits (155), Expect = 7.689e-10
Identity = 35/85 (41.18%), Postives = 46/85 (54.12%), Query Frame = 1
Query:  748 TKKI-LKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHE 999
            T++I L+C  C KTF+  + L+ H+ IHTGEKP+ C +CGKAF     L +H  TH      +  Y C  C   F   S L  HE
Sbjct:  190 TREITLECRVCGKTFSKNSNLRRHEMIHTGEKPHGCHLCGKAFTHCSDLRKHERTH----TGEKPYGCHLCGKAFSKSSNLRRHE 270          

HSP 7 Score: 64.3142 bits (155), Expect = 8.240e-10
Identity = 32/81 (39.51%), Postives = 42/81 (51.85%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            +C  C K F+  + L+ H+R H GEKP+ C +CGKAF +S  L RH   H      +  Y C  C   F   S L  HE+T
Sbjct:  336 ECHLCGKAFSHCSHLRQHERSHNGEKPHGCHLCGKAFTESSVLKRHERIH----TGEKPYECHVCGKAFTESSDLRRHERT 412          

HSP 8 Score: 62.003 bits (149), Expect = 4.114e-9
Identity = 31/80 (38.75%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K F+ ++ L+ H+ IHT EK  +C +CGKAF     L +H  TH      D  Y C  C   F   S L  HE+T
Sbjct:  253 CHLCGKAFSKSSNLRRHEMIHTREKAQICHLCGKAFTHCSDLRKHERTH----LGDKPYGCLLCGKAFSKCSYLRQHERT 328          

HSP 9 Score: 59.3066 bits (142), Expect = 3.268e-8
Identity = 24/50 (48.00%), Postives = 36/50 (72.00%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            +C+ C K F  +   ++H+R+HTGEKPYVC +CGKAF++  +L +H  TH
Sbjct:  448 ECNICGKAFNRSYNFRLHRRVHTGEKPYVCPLCGKAFSKFFNLRQHERTH 497          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Human
Match: ZNF596 (zinc finger protein 596 [Source:HGNC Symbol;Acc:HGNC:27268])

HSP 1 Score: 85.1149 bits (209), Expect = 2.107e-16
Identity = 40/80 (50.00%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K FT ++VLK H+RIHTGEKPY C +CGKAF +S  L RH  TH      +  Y C  C   F H S+L  HE+T
Sbjct:  365 CHLCGKAFTESSVLKRHERIHTGEKPYECHVCGKAFTESSDLRRHERTH----TGEKPYECHLCGKAFNHSSVLRRHERT 440          

HSP 2 Score: 74.7146 bits (182), Expect = 4.644e-13
Identity = 37/80 (46.25%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K FT  + L+ H+R HTGEKPY C +CGKAF++S +L RH   H    A     IC  C   F H S L  HE+T
Sbjct:  225 CHLCGKAFTHCSDLRKHERTHTGEKPYGCHLCGKAFSKSSNLRRHEMIHTREKAQ----ICHLCGKAFTHCSDLRKHERT 300          

HSP 3 Score: 70.0922 bits (170), Expect = 1.453e-11
Identity = 35/81 (43.21%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            +C  C K F  ++VL+ H+R HTGEKPY C ICGKAFN+S +   HR  H      +  Y+C  C   F     L  HE+T
Sbjct:  420 ECHLCGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVH----TGEKPYVCPLCGKAFSKFFNLRQHERT 496          

HSP 4 Score: 67.0106 bits (162), Expect = 1.281e-10
Identity = 32/69 (46.38%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            +C  C K FT ++ L+ H+R HTGEKPY C +CGKAFN S  L RH  TH      +  Y C  C   F
Sbjct:  392 ECHVCGKAFTESSDLRRHERTHTGEKPYECHLCGKAFNHSSVLRRHERTH----TGEKPYECNICGKAF 456          

HSP 5 Score: 65.855 bits (159), Expect = 2.652e-10
Identity = 32/80 (40.00%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K FT  + L+ H+R H G+KPY C +CGKAF++   L +H  TH      +  Y C  C   F H S L  HE++
Sbjct:  281 CHLCGKAFTHCSDLRKHERTHLGDKPYGCLLCGKAFSKCSYLRQHERTHN----GEKPYECHLCGKAFSHCSHLRQHERS 356          

HSP 6 Score: 64.3142 bits (155), Expect = 7.689e-10
Identity = 35/85 (41.18%), Postives = 46/85 (54.12%), Query Frame = 1
Query:  748 TKKI-LKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHE 999
            T++I L+C  C KTF+  + L+ H+ IHTGEKP+ C +CGKAF     L +H  TH      +  Y C  C   F   S L  HE
Sbjct:  190 TREITLECRVCGKTFSKNSNLRRHEMIHTGEKPHGCHLCGKAFTHCSDLRKHERTH----TGEKPYGCHLCGKAFSKSSNLRRHE 270          

HSP 7 Score: 64.3142 bits (155), Expect = 8.240e-10
Identity = 32/81 (39.51%), Postives = 42/81 (51.85%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            +C  C K F+  + L+ H+R H GEKP+ C +CGKAF +S  L RH   H      +  Y C  C   F   S L  HE+T
Sbjct:  336 ECHLCGKAFSHCSHLRQHERSHNGEKPHGCHLCGKAFTESSVLKRHERIH----TGEKPYECHVCGKAFTESSDLRRHERT 412          

HSP 8 Score: 62.003 bits (149), Expect = 4.114e-9
Identity = 31/80 (38.75%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K F+ ++ L+ H+ IHT EK  +C +CGKAF     L +H  TH      D  Y C  C   F   S L  HE+T
Sbjct:  253 CHLCGKAFSKSSNLRRHEMIHTREKAQICHLCGKAFTHCSDLRKHERTH----LGDKPYGCLLCGKAFSKCSYLRQHERT 328          

HSP 9 Score: 59.3066 bits (142), Expect = 3.268e-8
Identity = 24/50 (48.00%), Postives = 36/50 (72.00%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            +C+ C K F  +   ++H+R+HTGEKPYVC +CGKAF++  +L +H  TH
Sbjct:  448 ECNICGKAFNRSYNFRLHRRVHTGEKPYVCPLCGKAFSKFFNLRQHERTH 497          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Human
Match: ZNF596 (zinc finger protein 596 [Source:HGNC Symbol;Acc:HGNC:27268])

HSP 1 Score: 85.1149 bits (209), Expect = 2.107e-16
Identity = 40/80 (50.00%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K FT ++VLK H+RIHTGEKPY C +CGKAF +S  L RH  TH      +  Y C  C   F H S+L  HE+T
Sbjct:  365 CHLCGKAFTESSVLKRHERIHTGEKPYECHVCGKAFTESSDLRRHERTH----TGEKPYECHLCGKAFNHSSVLRRHERT 440          

HSP 2 Score: 74.7146 bits (182), Expect = 4.644e-13
Identity = 37/80 (46.25%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K FT  + L+ H+R HTGEKPY C +CGKAF++S +L RH   H    A     IC  C   F H S L  HE+T
Sbjct:  225 CHLCGKAFTHCSDLRKHERTHTGEKPYGCHLCGKAFSKSSNLRRHEMIHTREKAQ----ICHLCGKAFTHCSDLRKHERT 300          

HSP 3 Score: 70.0922 bits (170), Expect = 1.453e-11
Identity = 35/81 (43.21%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            +C  C K F  ++VL+ H+R HTGEKPY C ICGKAFN+S +   HR  H      +  Y+C  C   F     L  HE+T
Sbjct:  420 ECHLCGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVH----TGEKPYVCPLCGKAFSKFFNLRQHERT 496          

HSP 4 Score: 67.0106 bits (162), Expect = 1.281e-10
Identity = 32/69 (46.38%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            +C  C K FT ++ L+ H+R HTGEKPY C +CGKAFN S  L RH  TH      +  Y C  C   F
Sbjct:  392 ECHVCGKAFTESSDLRRHERTHTGEKPYECHLCGKAFNHSSVLRRHERTH----TGEKPYECNICGKAF 456          

HSP 5 Score: 65.855 bits (159), Expect = 2.652e-10
Identity = 32/80 (40.00%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K FT  + L+ H+R H G+KPY C +CGKAF++   L +H  TH      +  Y C  C   F H S L  HE++
Sbjct:  281 CHLCGKAFTHCSDLRKHERTHLGDKPYGCLLCGKAFSKCSYLRQHERTHN----GEKPYECHLCGKAFSHCSHLRQHERS 356          

HSP 6 Score: 64.3142 bits (155), Expect = 7.689e-10
Identity = 35/85 (41.18%), Postives = 46/85 (54.12%), Query Frame = 1
Query:  748 TKKI-LKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHE 999
            T++I L+C  C KTF+  + L+ H+ IHTGEKP+ C +CGKAF     L +H  TH      +  Y C  C   F   S L  HE
Sbjct:  190 TREITLECRVCGKTFSKNSNLRRHEMIHTGEKPHGCHLCGKAFTHCSDLRKHERTH----TGEKPYGCHLCGKAFSKSSNLRRHE 270          

HSP 7 Score: 64.3142 bits (155), Expect = 8.240e-10
Identity = 32/81 (39.51%), Postives = 42/81 (51.85%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            +C  C K F+  + L+ H+R H GEKP+ C +CGKAF +S  L RH   H      +  Y C  C   F   S L  HE+T
Sbjct:  336 ECHLCGKAFSHCSHLRQHERSHNGEKPHGCHLCGKAFTESSVLKRHERIH----TGEKPYECHVCGKAFTESSDLRRHERT 412          

HSP 8 Score: 62.003 bits (149), Expect = 4.114e-9
Identity = 31/80 (38.75%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K F+ ++ L+ H+ IHT EK  +C +CGKAF     L +H  TH      D  Y C  C   F   S L  HE+T
Sbjct:  253 CHLCGKAFSKSSNLRRHEMIHTREKAQICHLCGKAFTHCSDLRKHERTH----LGDKPYGCLLCGKAFSKCSYLRQHERT 328          

HSP 9 Score: 59.3066 bits (142), Expect = 3.268e-8
Identity = 24/50 (48.00%), Postives = 36/50 (72.00%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            +C+ C K F  +   ++H+R+HTGEKPYVC +CGKAF++  +L +H  TH
Sbjct:  448 ECNICGKAFNRSYNFRLHRRVHTGEKPYVCPLCGKAFSKFFNLRQHERTH 497          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Human
Match: ZNF420 (zinc finger protein 420 [Source:HGNC Symbol;Acc:HGNC:20649])

HSP 1 Score: 73.9442 bits (180), Expect = 1.971e-15
Identity = 36/79 (45.57%), Postives = 44/79 (55.70%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            C  C K F+  + L  HQRIHTGEKPY C+ CGKAFN+   L RH+  H      +  Y C+ C   F  GS L  HE+
Sbjct:    2 CKECGKMFSHGSQLTQHQRIHTGEKPYQCKECGKAFNRGSLLTRHQRIH----TGEKPYECKECGKTFSRGSELTQHER 76          

HSP 2 Score: 59.3066 bits (142), Expect = 3.265e-10
Identity = 25/54 (46.30%), Postives = 33/54 (61.11%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            +K  +C  C K F   ++L  HQRIHTGEKPY C+ CGK F++   L +H   H
Sbjct:   25 EKPYQCKECGKAFNRGSLLTRHQRIHTGEKPYECKECGKTFSRGSELTQHERIH 78          

HSP 3 Score: 50.0618 bits (118), Expect = 5.542e-7
Identity = 22/51 (43.14%), Postives = 30/51 (58.82%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            G +  +C +C K F   S L  H R H+GE+PY C+ C KTFS+   L +H
Sbjct:   24 GEKPYQCKECGKAFNRGSLLTRHQRIHTGEKPYECKECGKTFSRGSELTQH 74          

HSP 4 Score: 48.521 bits (114), Expect = 1.842e-6
Identity = 20/46 (43.48%), Postives = 27/46 (58.70%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHH 2316
            C +C K F+  S L  H R H+GE+PY C+ C K F++   L RH 
Sbjct:    2 CKECGKMFSHGSQLTQHQRIHTGEKPYQCKECGKAFNRGSLLTRHQ 47          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Human
Match: ZNF768 (zinc finger protein 768 [Source:HGNC Symbol;Acc:HGNC:26273])

HSP 1 Score: 81.2629 bits (199), Expect = 4.023e-15
Identity = 54/196 (27.55%), Postives = 80/196 (40.82%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPG--YNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSIL----GGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIG 1335
            C  C K+F   + L  HQRIHTGEKPY CE+C KAF+QS  L +H+ TH      +  Y C  C   F   S L  H++T    +    P       +++  L  +  + H   +     G  Y+ N+ ++S     TG              +  +++      + E  F CP C         L +H   H  G
Sbjct:  232 CGICGKSFGRGSTLIQHQRIHTGEKPYKCEVCSKAFSQSSDLIKHQRTH----TGERPYKCPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCTECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAIHARTHLPG 423          

HSP 2 Score: 74.7146 bits (182), Expect = 5.055e-13
Identity = 38/90 (42.22%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNR 1020
            +K  KC+ C K F+ ++ L  HQR HTGE+PY C  CGKAF  S  L RH+ TH    +    Y C  C   F   S L  H++T  H R
Sbjct:  255 EKPYKCEVCSKAFSQSSDLIKHQRTHTGERPYKCPRCGKAFADSSYLLRHQRTH----SGQKPYKCPHCGKAFGDSSYLLRHQRTHSHER 340          

HSP 3 Score: 67.3958 bits (163), Expect = 9.907e-11
Identity = 34/90 (37.78%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRR 1023
            +   C  C KTF  ++ L  HQR HTGE+PY C +CGK F +S +L +H   H    + +  Y C  C   F   S L  H++T    RR
Sbjct:  424 RTYSCPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHHRVH----SGERPYKCDDCGKAFSQSSDLIRHQRTHAAGRR 509          

HSP 4 Score: 65.4698 bits (158), Expect = 3.476e-10
Identity = 30/87 (34.48%), Postives = 49/87 (56.32%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            S ++   C  C K ++  + L+ HQR+HTG++P+ C ICGK+F+Q  +L  H  +H    A +  + C  C  +F   S+L  H +T
Sbjct:  337 SHERPYSCTECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSH----AREKPFKCPECGKRFGQSSVLAIHART 419          

HSP 5 Score: 58.9214 bits (141), Expect = 3.441e-8
Identity = 30/87 (34.48%), Postives = 43/87 (49.43%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            S +K  KC +C K F  ++ L  HQR H+ E+PY C  CGK ++Q+ SL  H+  H         + C  C   F   S L  H ++
Sbjct:  309 SGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCTECGKCYSQNSSLRSHQRVH----TGQRPFSCGICGKSFSQRSALIPHARS 391          

HSP 6 Score: 57.7658 bits (138), Expect = 1.011e-7
Identity = 29/87 (33.33%), Postives = 42/87 (48.28%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            + +K  KC  C K F  ++VL +H R H   + Y C  CGK FN+S +L +H+ +H      +  Y C  C   F   S L  H + 
Sbjct:  393 AREKPFKCPECGKRFGQSSVLAIHARTHLPGRTYSCPDCGKTFNRSSTLIQHQRSH----TGERPYRCAVCGKGFCRSSTLLQHHRV 475          

HSP 7 Score: 53.5286 bits (127), Expect = 1.674e-6
Identity = 24/46 (52.17%), Postives = 28/46 (60.87%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHH 2316
            CPDC K F   S L  H R H+GERPY C  C K F ++ TL +HH
Sbjct:  428 CPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHH 473          

HSP 8 Score: 51.6026 bits (122), Expect = 7.101e-6
Identity = 26/54 (48.15%), Postives = 30/54 (55.56%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            G    +C  C K F   S L  H+R HSGERPY C+ C K FSQ+  L RH  T
Sbjct:  450 GERPYRCAVCGKGFCRSSTLLQHHRVHSGERPYKCDDCGKAFSQSSDLIRHQRT 503          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Celegans
Match: mnm-2 (Zinc finger protein mnm-2 [Source:UniProtKB/Swiss-Prot;Acc:Q17895])

HSP 1 Score: 90.5077 bits (223), Expect = 7.574e-20
Identity = 60/169 (35.50%), Postives = 85/169 (50.30%), Query Frame = 1
Query:  502 MLFDSNSNEKCFLPITYDHNTDQNLPNQDIEDNSLKPMETNSTSPPSLPEL-NIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            MLF      +CF P+    +   +L  Q  + N L+ +  ++   P +P L N+A +    N    S +  S        ++   K  +CD CDKTF+ +N L  H+RIHTGEKP+ CE CG+AF Q G+L RHR TH     T   Y+C  C+  F   S L  H +T
Sbjct:   96 MLF----RPECFFPLELSKHL--HLVQQTFQMNVLQNL-GHTLPLPFVPMLKNVAPAQKRLNNKRASYVDHS--------QKGNLKKYRCDVCDKTFSRSNTLITHKRIHTGEKPFKCEHCGRAFRQPGNLTRHRLTH----TTVKPYVCGLCDKAFNRASNLHTHMRT 245          

HSP 2 Score: 58.9214 bits (141), Expect = 3.921e-9
Identity = 26/58 (44.83%), Postives = 36/58 (62.07%), Query Frame = 1
Query: 2149 SRKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            S+KG  ++ +C  CDK F+  + L  H R H+GE+P+ CE C + F Q G L RH LT
Sbjct:  160 SQKGNLKKYRCDVCDKTFSRSNTLITHKRIHTGEKPFKCEHCGRAFRQPGNLTRHRLT 217          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058845:1063187:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 77.411 bits (189), Expect = 3.785e-14
Identity = 39/91 (42.86%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            + E++ +K + C YC+K F  A  L+VH R HTGE+PYVC+ C KAF   G+L  H  TH      +  Y C+FC   F   S L  HE T
Sbjct:  238 VHEQNERKHV-CVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTH----TGERPYSCQFCQRTFIQKSQLTAHEST 323          

HSP 2 Score: 70.4774 bits (171), Expect = 4.825e-12
Identity = 51/189 (26.98%), Postives = 75/189 (39.68%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNY--PGYNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQH 1326
            C  C K F+  ++L+ H+R HTGEKPY C  C K F Q  +L  H  TH      +  Y CR+C   F        HEK+AH   R+ +        ++ ++L        +  F+ ++    + L N +K           + VK            +   NE    C YC  G      L VH+  H
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTH----TGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPKTFALKNYLK-----------LHVKQ-----------VHEQNERKHVCVYCNKGFAYAGSLQVHVRTH 268          

HSP 3 Score: 68.9366 bits (167), Expect = 1.629e-11
Identity = 46/168 (27.38%), Postives = 76/168 (45.24%), Query Frame = 1
Query:  703 IAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYR------DATDS----------------NYICRFCNTKFPHGSLLENH-----EKTAHHNRRSGRPRNLSTTDN-NANSLDAKSNNLHNDNFKFNY 1122
             A +G+    +   + ++   C +C K F     L+ H+R HTGE+PY C+ C + F Q   L  H +TH  +      D+T +                NY C FCN K+P+ S L  H     EK+A+     G+P +   + N + +  +A  N L   + +F++
Sbjct:  255 FAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAGSVTDHQMVGNYECTFCNKKYPYASSLYIHMRKHTEKSAYSCDGCGKPYSQKISLNIHQDQCEAFKNRLKTTDSQFSH 422          

HSP 4 Score: 56.225 bits (134), Expect = 1.103e-7
Identity = 35/116 (30.17%), Postives = 45/116 (38.79%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSG-----------------------------SLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            +K   C +C KTF     L+VH+R HTGE+PY C  C K F Q G                             +L  H+ TH      D  + C FC   F   + L+ H K  H
Sbjct:  129 EKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTH-----GDKTFRCDFCPKTFALKNYLKLHVKQVH 239          

HSP 5 Score: 55.4546 bits (132), Expect = 1.955e-7
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 1
Query: 2167 ERRK-CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            ER+  C  C+K F    +L++H R H+GERPY C+FC K F+  G L+ H  T
Sbjct:  243 ERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERT 295          

HSP 6 Score: 54.6842 bits (130), Expect = 3.155e-7
Identity = 23/51 (45.10%), Postives = 31/51 (60.78%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            G +   C  C K F  ++ L++H R H+GERPY C +C KTF+Q GT   H
Sbjct:  128 GEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVH 178          

HSP 7 Score: 54.299 bits (129), Expect = 4.516e-7
Identity = 25/52 (48.08%), Postives = 31/52 (59.62%), Query Frame = 1
Query: 2167 ERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            +R  C  C K F+  S L  H R H+GE+PY C FC KTF+Q  TL+ H  T
Sbjct:  102 KRHICTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERT 153          

HSP 8 Score: 51.9878 bits (123), Expect = 2.690e-6
Identity = 26/60 (43.33%), Postives = 33/60 (55.00%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH---HLTCKN 2331
            G     C  C K F  +  L+ H R H+GERPY+C+FC +TF Q   L  H   HLT K+
Sbjct:  270 GERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKH 329          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058695:1067525:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 77.411 bits (189), Expect = 3.785e-14
Identity = 39/91 (42.86%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            + E++ +K + C YC+K F  A  L+VH R HTGE+PYVC+ C KAF   G+L  H  TH      +  Y C+FC   F   S L  HE T
Sbjct:  238 VHEQNERKHV-CVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTH----TGERPYSCQFCQRTFIQKSQLTAHEST 323          

HSP 2 Score: 70.4774 bits (171), Expect = 4.825e-12
Identity = 51/189 (26.98%), Postives = 75/189 (39.68%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNY--PGYNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQH 1326
            C  C K F+  ++L+ H+R HTGEKPY C  C K F Q  +L  H  TH      +  Y CR+C   F        HEK+AH   R+ +        ++ ++L        +  F+ ++    + L N +K           + VK            +   NE    C YC  G      L VH+  H
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTH----TGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPKTFALKNYLK-----------LHVKQ-----------VHEQNERKHVCVYCNKGFAYAGSLQVHVRTH 268          

HSP 3 Score: 68.9366 bits (167), Expect = 1.629e-11
Identity = 46/168 (27.38%), Postives = 76/168 (45.24%), Query Frame = 1
Query:  703 IAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYR------DATDS----------------NYICRFCNTKFPHGSLLENH-----EKTAHHNRRSGRPRNLSTTDN-NANSLDAKSNNLHNDNFKFNY 1122
             A +G+    +   + ++   C +C K F     L+ H+R HTGE+PY C+ C + F Q   L  H +TH  +      D+T +                NY C FCN K+P+ S L  H     EK+A+     G+P +   + N + +  +A  N L   + +F++
Sbjct:  255 FAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAGSVTDHQMVGNYECTFCNKKYPYASSLYIHMRKHTEKSAYSCDGCGKPYSQKISLNIHQDQCEAFKNRLKTTDSQFSH 422          

HSP 4 Score: 56.225 bits (134), Expect = 1.103e-7
Identity = 35/116 (30.17%), Postives = 45/116 (38.79%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSG-----------------------------SLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            +K   C +C KTF     L+VH+R HTGE+PY C  C K F Q G                             +L  H+ TH      D  + C FC   F   + L+ H K  H
Sbjct:  129 EKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTH-----GDKTFRCDFCPKTFALKNYLKLHVKQVH 239          

HSP 5 Score: 55.4546 bits (132), Expect = 1.955e-7
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 1
Query: 2167 ERRK-CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            ER+  C  C+K F    +L++H R H+GERPY C+FC K F+  G L+ H  T
Sbjct:  243 ERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERT 295          

HSP 6 Score: 54.6842 bits (130), Expect = 3.155e-7
Identity = 23/51 (45.10%), Postives = 31/51 (60.78%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            G +   C  C K F  ++ L++H R H+GERPY C +C KTF+Q GT   H
Sbjct:  128 GEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVH 178          

HSP 7 Score: 54.299 bits (129), Expect = 4.516e-7
Identity = 25/52 (48.08%), Postives = 31/52 (59.62%), Query Frame = 1
Query: 2167 ERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            +R  C  C K F+  S L  H R H+GE+PY C FC KTF+Q  TL+ H  T
Sbjct:  102 KRHICTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERT 153          

HSP 8 Score: 51.9878 bits (123), Expect = 2.690e-6
Identity = 26/60 (43.33%), Postives = 33/60 (55.00%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH---HLTCKN 2331
            G     C  C K F  +  L+ H R H+GERPY+C+FC +TF Q   L  H   HLT K+
Sbjct:  270 GERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKH 329          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 72.0182 bits (175), Expect = 7.950e-14
Identity = 37/88 (42.05%), Postives = 47/88 (53.41%), Query Frame = 1
Query:  742 ESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
             ST K  +C  C K F+ A  L  H+RIHTGEKP++C +C + F+QS SL  HR TH      +  Y C  C   F   S L  H +T
Sbjct:  101 RSTPKPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTH----TGERPYPCAQCEKAFTDSSTLTKHLRT 184          

HSP 2 Score: 64.3142 bits (155), Expect = 3.619e-11
Identity = 32/85 (37.65%), Postives = 43/85 (50.59%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            +K   C  C++ F+ ++ L  H+R HTGE+PY C  C KAF  S +L +H  TH         Y+C  C  KF     L  H KT
Sbjct:  132 EKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTH----TGHKPYVCSICMMKFTQSGNLHRHMKT 212          

HSP 3 Score: 62.3882 bits (150), Expect = 1.460e-10
Identity = 27/50 (54.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHR 915
            C  C+K FT ++ L  H R HTG KPYVC IC   F QSG+L+RH  TH+
Sbjct:  165 CAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTHK 214          

HSP 4 Score: 51.6026 bits (122), Expect = 7.369e-7
Identity = 27/69 (39.13%), Postives = 39/69 (56.52%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT-CKNRPTVLSSTKLK 2364
            G +   CP C++ F+  S+L  H R H+GERPY C  C K F+ + TL +H  T   ++P V S   +K
Sbjct:  131 GEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMK 199          

HSP 5 Score: 50.8322 bits (120), Expect = 1.287e-6
Identity = 22/51 (43.14%), Postives = 27/51 (52.94%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            G     C  C+K FT  S L  H R H+G +PY C  C   F+Q+G L RH
Sbjct:  159 GERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRH 209          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 72.4034 bits (176), Expect = 1.468e-13
Identity = 37/88 (42.05%), Postives = 47/88 (53.41%), Query Frame = 1
Query:  742 ESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
             ST K  +C  C K F+ A  L  H+RIHTGEKP++C +C + F+QS SL  HR TH      +  Y C  C   F   S L  H +T
Sbjct:  160 RSTPKPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTH----TGERPYPCAQCEKAFTDSSTLTKHLRT 243          

HSP 2 Score: 65.0846 bits (157), Expect = 5.391e-11
Identity = 32/85 (37.65%), Postives = 43/85 (50.59%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            +K   C  C++ F+ ++ L  H+R HTGE+PY C  C KAF  S +L +H  TH         Y+C  C  KF     L  H KT
Sbjct:  191 EKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTH----TGHKPYVCSICMMKFTQSGNLHRHMKT 271          

HSP 3 Score: 63.1586 bits (152), Expect = 1.920e-10
Identity = 27/50 (54.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHR 915
            C  C+K FT ++ L  H R HTG KPYVC IC   F QSG+L+RH  TH+
Sbjct:  224 CAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTHK 273          

HSP 4 Score: 52.7582 bits (125), Expect = 5.281e-7
Identity = 26/63 (41.27%), Postives = 37/63 (58.73%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT-CKNRPTVLSSTKLK 2364
            CP C++ F+  S+L  H R H+GERPY C  C K F+ + TL +H  T   ++P V S   +K
Sbjct:  196 CPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMK 258          

HSP 5 Score: 52.373 bits (124), Expect = 8.152e-7
Identity = 23/50 (46.00%), Postives = 28/50 (56.00%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCK 2328
            C  C+K FT  S L  H R H+G +PY C  C   F+Q+G L RH  T K
Sbjct:  224 CAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTHK 273          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Fly
Match: CG9650 (gene:FBgn0029939 transcript:FBtr0339815)

HSP 1 Score: 78.1814 bits (191), Expect = 3.704e-14
Identity = 40/90 (44.44%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +++ES ++   C++C K F   + L VH+R HTGEKPY CE+C  A  QS  L RH  TH  R   D  Y CRFC+  F   S LE H +
Sbjct:  946 LKKESRQRNDTCEFCGKVFKNCSNLTVHRRSHTGEKPYKCELCSYACAQSSKLTRHMKTHG-RTGKDV-YRCRFCDMPFSVPSTLEKHMR 1033          

HSP 2 Score: 56.9954 bits (136), Expect = 1.121e-7
Identity = 25/59 (42.37%), Postives = 29/59 (49.15%), Query Frame = 1
Query:  739 EESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHR 915
            +E       C YCDK F   N L +HQR HTGEKPY C  C    +    L +H   HR
Sbjct:  637 QEPIAHCYSCSYCDKKFRFENNLIIHQRTHTGEKPYKCTACDFECSHIQKLMKHMRVHR 695          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Fly
Match: CG9650 (gene:FBgn0029939 transcript:FBtr0301240)

HSP 1 Score: 77.7962 bits (190), Expect = 4.267e-14
Identity = 40/90 (44.44%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +++ES ++   C++C K F   + L VH+R HTGEKPY CE+C  A  QS  L RH  TH  R   D  Y CRFC+  F   S LE H +
Sbjct: 1015 LKKESRQRNDTCEFCGKVFKNCSNLTVHRRSHTGEKPYKCELCSYACAQSSKLTRHMKTHG-RTGKDV-YRCRFCDMPFSVPSTLEKHMR 1102          

HSP 2 Score: 56.9954 bits (136), Expect = 1.227e-7
Identity = 25/59 (42.37%), Postives = 29/59 (49.15%), Query Frame = 1
Query:  739 EESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHR 915
            +E       C YCDK F   N L +HQR HTGEKPY C  C    +    L +H   HR
Sbjct:  706 QEPIAHCYSCSYCDKKFRFENNLIIHQRTHTGEKPYKCTACDFECSHIQKLMKHMRVHR 764          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Fly
Match: CG9650 (gene:FBgn0029939 transcript:FBtr0309030)

HSP 1 Score: 77.7962 bits (190), Expect = 4.411e-14
Identity = 40/90 (44.44%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +++ES ++   C++C K F   + L VH+R HTGEKPY CE+C  A  QS  L RH  TH  R   D  Y CRFC+  F   S LE H +
Sbjct: 1013 LKKESRQRNDTCEFCGKVFKNCSNLTVHRRSHTGEKPYKCELCSYACAQSSKLTRHMKTHG-RTGKDV-YRCRFCDMPFSVPSTLEKHMR 1100          

HSP 2 Score: 56.9954 bits (136), Expect = 1.226e-7
Identity = 25/59 (42.37%), Postives = 29/59 (49.15%), Query Frame = 1
Query:  739 EESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHR 915
            +E       C YCDK F   N L +HQR HTGEKPY C  C    +    L +H   HR
Sbjct:  704 QEPIAHCYSCSYCDKKFRFENNLIIHQRTHTGEKPYKCTACDFECSHIQKLMKHMRVHR 762          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Fly
Match: CG9650 (gene:FBgn0029939 transcript:FBtr0474235)

HSP 1 Score: 77.7962 bits (190), Expect = 4.611e-14
Identity = 40/90 (44.44%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +++ES ++   C++C K F   + L VH+R HTGEKPY CE+C  A  QS  L RH  TH  R   D  Y CRFC+  F   S LE H +
Sbjct: 1019 LKKESRQRNDTCEFCGKVFKNCSNLTVHRRSHTGEKPYKCELCSYACAQSSKLTRHMKTHG-RTGKDV-YRCRFCDMPFSVPSTLEKHMR 1106          

HSP 2 Score: 56.9954 bits (136), Expect = 1.217e-7
Identity = 25/59 (42.37%), Postives = 29/59 (49.15%), Query Frame = 1
Query:  739 EESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHR 915
            +E       C YCDK F   N L +HQR HTGEKPY C  C    +    L +H   HR
Sbjct:  710 QEPIAHCYSCSYCDKKFRFENNLIIHQRTHTGEKPYKCTACDFECSHIQKLMKHMRVHR 768          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Fly
Match: CG9650 (gene:FBgn0029939 transcript:FBtr0474234)

HSP 1 Score: 77.7962 bits (190), Expect = 4.706e-14
Identity = 40/90 (44.44%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +++ES ++   C++C K F   + L VH+R HTGEKPY CE+C  A  QS  L RH  TH  R   D  Y CRFC+  F   S LE H +
Sbjct: 1019 LKKESRQRNDTCEFCGKVFKNCSNLTVHRRSHTGEKPYKCELCSYACAQSSKLTRHMKTHG-RTGKDV-YRCRFCDMPFSVPSTLEKHMR 1106          

HSP 2 Score: 56.9954 bits (136), Expect = 1.185e-7
Identity = 25/59 (42.37%), Postives = 29/59 (49.15%), Query Frame = 1
Query:  739 EESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHR 915
            +E       C YCDK F   N L +HQR HTGEKPY C  C    +    L +H   HR
Sbjct:  710 QEPIAHCYSCSYCDKKFRFENNLIIHQRTHTGEKPYKCTACDFECSHIQKLMKHMRVHR 768          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Zebrafish
Match: si:dkey-182i3.8 (si:dkey-182i3.8 [Source:ZFIN;Acc:ZDB-GENE-030131-4134])

HSP 1 Score: 80.8777 bits (198), Expect = 4.846e-15
Identity = 62/208 (29.81%), Postives = 88/208 (42.31%), Query Frame = 1
Query:  715 GTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPGYN---LNNDIKSDALTPTGNDDVDVKTDSSG-IIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQH 1326
            GT N      S ++ +KC +C+K+F    +LK H R+HTGE+P+ C+ICGK+F  SG+L RH   H      D  Y+C  C  +F   S L+       H R  G  R +                +    F++NY   N    +N I     +     +V  K  SS   +K H  L   N   F C  C    + I  L +H   H
Sbjct:  318 GTLNYHKRIHSNERPIKCSHCNKSFKYHKLLKHHLRVHTGERPHTCDICGKSFALSGTLKRHILIH----TGDKPYVCEVCGRRFNQRSTLKG------HMRVHGEKRFMC--------------EMCGKTFQYNYVLRNHILTHNQINPGEKSNAQRCEVCGKFLSSAYALKAHLQLHSDNSKPFACTSCDRKYSSIHSLRMHEQLH 501          

HSP 2 Score: 70.0922 bits (170), Expect = 1.167e-11
Identity = 32/77 (41.56%), Postives = 46/77 (59.74%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            C+ C + FT+   L +HQR+HTGEKPY C+ CGK F+  G+LN H+  H    + +    C  CN  F +  LL++H
Sbjct:  279 CETCGQGFTIKRSLYMHQRVHTGEKPYRCDTCGKCFSLIGTLNYHKRIH----SNERPIKCSHCNKSFKYHKLLKHH 351          

HSP 3 Score: 65.4698 bits (158), Expect = 2.556e-10
Identity = 29/50 (58.00%), Postives = 35/50 (70.00%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            KC  C K F L++ LK+H R HTGEKP+ CE CGKAF+ S +L RHR  H
Sbjct:  536 KCLLCGKRFKLSSSLKMHMRTHTGEKPHKCETCGKAFHLSANLKRHRLVH 585          

HSP 4 Score: 60.4622 bits (145), Expect = 1.060e-8
Identity = 30/84 (35.71%), Postives = 47/84 (55.95%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            K   C  CD+ ++  + L++H+++HTGEKP+ CEICGK F    SL     TH +  + +  + C  C  +F   S L+ H +T
Sbjct:  477 KPFACTSCDRKYSSIHSLRMHEQLHTGEKPFKCEICGKDF----SLRASYKTHMFLHSGERPHKCLLCGKRFKLSSSLKMHMRT 556          

HSP 5 Score: 55.4546 bits (132), Expect = 3.720e-7
Identity = 28/71 (39.44%), Postives = 39/71 (54.93%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPH 975
            KC+ C K F L+  LK H+ +HTGEKP+ C+IC K+F Q  +L  H + H  +      Y C  C   F +
Sbjct:  564 KCETCGKAFHLSANLKRHRLVHTGEKPFTCDICLKSFTQPNNLKAHMHIHTGKKP----YTCTKCWKSFAY 630          

HSP 6 Score: 55.0694 bits (131), Expect = 4.052e-7
Identity = 24/48 (50.00%), Postives = 32/48 (66.67%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHL 2319
            KC  C+K F     L+ H R H+GERP+ C+ C K+F+ +GTLKRH L
Sbjct:  334 KCSHCNKSFKYHKLLKHHLRVHTGERPHTCDICGKSFALSGTLKRHIL 381          

HSP 7 Score: 54.299 bits (129), Expect = 8.450e-7
Identity = 29/82 (35.37%), Postives = 41/82 (50.00%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            +K  KC+ C K F+L    K H  +H+GE+P+ C +CGK F  S SL  H  TH      +  + C  C   F   + L+ H
Sbjct:  504 EKPFKCEICGKDFSLRASYKTHMFLHSGERPHKCLLCGKRFKLSSSLKMHMRTH----TGEKPHKCETCGKAFHLSANLKRH 581          

HSP 8 Score: 53.9138 bits (128), Expect = 9.605e-7
Identity = 24/54 (44.44%), Postives = 32/54 (59.26%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            G    KC  C K+F   S+L++H R H+GE+P+ CE C K F  +  LKRH L 
Sbjct:  531 GERPHKCLLCGKRFKLSSSLKMHMRTHTGEKPHKCETCGKAFHLSANLKRHRLV 584          

HSP 9 Score: 50.8322 bits (120), Expect = 9.006e-6
Identity = 34/134 (25.37%), Postives = 57/134 (42.54%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHH-----------LTCKNRPTVLSSTKLKVIPNKPSMSKDSESAAPDVNNSTNGSTYTMTNSPP----CSFGTNSLTNPQNPHLNYMINT 2535
            C  CD++++   +LR+H + H+GE+P+ CE C K FS   + K H            L C  R  + SS K+ +  +        E+     + S N   + + ++      C     S T P N   +  I+T
Sbjct:  481 CTSCDRKYSSIHSLRMHEQLHTGEKPFKCEICGKDFSLRASYKTHMFLHSGERPHKCLLCGKRFKLSSSLKMHMRTHTGEKPHKCETCGKAFHLSANLKRHRLVHTGEKPFTCDICLKSFTQPNNLKAHMHIHT 614          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Zebrafish
Match: zgc:173577 (zgc:173577 [Source:ZFIN;Acc:ZDB-GENE-071004-55])

HSP 1 Score: 77.7962 bits (190), Expect = 5.278e-15
Identity = 42/103 (40.78%), Postives = 54/103 (52.43%), Query Frame = 1
Query:  694 ESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            E   +  G+ N      + +K  KC YCDK F  + +LK H+RIHTGEKPY C  C K FNQSG L  H  TH      +  Y+C  C  +F H   L  H++
Sbjct:  167 EKRFSQLGSLNKHKMIHTGEKPYKCSYCDKCFNRSGILKKHERIHTGEKPYKCSHCDKRFNQSGILKAHERTH----TGEKPYMCSHCGKRFGHLFSLTTHKR 265          

HSP 2 Score: 71.633 bits (174), Expect = 6.607e-13
Identity = 35/82 (42.68%), Postives = 48/82 (58.54%), Query Frame = 1
Query:  757 ILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +  C  C+KTF  A  LK+H+R HTGEKPY C  C K F+Q GSLN+H+  H      +  Y C +C+  F    +L+ HE+
Sbjct:  132 VYICLVCEKTFITAVKLKIHERTHTGEKPYKCSHCEKRFSQLGSLNKHKMIH----TGEKPYKCSYCDKCFNRSGILKKHER 209          

HSP 3 Score: 67.3958 bits (163), Expect = 1.614e-11
Identity = 33/81 (40.74%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            KC +C+K F+    L  H+ IHTGEKPY C  C K FN+SG L +H   H      +  Y C  C+ +F    +L+ HE+T
Sbjct:  162 KCSHCEKRFSQLGSLNKHKMIHTGEKPYKCSYCDKCFNRSGILKKHERIH----TGEKPYKCSHCDKRFNQSGILKAHERT 238          

HSP 4 Score: 67.3958 bits (163), Expect = 1.644e-11
Identity = 57/202 (28.22%), Postives = 81/202 (40.10%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDA--KSNNLHNDN--FKFNY--PGYNLNNDIKSDALTPTGND-----DVDVKTDSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQH 1326
            K  +CD C KTF  A+ LK H R+HT  KPY C +CGK F     L  H+  H         YIC  C   F     L+ HE+T        +P   S  +   + L +  K   +H     +K +Y    +N +  +K      TG         D + + SGI+K H     + E  + C +C      +  L  H   H
Sbjct:   75 KTHQCDQCGKTFLRASGLKKHLRVHTEGKPYSCTVCGKTFRHEDGLRDHQKIH----TGVGVYICLVCEKTFITAVKLKIHERT----HTGEKPYKCSHCEKRFSQLGSLNKHKMIHTGEKPYKCSYCDKCFNRSGILKKHERIHTGEKPYKCSHCDKRFNQSGILKAHERT-HTGEKPYMCSHCGKRFGHLFSLTTHKRIH 267          

HSP 5 Score: 49.6766 bits (117), Expect = 9.045e-6
Identity = 22/47 (46.81%), Postives = 29/47 (61.70%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHL 2319
            C  C+K F     L+IH R H+GE+PY C  C K FSQ G+L +H +
Sbjct:  135 CLVCEKTFITAVKLKIHERTHTGEKPYKCSHCEKRFSQLGSLNKHKM 181          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Zebrafish
Match: si:dkey-182i3.8 (si:dkey-182i3.8 [Source:ZFIN;Acc:ZDB-GENE-030131-4134])

HSP 1 Score: 80.1073 bits (196), Expect = 5.454e-15
Identity = 62/208 (29.81%), Postives = 88/208 (42.31%), Query Frame = 1
Query:  715 GTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPGYN---LNNDIKSDALTPTGNDDVDVKTDSSG-IIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQH 1326
            GT N      S ++ +KC +C+K+F    +LK H R+HTGE+P+ C+ICGK+F  SG+L RH   H      D  Y+C  C  +F   S L+       H R  G  R +                +    F++NY   N    +N I     +     +V  K  SS   +K H  L   N   F C  C    + I  L +H   H
Sbjct:  204 GTLNYHKRIHSNERPIKCSHCNKSFKYHKLLKHHLRVHTGERPHTCDICGKSFALSGTLKRHILIH----TGDKPYVCEVCGRRFNQRSTLKG------HMRVHGEKRFMC--------------EMCGKTFQYNYVLRNHILTHNQINPGEKSNAQRCEVCGKFLSSAYALKAHLQLHSDNSKPFACTSCDRKYSSIHSLRMHEQLH 387          

HSP 2 Score: 69.3218 bits (168), Expect = 1.661e-11
Identity = 32/77 (41.56%), Postives = 46/77 (59.74%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            C+ C + FT+   L +HQR+HTGEKPY C+ CGK F+  G+LN H+  H    + +    C  CN  F +  LL++H
Sbjct:  165 CETCGQGFTIKRSLYMHQRVHTGEKPYRCDTCGKCFSLIGTLNYHKRIH----SNERPIKCSHCNKSFKYHKLLKHH 237          

HSP 3 Score: 65.0846 bits (157), Expect = 3.275e-10
Identity = 29/50 (58.00%), Postives = 35/50 (70.00%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            KC  C K F L++ LK+H R HTGEKP+ CE CGKAF+ S +L RHR  H
Sbjct:  422 KCLLCGKRFKLSSSLKMHMRTHTGEKPHKCETCGKAFHLSANLKRHRLVH 471          

HSP 4 Score: 59.3066 bits (142), Expect = 1.852e-8
Identity = 30/84 (35.71%), Postives = 47/84 (55.95%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            K   C  CD+ ++  + L++H+++HTGEKP+ CEICGK F    SL     TH +  + +  + C  C  +F   S L+ H +T
Sbjct:  363 KPFACTSCDRKYSSIHSLRMHEQLHTGEKPFKCEICGKDF----SLRASYKTHMFLHSGERPHKCLLCGKRFKLSSSLKMHMRT 442          

HSP 5 Score: 54.299 bits (129), Expect = 6.465e-7
Identity = 28/71 (39.44%), Postives = 38/71 (53.52%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPH 975
            KC+ C K F L+  LK H+ +HTGEKP+ C+IC K+F Q  +L  H + H         Y C  C   F +
Sbjct:  450 KCETCGKAFHLSANLKRHRLVHTGEKPFTCDICLKSFTQPNNLKAHMHIH----TGKKPYTCTKCWKSFAY 516          

HSP 6 Score: 54.299 bits (129), Expect = 6.866e-7
Identity = 24/48 (50.00%), Postives = 32/48 (66.67%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHL 2319
            KC  C+K F     L+ H R H+GERP+ C+ C K+F+ +GTLKRH L
Sbjct:  220 KCSHCNKSFKYHKLLKHHLRVHTGERPHTCDICGKSFALSGTLKRHIL 267          

HSP 7 Score: 53.1434 bits (126), Expect = 1.413e-6
Identity = 29/82 (35.37%), Postives = 41/82 (50.00%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            +K  KC+ C K F+L    K H  +H+GE+P+ C +CGK F  S SL  H  TH      +  + C  C   F   + L+ H
Sbjct:  390 EKPFKCEICGKDFSLRASYKTHMFLHSGERPHKCLLCGKRFKLSSSLKMHMRTH----TGEKPHKCETCGKAFHLSANLKRH 467          

HSP 8 Score: 53.1434 bits (126), Expect = 1.737e-6
Identity = 24/54 (44.44%), Postives = 32/54 (59.26%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            G    KC  C K+F   S+L++H R H+GE+P+ CE C K F  +  LKRH L 
Sbjct:  417 GERPHKCLLCGKRFKLSSSLKMHMRTHTGEKPHKCETCGKAFHLSANLKRHRLV 470          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Zebrafish
Match: si:ch211-266d19.4 (si:ch211-266d19.4 [Source:ZFIN;Acc:ZDB-GENE-091204-74])

HSP 1 Score: 80.1073 bits (196), Expect = 1.103e-14
Identity = 81/294 (27.55%), Postives = 121/294 (41.16%), Query Frame = 1
Query:  622 NSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEEST--------KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPG--YNLNNDIKSDALTPTGNDDVDVKT------DSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIGGNLVSGSSGINSPTNPMMSKSNPLFSSESLVHQLANLSKK 1455
             S++   L E   AASP+S++ S +S    +G   +P +EE T        +K  +C++C+K F     L++H R+HTGEKPY C  CGK F+Q  +L +H  TH      +  Y C  C+ KF     L  H++ AH       P  LS  +                 F   + G  +  + D++    T T                 S +I    I  G  E  F C  C        DL  H+  H          +GI   + P+ SKS P  SS    H L++++K+
Sbjct:  254 ESSAQIQLEEAERAASPSSEH-SLDSAQKDTGPGYAPPDEEFTADQQSSDEEKPYQCNHCEKRFNKQAKLRIHLRVHTGEKPYQCSQCGKHFSQDVNLKKHYRTHH---TEEKPYQCMICDRKFSVSFSLIKHQRVAH-------PECLSVAERK--------------RFTCPFCGKIFGRHQDMEQHKRTHTDERPFRCNVCNKSFRQRSVLIVHRKIHTG--EKPFECFVCCRRFYGSGDLKTHMGTH----------TGIRPHSCPLCSKSFPRPSSLQ-AHMLSHVNKQ 509          

HSP 2 Score: 60.4622 bits (145), Expect = 1.300e-8
Identity = 34/91 (37.36%), Postives = 46/91 (50.55%), Query Frame = 1
Query:  748 TKKI---LKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            TK+I    +C  C K+F     L VHQR+HTGEKPY C  C K++ Q   L+ H  +H      +  Y C  C   F H S ++ H +  H
Sbjct:  938 TKEIKPKFECPDCGKSFGQTKDLMVHQRVHTGEKPYQCPQCKKSYRQFAHLSVHLRSH----TGEKPYQCPICLKFFAHSSSMKKHLRVMH 1024          

HSP 3 Score: 56.225 bits (134), Expect = 2.733e-7
Identity = 41/123 (33.33%), Postives = 53/123 (43.09%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF--PHGSL---LENHEKTAHHN-----RRSGRPRNLSTTDNNANSLDAKSNN 1092
            K   C YC + F     L  H+RIHTGE+P+ C  C K+F Q  +L  H  +H      +  ++C  CN  F  P G L   LE H     HN     +  GRP  L T         AK  +
Sbjct:  609 KCFACSYCGRKFGRRQGLLQHERIHTGERPFNCPTCNKSFRQRSALVVHIRSH----TGERAFVCFVCNKSFYTP-GDLKKHLEIHTGVRPHNCPICSKGFGRPSFLRTHMRTHEKTSAKKQS 726          

HSP 4 Score: 55.8398 bits (133), Expect = 3.585e-7
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            S +K  +C +C K F+   + K+HQRIHT EK Y C  CG +F    +L  H++TH  ++       C  C+  F   + +++H+ T H
Sbjct:  739 SQEKPFECSHCGKKFSQQCMFKIHQRIHTTEKRYKCTECGLSFRWRRNLISHQSTHPGQNPLQ----CSMCDQTFISEAAVKSHQDTFH 823          

HSP 5 Score: 54.6842 bits (130), Expect = 6.946e-7
Identity = 40/143 (27.97%), Postives = 60/143 (41.96%), Query Frame = 1
Query:  589 IEDNSLKPMETNSTS-PPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSN-YICRFCNTKFPHGSLLENHEKTAH 1011
            I D  +  +ET+S    PS    ++  + +  N+S  + + P                 +C  C K F+    L  H RIHTGE+P+ C  CGK F +   L  H+  H     TD+  + C  C   F   S L+ H +  H
Sbjct:   16 IRDEQMSGLETDSQDVQPSDASFDLGENADELNKSLSATVKP----------------FQCSQCGKGFSRIQHLSEHVRIHTGERPFQCLECGKTFARERDLKTHQLVH-----TDAKAFHCVICVKNFALLSSLKRHLRAFH 137          

HSP 6 Score: 54.6842 bits (130), Expect = 7.308e-7
Identity = 24/49 (48.98%), Postives = 34/49 (69.39%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            +C  C+K+F  ++ LRIH R H+GE+PY C  C K FSQ+  LK+H+ T
Sbjct:  308 QCNHCEKRFNKQAKLRIHLRVHTGEKPYQCSQCGKHFSQDVNLKKHYRT 356          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Zebrafish
Match: si:ch211-266d19.4 (si:ch211-266d19.4 [Source:ZFIN;Acc:ZDB-GENE-091204-74])

HSP 1 Score: 80.1073 bits (196), Expect = 1.158e-14
Identity = 81/294 (27.55%), Postives = 121/294 (41.16%), Query Frame = 1
Query:  622 NSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEEST--------KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPG--YNLNNDIKSDALTPTGNDDVDVKT------DSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIGGNLVSGSSGINSPTNPMMSKSNPLFSSESLVHQLANLSKK 1455
             S++   L E   AASP+S++ S +S    +G   +P +EE T        +K  +C++C+K F     L++H R+HTGEKPY C  CGK F+Q  +L +H  TH      +  Y C  C+ KF     L  H++ AH       P  LS  +                 F   + G  +  + D++    T T                 S +I    I  G  E  F C  C        DL  H+  H          +GI   + P+ SKS P  SS    H L++++K+
Sbjct:  254 ESSAQIQLEEAERAASPSSEH-SLDSAQKDTGPGYAPPDEEFTADQQSSDEEKPYQCNHCEKRFNKQAKLRIHLRVHTGEKPYQCSQCGKHFSQDVNLKKHYRTHH---TEEKPYQCMICDRKFSVSFSLIKHQRVAH-------PECLSVAERK--------------RFTCPFCGKIFGRHQDMEQHKRTHTDERPFRCNVCNKSFRQRSVLIVHRKIHTG--EKPFECFVCCRRFYGSGDLKTHMGTH----------TGIRPHSCPLCSKSFPRPSSLQ-AHMLSHVNKQ 509          

HSP 2 Score: 62.003 bits (149), Expect = 3.707e-9
Identity = 34/91 (37.36%), Postives = 50/91 (54.95%), Query Frame = 1
Query:  760 LKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGR 1032
             +C+ C+K+F   +VL VH++IHTGEKP+ C +C + F  SG L  H  TH         + C  C+  FP  S L+ H   +H N++  R
Sbjct:  427 FRCNVCNKSFRQRSVLIVHRKIHTGEKPFECFVCCRRFYGSGDLKTHMGTH----TGIRPHSCPLCSKSFPRPSSLQAH-MLSHVNKQQDR 512          

HSP 3 Score: 60.4622 bits (145), Expect = 1.185e-8
Identity = 34/91 (37.36%), Postives = 46/91 (50.55%), Query Frame = 1
Query:  748 TKKI---LKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            TK+I    +C  C K+F     L VHQR+HTGEKPY C  C K++ Q   L+ H  +H      +  Y C  C   F H S ++ H +  H
Sbjct:  938 TKEIKPKFECPDCGKSFGQTKDLMVHQRVHTGEKPYQCPQCKKSYRQFAHLSVHLRSH----TGEKPYQCPICLKFFAHSSSMKKHLRVMH 1024          

HSP 4 Score: 56.225 bits (134), Expect = 2.406e-7
Identity = 41/123 (33.33%), Postives = 53/123 (43.09%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF--PHGSL---LENHEKTAHHN-----RRSGRPRNLSTTDNNANSLDAKSNN 1092
            K   C YC + F     L  H+RIHTGE+P+ C  C K+F Q  +L  H  +H      +  ++C  CN  F  P G L   LE H     HN     +  GRP  L T         AK  +
Sbjct:  609 KCFACSYCGRKFGRRQGLLQHERIHTGERPFNCPTCNKSFRQRSALVVHIRSH----TGERAFVCFVCNKSFYTP-GDLKKHLEIHTGVRPHNCPICSKGFGRPSFLRTHMRTHEKTSAKKQS 726          

HSP 5 Score: 55.8398 bits (133), Expect = 3.237e-7
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            S +K  +C +C K F+   + K+HQRIHT EK Y C  CG +F    +L  H++TH  ++       C  C+  F   + +++H+ T H
Sbjct:  739 SQEKPFECSHCGKKFSQQCMFKIHQRIHTTEKRYKCTECGLSFRWRRNLISHQSTHPGQNPLQ----CSMCDQTFISEAAVKSHQDTFH 823          

HSP 6 Score: 54.6842 bits (130), Expect = 6.654e-7
Identity = 40/143 (27.97%), Postives = 60/143 (41.96%), Query Frame = 1
Query:  589 IEDNSLKPMETNSTS-PPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSN-YICRFCNTKFPHGSLLENHEKTAH 1011
            I D  +  +ET+S    PS    ++  + +  N+S  + + P                 +C  C K F+    L  H RIHTGE+P+ C  CGK F +   L  H+  H     TD+  + C  C   F   S L+ H +  H
Sbjct:   16 IRDEQMSGLETDSQDVQPSDASFDLGENADELNKSLSATVKP----------------FQCSQCGKGFSRIQHLSEHVRIHTGERPFQCLECGKTFARERDLKTHQLVH-----TDAKAFHCVICVKNFALLSSLKRHLRAFH 137          

HSP 7 Score: 54.6842 bits (130), Expect = 6.768e-7
Identity = 24/49 (48.98%), Postives = 34/49 (69.39%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            +C  C+K+F  ++ LRIH R H+GE+PY C  C K FSQ+  LK+H+ T
Sbjct:  308 QCNHCEKRFNKQAKLRIHLRVHTGEKPYQCSQCGKHFSQDVNLKKHYRT 356          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Xenopus
Match: ZBTB38 (zinc finger and BTB domain containing 38 [Source:HGNC Symbol;Acc:HGNC:26636])

HSP 1 Score: 75.0998 bits (183), Expect = 6.129e-13
Identity = 34/79 (43.04%), Postives = 47/79 (59.49%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            C+ C K+F   + LKVH R HTGEKPY C+ CGK F+  G+LN+H   H        N++C+FC+  F     L+ HE+
Sbjct:  951 CELCQKSFRNPSTLKVHMRCHTGEKPYPCKTCGKCFSFPGNLNKHERIH----MGVKNFMCQFCSKSFMLNETLKKHER 1025          

HSP 2 Score: 56.6102 bits (135), Expect = 2.554e-7
Identity = 31/91 (34.07%), Postives = 45/91 (49.45%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPR 1038
            C +C K+F L   LK H+RIHTGEK Y C+ C + F    + N H   H+   +    ++C  C+      + L  H+K   H  RS + R
Sbjct: 1007 CQFCSKSFMLNETLKKHERIHTGEKLYGCQFCPQQFLYLCTKNNHEQRHQTERSV-KGFVCIQCSKICKTAAALGMHQK--KHYLRSLKQR 1094          

HSP 3 Score: 55.0694 bits (131), Expect = 8.577e-7
Identity = 29/87 (33.33%), Postives = 43/87 (49.43%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRS 1026
            C  C K F+    L  H+RIH G K ++C+ C K+F  + +L +H   H      +  Y C+FC  +F +     NHE+  H   RS
Sbjct:  979 CKTCGKCFSFPGNLNKHERIHMGVKNFMCQFCSKSFMLNETLKKHERIH----TGEKLYGCQFCPQQFLYLCTKNNHEQ-RHQTERS 1060          

HSP 4 Score: 53.9138 bits (128), Expect = 2.001e-6
Identity = 25/82 (30.49%), Postives = 38/82 (46.34%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            C  C + +   + L+ H  +H+  K Y C  C K F    +L  +R  H      D  Y C FC   F    +L+NH+K++H
Sbjct:  430 CIVCKRNYVTLSSLRRHSNVHSWRKSYPCHYCNKVF----ALAEYRTKHEIWHTGDRRYQCIFCLETFMTYYILKNHQKSSH 507          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Xenopus
Match: SALL3 (spalt-like transcription factor 3 [Source:NCBI gene;Acc:100038115])

HSP 1 Score: 75.0998 bits (183), Expect = 6.424e-13
Identity = 28/78 (35.90%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            +C  C +  +  + LK+H R HTGE+P+ C+ICG+AF   G+L  H   HR +      + C  C  KF +  +L+ H
Sbjct:  730 QCVICHRVLSCQSALKMHYRTHTGERPFKCKICGRAFTTKGNLKTHFGVHRAKPPLRVQHSCPICQKKFTNAVVLQQH 807          

HSP 2 Score: 70.8626 bits (172), Expect = 1.238e-11
Identity = 29/60 (48.33%), Postives = 39/60 (65.00%), Query Frame = 1
Query:  748 TKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDA 927
            T K   C  C KTF+ A+ L++H+R HTGEKP+ C ICG+AF   G+L  H  TH + +A
Sbjct: 1095 TPKQHNCHSCGKTFSSASALQIHERTHTGEKPFGCTICGRAFTTKGNLKVHMGTHMWNNA 1154          

HSP 3 Score: 63.5438 bits (153), Expect = 2.068e-9
Identity = 22/54 (40.74%), Postives = 35/54 (64.81%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRP 2337
            +C  C +  +C+SAL++HYR H+GERP+ C+ C + F+  G LK H    + +P
Sbjct:  730 QCVICHRVLSCQSALKMHYRTHTGERPFKCKICGRAFTTKGNLKTHFGVHRAKP 783          

HSP 4 Score: 57.7658 bits (138), Expect = 1.155e-7
Identity = 30/64 (46.88%), Postives = 35/64 (54.69%), Query Frame = 1
Query: 2128 KTT--DIFFSRKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            KTT  D FF       + KC  C K F  +SAL+IH R H+GERP+ C  C   FS  G LK H
Sbjct:  455 KTTSDDPFF-------KHKCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRFSTKGNLKVH 511          

HSP 5 Score: 57.3806 bits (137), Expect = 1.404e-7
Identity = 22/53 (41.51%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYR 921
            KC +C K F   + L++H R HTGE+P+ C ICG  F+  G+L  H   H+ +
Sbjct:  466 KCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRFSTKGNLKVHFQRHKEK 518          

HSP 6 Score: 56.6102 bits (135), Expect = 2.717e-7
Identity = 21/45 (46.67%), Postives = 28/45 (62.22%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            C  C K F+  SAL+IH R H+GE+P+ C  C + F+  G LK H
Sbjct: 1101 CHSCGKTFSSASALQIHERTHTGEKPFGCTICGRAFTTKGNLKVH 1145          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Xenopus
Match: SALL3 (spalt-like transcription factor 3 [Source:NCBI gene;Acc:100038115])

HSP 1 Score: 75.0998 bits (183), Expect = 6.669e-13
Identity = 28/78 (35.90%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            +C  C +  +  + LK+H R HTGE+P+ C+ICG+AF   G+L  H   HR +      + C  C  KF +  +L+ H
Sbjct:  710 QCVICHRVLSCQSALKMHYRTHTGERPFKCKICGRAFTTKGNLKTHFGVHRAKPPLRVQHSCPICQKKFTNAVVLQQH 787          

HSP 2 Score: 70.8626 bits (172), Expect = 1.330e-11
Identity = 29/60 (48.33%), Postives = 39/60 (65.00%), Query Frame = 1
Query:  748 TKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDA 927
            T K   C  C KTF+ A+ L++H+R HTGEKP+ C ICG+AF   G+L  H  TH + +A
Sbjct: 1075 TPKQHNCHSCGKTFSSASALQIHERTHTGEKPFGCTICGRAFTTKGNLKVHMGTHMWNNA 1134          

HSP 3 Score: 63.5438 bits (153), Expect = 2.204e-9
Identity = 22/54 (40.74%), Postives = 35/54 (64.81%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRP 2337
            +C  C +  +C+SAL++HYR H+GERP+ C+ C + F+  G LK H    + +P
Sbjct:  710 QCVICHRVLSCQSALKMHYRTHTGERPFKCKICGRAFTTKGNLKTHFGVHRAKP 763          

HSP 4 Score: 57.7658 bits (138), Expect = 1.222e-7
Identity = 30/64 (46.88%), Postives = 35/64 (54.69%), Query Frame = 1
Query: 2128 KTT--DIFFSRKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            KTT  D FF       + KC  C K F  +SAL+IH R H+GERP+ C  C   FS  G LK H
Sbjct:  435 KTTSDDPFF-------KHKCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRFSTKGNLKVH 491          

HSP 5 Score: 57.3806 bits (137), Expect = 1.459e-7
Identity = 22/53 (41.51%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYR 921
            KC +C K F   + L++H R HTGE+P+ C ICG  F+  G+L  H   H+ +
Sbjct:  446 KCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRFSTKGNLKVHFQRHKEK 498          

HSP 6 Score: 56.6102 bits (135), Expect = 2.898e-7
Identity = 21/45 (46.67%), Postives = 28/45 (62.22%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            C  C K F+  SAL+IH R H+GE+P+ C  C + F+  G LK H
Sbjct: 1081 CHSCGKTFSSASALQIHERTHTGEKPFGCTICGRAFTTKGNLKVH 1125          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Xenopus
Match: agtr1 (angiotensin II receptor type 1 [Source:Xenbase;Acc:XB-GENE-478953])

HSP 1 Score: 73.1738 bits (178), Expect = 7.182e-13
Identity = 36/80 (45.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K+F  +  L +HQRIHTGE+PYVC+ CGK+F  S +L  HR  H      +  YIC  C   F H S L  H+K 
Sbjct:  271 CKICGKSFISSAYLIMHQRIHTGERPYVCKECGKSFINSSNLIIHRRVH----TGERPYICSECGKSFRHSSDLVRHQKV 346          

HSP 2 Score: 63.5438 bits (153), Expect = 9.734e-10
Identity = 30/79 (37.97%), Postives = 43/79 (54.43%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            C  C K+F  ++ L +H+R+HTGE+PY+C  CGK+F  S  L RH+  H      +  Y C  C   F   S L  H++
Sbjct:  299 CKECGKSFINSSNLIIHRRVHTGERPYICSECGKSFRHSSDLVRHQKVH----TGERPYSCEECGKCFFRSSHLVRHKR 373          

HSP 3 Score: 56.9954 bits (136), Expect = 8.960e-8
Identity = 24/49 (48.98%), Postives = 32/49 (65.31%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            C  C K+F  ++ L  HQ++HTGE+PY CE CGK F +S  L RH+  H
Sbjct:  327 CSECGKSFRHSSDLVRHQKVHTGERPYSCEECGKCFFRSSHLVRHKRIH 375          

HSP 4 Score: 52.373 bits (124), Expect = 2.779e-6
Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            C DC K FT  ++L IH+R H+GERP+AC+ C K+F  +  L  H
Sbjct:  243 CSDCGKTFTQNASLIIHHRTHTGERPHACKICGKSFISSAYLIMH 287          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Xenopus
Match: ENSXETT00000016517.1 (oocyte zinc finger protein XlCOF26-like [Source:NCBI gene;Acc:100498327])

HSP 1 Score: 73.1738 bits (178), Expect = 8.275e-13
Identity = 38/96 (39.58%), Postives = 56/96 (58.33%), Query Frame = 1
Query:  715 GTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            GT +S     + +K   C  C +TF+  + L+ HQRIHTGEKPY C  CGK+F+ + +L+ H+  HR     ++N+ C  C  KFP  S L  H++
Sbjct:  298 GTLSSHQRIHTGEKPFSCTECGRTFSQKSTLRSHQRIHTGEKPYTCSECGKSFSLNSTLHTHQRYHR----KENNFTCGECGNKFPTKSNLLQHQR 389          

HSP 2 Score: 65.855 bits (159), Expect = 1.766e-10
Identity = 40/122 (32.79%), Postives = 52/122 (42.62%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNF 1110
            + +K   C  C +TF+    L  HQRIHTGEKP+ C  CG+ F+Q  +L  H+  H      +  Y C  C   F   S L  H+       R  R  N  T     N    KSN L +   
Sbjct:  280 AEEKPFTCSECGRTFSQIGTLSSHQRIHTGEKPFSCTECGRTFSQKSTLRSHQRIH----TGEKPYTCSECGKSFSLNSTLHTHQ-------RYHRKENNFTCGECGNKFPTKSNLLQHQRI 390          

HSP 3 Score: 53.1434 bits (126), Expect = 2.138e-6
Identity = 22/49 (44.90%), Postives = 29/49 (59.18%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            C  C   F   + L  HQRIHTGEKP++C  CG++F +  SL  H+  H
Sbjct:  371 CGECGNKFPTKSNLLQHQRIHTGEKPFICTTCGRSFTRGNSLRDHQRVH 419          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Mouse
Match: Zfp940 (zinc finger protein 940 [Source:MGI Symbol;Acc:MGI:2446235])

HSP 1 Score: 84.7297 bits (208), Expect = 2.342e-16
Identity = 83/319 (26.02%), Postives = 131/319 (41.07%), Query Frame = 1
Query:  559 NTDQNLPNQDIEDNSL-KPMETNSTSPPSLPELNI--AASPNSQNQSTES--PIA-PSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGR-----PRNLSTTDNNANSLDAKSNNLHNDNFKFNYPG--YNLNNDIKSDALTPTGNDDVDVKTDS------SGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIGGNLVSGSSGINSPTNPMMSKSNPLFSSESLVHQLANLSKKL 1458
             +D+ LP      N + K  E   TS P     +   A  P +  Q  ES  P   PSG    P +  + +K   C  C K+FTL + L  H+RIHTGE+PY C  CGKAF Q   L  H+  H  + A    Y+C  C   F   S L +H+   +H   +G+      +     D ++  +D +  +     FK  + G  +  ++ +++     +G    D K         S +++ H +  G  E  +TC  C    +    L  H   H      V G  G         S+ + L S +++ + + N  KK+
Sbjct:  179 ESDRILPQLTPPGNKVHKDKECGDTSAPESERTHCQRAHCPQTPQQGKESGGPFGLPSGILGLP-QGHTGEKSYDCKECGKSFTLKSNLTRHRRIHTGERPYTCHGCGKAFTQKSHLMSHQKIHTGKKA----YVCGVCGKAFHCDSSLTSHQNIHYHAADAGKKAYECKKCGKDFDCHSGLIDHQKVHTGEKPFKCKHCGRLFRFHSHLRAHTRIHSGVKSYDCKECGKSFNLRSNLMRHHRVHTG--ERPYTCHGCGKAFSQKSHLTSHQKIHTGEKAYVCGVCG------KAFSRGSSLTSHQNIHYYVVNAGKKV 484          

HSP 2 Score: 69.3218 bits (168), Expect = 1.932e-11
Identity = 36/80 (45.00%), Postives = 46/80 (57.50%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRY-RDATDSNYICRFCNTKFPHGSLLENHEK 1002
            C  C K F+  + L  HQ+IHTGEK YVC +CGKAF++  SL  H+N H Y  +A    Y C+ C   F   S L  H+K
Sbjct:  426 CHGCGKAFSQKSHLTSHQKIHTGEKAYVCGVCGKAFSRGSSLTSHQNIHYYVVNAGKKVYECKECGKAFGCHSNLSRHQK 505          

HSP 3 Score: 55.8398 bits (133), Expect = 2.540e-7
Identity = 25/63 (39.68%), Postives = 34/63 (53.97%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATD 933
            + KK+ +C  C K F   + L  HQ+IH GEKP+ C  C KAF Q   L +H+  H   +  D
Sbjct:  480 AGKKVYECKECGKAFGCHSNLSRHQKIHAGEKPFKCRDCEKAFGQRAHLTKHQRIHTGEEGPD 542          

HSP 4 Score: 51.2174 bits (121), Expect = 7.637e-6
Identity = 30/89 (33.71%), Postives = 43/89 (48.31%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIH-----TGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +K   C  C K F+  + L  HQ IH      G+K Y C+ CGKAF    +L+RH+  H    A +  + CR C   F   + L  H++
Sbjct:  449 EKAYVCGVCGKAFSRGSSLTSHQNIHYYVVNAGKKVYECKECGKAFGCHSNLSRHQKIH----AGEKPFKCRDCEKAFGQRAHLTKHQR 533          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Mouse
Match: Zfp853 (zinc finger protein 853 [Source:MGI Symbol;Acc:MGI:2685638])

HSP 1 Score: 83.5741 bits (205), Expect = 7.095e-16
Identity = 41/99 (41.41%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLS 1047
            +K   C YC K F+ ++ L  HQR HTGE+PYVC  CGK F+ S +L RHR TH    + +  Y+C  C  +F H   +  HE+  H    +GR R L 
Sbjct:  554 EKPYACTYCSKCFSESSALVQHQRTHTGERPYVCGDCGKRFSVSSNLLRHRRTH----SGERPYVCEDCGERFRHKVQIRRHERQLHG---AGRSRGLG 645          

HSP 2 Score: 63.929 bits (154), Expect = 9.989e-10
Identity = 30/80 (37.50%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K F+ +  L  HQ  HTGE+PY+C  CGK+F+Q  +L  H+  H      +  Y C +C+  F   S L  H++T
Sbjct:  503 CSECGKGFSRSTDLVRHQATHTGERPYLCSECGKSFSQHSNLVTHQRIH----TGEKPYACTYCSKCFSESSALVQHQRT 578          

HSP 3 Score: 53.9138 bits (128), Expect = 1.271e-6
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT-CKNRPTV 2343
            C +C K F+  S L  H R H+GE+PYAC +CSK FS++  L +H  T    RP V
Sbjct:  531 CSECGKSFSQHSNLVTHQRIHTGEKPYACTYCSKCFSESSALVQHQRTHTGERPYV 586          

HSP 4 Score: 52.373 bits (124), Expect = 3.197e-6
Identity = 22/45 (48.89%), Postives = 27/45 (60.00%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            C DC K+F+  S L  H R HSGERPY CE C + F     ++RH
Sbjct:  587 CGDCGKRFSVSSNLLRHRRTHSGERPYVCEDCGERFRHKVQIRRH 631          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Mouse
Match: Zfp853 (zinc finger protein 853 [Source:MGI Symbol;Acc:MGI:2685638])

HSP 1 Score: 83.5741 bits (205), Expect = 8.155e-16
Identity = 41/99 (41.41%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLS 1047
            +K   C YC K F+ ++ L  HQR HTGE+PYVC  CGK F+ S +L RHR TH    + +  Y+C  C  +F H   +  HE+  H    +GR R L 
Sbjct:  620 EKPYACTYCSKCFSESSALVQHQRTHTGERPYVCGDCGKRFSVSSNLLRHRRTH----SGERPYVCEDCGERFRHKVQIRRHERQLHG---AGRSRGLG 711          

HSP 2 Score: 63.929 bits (154), Expect = 1.018e-9
Identity = 30/80 (37.50%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K F+ +  L  HQ  HTGE+PY+C  CGK+F+Q  +L  H+  H      +  Y C +C+  F   S L  H++T
Sbjct:  569 CSECGKGFSRSTDLVRHQATHTGERPYLCSECGKSFSQHSNLVTHQRIH----TGEKPYACTYCSKCFSESSALVQHQRT 644          

HSP 3 Score: 53.9138 bits (128), Expect = 1.261e-6
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT-CKNRPTV 2343
            C +C K F+  S L  H R H+GE+PYAC +CSK FS++  L +H  T    RP V
Sbjct:  597 CSECGKSFSQHSNLVTHQRIHTGEKPYACTYCSKCFSESSALVQHQRTHTGERPYV 652          

HSP 4 Score: 52.373 bits (124), Expect = 3.218e-6
Identity = 22/45 (48.89%), Postives = 27/45 (60.00%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            C DC K+F+  S L  H R HSGERPY CE C + F     ++RH
Sbjct:  653 CGDCGKRFSVSSNLLRHRRTHSGERPYVCEDCGERFRHKVQIRRH 697          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Mouse
Match: Zfp853 (zinc finger protein 853 [Source:MGI Symbol;Acc:MGI:2685638])

HSP 1 Score: 83.5741 bits (205), Expect = 9.018e-16
Identity = 41/99 (41.41%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLS 1047
            +K   C YC K F+ ++ L  HQR HTGE+PYVC  CGK F+ S +L RHR TH    + +  Y+C  C  +F H   +  HE+  H    +GR R L 
Sbjct:  605 EKPYACTYCSKCFSESSALVQHQRTHTGERPYVCGDCGKRFSVSSNLLRHRRTH----SGERPYVCEDCGERFRHKVQIRRHERQLH---GAGRSRGLG 696          

HSP 2 Score: 63.5438 bits (153), Expect = 1.124e-9
Identity = 30/80 (37.50%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K F+ +  L  HQ  HTGE+PY+C  CGK+F+Q  +L  H+  H      +  Y C +C+  F   S L  H++T
Sbjct:  554 CSECGKGFSRSTDLVRHQATHTGERPYLCSECGKSFSQHSNLVTHQRIH----TGEKPYACTYCSKCFSESSALVQHQRT 629          

HSP 3 Score: 53.9138 bits (128), Expect = 1.327e-6
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT-CKNRPTV 2343
            C +C K F+  S L  H R H+GE+PYAC +CSK FS++  L +H  T    RP V
Sbjct:  582 CSECGKSFSQHSNLVTHQRIHTGEKPYACTYCSKCFSESSALVQHQRTHTGERPYV 637          

HSP 4 Score: 52.373 bits (124), Expect = 3.506e-6
Identity = 22/45 (48.89%), Postives = 27/45 (60.00%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            C DC K+F+  S L  H R HSGERPY CE C + F     ++RH
Sbjct:  638 CGDCGKRFSVSSNLLRHRRTHSGERPYVCEDCGERFRHKVQIRRH 682          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Mouse
Match: Zfp768 (zinc finger protein 768 [Source:MGI Symbol;Acc:MGI:2384582])

HSP 1 Score: 80.8777 bits (198), Expect = 4.552e-15
Identity = 54/196 (27.55%), Postives = 80/196 (40.82%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPG--YNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSIL----GGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIG 1335
            C  C K+F   + L  HQRIHTGEKPY CE+C KAF+QS  L +H+ TH      +  Y C  C   F   S L  H++T    +    P       +++  L  +  + H   +     G  Y+ N+ ++S     TG              +  +++      + E  F CP C         L +H   H  G
Sbjct:  288 CGICGKSFGRGSTLIQHQRIHTGEKPYKCEVCSKAFSQSSDLIKHQRTH----TGERPYKCPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAIHARTHLPG 479          

HSP 2 Score: 67.781 bits (164), Expect = 5.287e-11
Identity = 34/90 (37.78%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRR 1023
            +   C  C KTF  ++ L  HQR HTGE+PY C +CGK F +S +L +H   H    + +  Y C  C   F   S L  H++T    RR
Sbjct:  480 RTYSCPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHHRVH----SGERPYKCDDCGKAFSQSSDLIRHQRTHAAGRR 565          

HSP 3 Score: 58.151 bits (139), Expect = 5.367e-8
Identity = 29/87 (33.33%), Postives = 42/87 (48.28%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            + +K  KC  C K F  ++VL +H R H   + Y C  CGK FN+S +L +H+ +H      +  Y C  C   F   S L  H + 
Sbjct:  449 AREKPFKCPECGKRFGQSSVLAIHARTHLPGRTYSCPDCGKTFNRSSTLIQHQRSH----TGERPYRCAVCGKGFCRSSTLLQHHRV 531          

HSP 4 Score: 53.9138 bits (128), Expect = 9.838e-7
Identity = 24/46 (52.17%), Postives = 28/46 (60.87%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHH 2316
            CPDC K F   S L  H R H+GERPY C  C K F ++ TL +HH
Sbjct:  484 CPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHH 529          

HSP 5 Score: 51.9878 bits (123), Expect = 3.944e-6
Identity = 26/54 (48.15%), Postives = 30/54 (55.56%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            G    +C  C K F   S L  H+R HSGERPY C+ C K FSQ+  L RH  T
Sbjct:  506 GERPYRCAVCGKGFCRSSTLLQHHRVHSGERPYKCDDCGKAFSQSSDLIRHQRT 559          

HSP 6 Score: 51.2174 bits (121), Expect = 7.762e-6
Identity = 25/51 (49.02%), Postives = 30/51 (58.82%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            G +  KCP C K F   S L  H R HS ERPY+C  C K +SQN +L+ H
Sbjct:  366 GQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNSSLRSH 416          

HSP 7 Score: 50.8322 bits (120), Expect = 9.698e-6
Identity = 21/45 (46.67%), Postives = 30/45 (66.67%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            CP+C K ++  S+LR H R H+G+RP++C  C K+FSQ   L  H
Sbjct:  400 CPECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPH 444          
BLAST of Zinc finger and BTB domain containing 41 vs. UniProt/SwissProt
Match: sp|Q17895|MNM2_CAEEL (Zinc finger protein mnm-2 OS=Caenorhabditis elegans OX=6239 GN=mnm-2 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 9.634e-19
Identity = 60/169 (35.50%), Postives = 85/169 (50.30%), Query Frame = 1
Query:  502 MLFDSNSNEKCFLPITYDHNTDQNLPNQDIEDNSLKPMETNSTSPPSLPEL-NIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            MLF      +CF P+    +   +L  Q  + N L+ +  ++   P +P L N+A +    N    S +  S        ++   K  +CD CDKTF+ +N L  H+RIHTGEKP+ CE CG+AF Q G+L RHR TH     T   Y+C  C+  F   S L  H +T
Sbjct:   96 MLF----RPECFFPLELSKHL--HLVQQTFQMNVLQNL-GHTLPLPFVPMLKNVAPAQKRLNNKRASYVDHS--------QKGNLKKYRCDVCDKTFSRSNTLITHKRIHTGEKPFKCEHCGRAFRQPGNLTRHRLTH----TTVKPYVCGLCDKAFNRASNLHTHMRT 245          

HSP 2 Score: 58.9214 bits (141), Expect = 4.988e-8
Identity = 26/58 (44.83%), Postives = 36/58 (62.07%), Query Frame = 1
Query: 2149 SRKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            S+KG  ++ +C  CDK F+  + L  H R H+GE+P+ CE C + F Q G L RH LT
Sbjct:  160 SQKGNLKKYRCDVCDKTFSRSNTLITHKRIHTGEKPFKCEHCGRAFRQPGNLTRHRLT 217          
BLAST of Zinc finger and BTB domain containing 41 vs. UniProt/SwissProt
Match: sp|Q8TC21|ZN596_HUMAN (Zinc finger protein 596 OS=Homo sapiens OX=9606 GN=ZNF596 PE=1 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 1.012e-15
Identity = 40/80 (50.00%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K FT ++VLK H+RIHTGEKPY C +CGKAF +S  L RH  TH      +  Y C  C   F H S+L  HE+T
Sbjct:  365 CHLCGKAFTESSVLKRHERIHTGEKPYECHVCGKAFTESSDLRRHERTH----TGEKPYECHLCGKAFNHSSVLRRHERT 440          

HSP 2 Score: 74.7146 bits (182), Expect = 2.230e-12
Identity = 37/80 (46.25%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K FT  + L+ H+R HTGEKPY C +CGKAF++S +L RH   H    A     IC  C   F H S L  HE+T
Sbjct:  225 CHLCGKAFTHCSDLRKHERTHTGEKPYGCHLCGKAFSKSSNLRRHEMIHTREKAQ----ICHLCGKAFTHCSDLRKHERT 300          

HSP 3 Score: 70.0922 bits (170), Expect = 6.977e-11
Identity = 35/81 (43.21%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            +C  C K F  ++VL+ H+R HTGEKPY C ICGKAFN+S +   HR  H      +  Y+C  C   F     L  HE+T
Sbjct:  420 ECHLCGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVH----TGEKPYVCPLCGKAFSKFFNLRQHERT 496          

HSP 4 Score: 67.0106 bits (162), Expect = 6.152e-10
Identity = 32/69 (46.38%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            +C  C K FT ++ L+ H+R HTGEKPY C +CGKAFN S  L RH  TH      +  Y C  C   F
Sbjct:  392 ECHVCGKAFTESSDLRRHERTHTGEKPYECHLCGKAFNHSSVLRRHERTH----TGEKPYECNICGKAF 456          

HSP 5 Score: 65.855 bits (159), Expect = 1.273e-9
Identity = 32/80 (40.00%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K FT  + L+ H+R H G+KPY C +CGKAF++   L +H  TH      +  Y C  C   F H S L  HE++
Sbjct:  281 CHLCGKAFTHCSDLRKHERTHLGDKPYGCLLCGKAFSKCSYLRQHERTHN----GEKPYECHLCGKAFSHCSHLRQHERS 356          

HSP 6 Score: 64.3142 bits (155), Expect = 3.692e-9
Identity = 35/85 (41.18%), Postives = 46/85 (54.12%), Query Frame = 1
Query:  748 TKKI-LKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHE 999
            T++I L+C  C KTF+  + L+ H+ IHTGEKP+ C +CGKAF     L +H  TH      +  Y C  C   F   S L  HE
Sbjct:  190 TREITLECRVCGKTFSKNSNLRRHEMIHTGEKPHGCHLCGKAFTHCSDLRKHERTH----TGEKPYGCHLCGKAFSKSSNLRRHE 270          

HSP 7 Score: 64.3142 bits (155), Expect = 3.957e-9
Identity = 32/81 (39.51%), Postives = 42/81 (51.85%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            +C  C K F+  + L+ H+R H GEKP+ C +CGKAF +S  L RH   H      +  Y C  C   F   S L  HE+T
Sbjct:  336 ECHLCGKAFSHCSHLRQHERSHNGEKPHGCHLCGKAFTESSVLKRHERIH----TGEKPYECHVCGKAFTESSDLRRHERT 412          

HSP 8 Score: 62.003 bits (149), Expect = 1.976e-8
Identity = 31/80 (38.75%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K F+ ++ L+ H+ IHT EK  +C +CGKAF     L +H  TH      D  Y C  C   F   S L  HE+T
Sbjct:  253 CHLCGKAFSKSSNLRRHEMIHTREKAQICHLCGKAFTHCSDLRKHERTH----LGDKPYGCLLCGKAFSKCSYLRQHERT 328          

HSP 9 Score: 59.3066 bits (142), Expect = 1.569e-7
Identity = 24/50 (48.00%), Postives = 36/50 (72.00%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            +C+ C K F  +   ++H+R+HTGEKPYVC +CGKAF++  +L +H  TH
Sbjct:  448 ECNICGKAFNRSYNFRLHRRVHTGEKPYVCPLCGKAFSKFFNLRQHERTH 497          
BLAST of Zinc finger and BTB domain containing 41 vs. UniProt/SwissProt
Match: sp|Q9BXA9|SALL3_HUMAN (Sal-like protein 3 OS=Homo sapiens OX=9606 GN=SALL3 PE=1 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 2.106e-14
Identity = 84/301 (27.91%), Postives = 123/301 (40.86%), Query Frame = 1
Query: 2059 TKKNSVPRSSPTSSGHTTQSSSNKTTD---IFFSRKGGSERRKCPD-----CDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT--CKNRPTVLSSTKLKVIPNKPSMSKDSESAAPDVNNSTNGSTYTMT--NSPPCSFGTNSLTNPQ---NPHLNYMINTKALATKINETINKFDHFPDNSMFQTVSSYSTGELSRKNNEQRFPFSNNIESSEEPTVGFMDLTVNCSRHSDTVSQSNDG-----EAPLDIDNIDETKAPTNSLRSETEQMEISNHKINRNSNFHNQY 2901
            T++   P ++P S G   ++   +      +F SR    ER KCP      C K F C+SAL IHYR H+ ERP+ C  C +  S  G LK+H LT   K  P+ L      + P++ + S  S +A   +    NG    M     PP   G      PQ    P L  M     LA     T  + +     S  +T SS S  ++  + +    PF   I      T G  +L V+   H    + +  G     E P+ +   D  K       SE  Q +++   +N + +F NQY
Sbjct:  935 TERPDSPAAAPGSGGAPGRAGIKEEAPFSLLFLSR----ERGKCPSTVCGVCGKPFACKSALEIHYRSHTKERPFVCALCRRGCSTMGNLKQHLLTHRLKELPSQLFDPNFALGPSQSTPSLISSAAPTMIKMEVNGHGKAMALGEGPPLPAGVQVPAGPQTVMGPGLAPM-----LAPPPRRTPKQHNC---QSCGKTFSSASALQIHERTHTGEKPFGCTICGRAFTTKG--NLKVHMGTHMWNNAPARRGRRLSVENPMALLGGDALK------FSEMFQKDLAARAMNVDPSFWNQY 1215          

HSP 2 Score: 73.1738 bits (178), Expect = 1.228e-11
Identity = 28/78 (35.90%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            +C  C +  +  + LK+H R HTGE+P+ C+ICG+AF   G+L  H   HR +      + C  C  KF +  +L+ H
Sbjct:  680 QCVICHRVLSCQSALKMHYRTHTGERPFKCKICGRAFTTKGNLKTHFGVHRAKPPLRVQHSCPICQKKFTNAVVLQQH 757          

HSP 3 Score: 70.0922 bits (170), Expect = 9.884e-11
Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDA 927
            C  C KTF+ A+ L++H+R HTGEKP+ C ICG+AF   G+L  H  TH + +A
Sbjct: 1115 CQSCGKTFSSASALQIHERTHTGEKPFGCTICGRAFTTKGNLKVHMGTHMWNNA 1168          

HSP 4 Score: 61.6178 bits (148), Expect = 3.881e-8
Identity = 22/56 (39.29%), Postives = 36/56 (64.29%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRPTV 2343
            +C  C +  +C+SAL++HYR H+GERP+ C+ C + F+  G LK H    + +P +
Sbjct:  680 QCVICHRVLSCQSALKMHYRTHTGERPFKCKICGRAFTTKGNLKTHFGVHRAKPPL 735          

HSP 5 Score: 56.9954 bits (136), Expect = 1.271e-6
Identity = 29/98 (29.59%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  679 QNQSTESPIAPSGTTNSP----IEEESTKKIL------------KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRD 924
            + +  +SP A  G+  +P    I+EE+   +L             C  C K F   + L++H R HT E+P+VC +C +  +  G+L +H  THR ++
Sbjct:  934 KTERPDSPAAAPGSGGAPGRAGIKEEAPFSLLFLSRERGKCPSTVCGVCGKPFACKSALEIHYRSHTKERPFVCALCRRGCSTMGNLKQHLLTHRLKE 1031          

HSP 6 Score: 56.225 bits (134), Expect = 1.738e-6
Identity = 22/53 (41.51%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYR 921
            KC +C K F   + L++H R HTGE+P+ C ICG  F+  G+L  H   H+ +
Sbjct:  421 KCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRFSTKGNLKVHFQRHKEK 473          

HSP 7 Score: 55.8398 bits (133), Expect = 2.816e-6
Identity = 24/48 (50.00%), Postives = 29/48 (60.42%), Query Frame = 1
Query: 2170 RRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            + KC  C K F  +SAL+IH R H+GERP+ C  C   FS  G LK H
Sbjct:  419 KHKCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRFSTKGNLKVH 466          
BLAST of Zinc finger and BTB domain containing 41 vs. UniProt/SwissProt
Match: sp|Q9H5H4|ZN768_HUMAN (Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 2.365e-14
Identity = 54/196 (27.55%), Postives = 80/196 (40.82%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPG--YNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSIL----GGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIG 1335
            C  C K+F   + L  HQRIHTGEKPY CE+C KAF+QS  L +H+ TH      +  Y C  C   F   S L  H++T    +    P       +++  L  +  + H   +     G  Y+ N+ ++S     TG              +  +++      + E  F CP C         L +H   H  G
Sbjct:  263 CGICGKSFGRGSTLIQHQRIHTGEKPYKCEVCSKAFSQSSDLIKHQRTH----TGERPYKCPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCTECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAIHARTHLPG 454          

HSP 2 Score: 74.7146 bits (182), Expect = 2.127e-12
Identity = 38/90 (42.22%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNR 1020
            +K  KC+ C K F+ ++ L  HQR HTGE+PY C  CGKAF  S  L RH+ TH    +    Y C  C   F   S L  H++T  H R
Sbjct:  286 EKPYKCEVCSKAFSQSSDLIKHQRTHTGERPYKCPRCGKAFADSSYLLRHQRTH----SGQKPYKCPHCGKAFGDSSYLLRHQRTHSHER 371          

HSP 3 Score: 67.3958 bits (163), Expect = 4.236e-10
Identity = 34/90 (37.78%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRR 1023
            +   C  C KTF  ++ L  HQR HTGE+PY C +CGK F +S +L +H   H    + +  Y C  C   F   S L  H++T    RR
Sbjct:  455 RTYSCPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHHRVH----SGERPYKCDDCGKAFSQSSDLIRHQRTHAAGRR 540          

HSP 4 Score: 65.855 bits (159), Expect = 1.443e-9
Identity = 30/87 (34.48%), Postives = 49/87 (56.32%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            S ++   C  C K ++  + L+ HQR+HTG++P+ C ICGK+F+Q  +L  H  +H    A +  + C  C  +F   S+L  H +T
Sbjct:  368 SHERPYSCTECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSH----AREKPFKCPECGKRFGQSSVLAIHART 450          

HSP 5 Score: 59.3066 bits (142), Expect = 1.499e-7
Identity = 30/87 (34.48%), Postives = 43/87 (49.43%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            S +K  KC +C K F  ++ L  HQR H+ E+PY C  CGK ++Q+ SL  H+  H         + C  C   F   S L  H ++
Sbjct:  340 SGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCTECGKCYSQNSSLRSHQRVH----TGQRPFSCGICGKSFSQRSALIPHARS 422          

HSP 6 Score: 57.7658 bits (138), Expect = 4.353e-7
Identity = 29/87 (33.33%), Postives = 42/87 (48.28%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            + +K  KC  C K F  ++VL +H R H   + Y C  CGK FN+S +L +H+ +H      +  Y C  C   F   S L  H + 
Sbjct:  424 AREKPFKCPECGKRFGQSSVLAIHARTHLPGRTYSCPDCGKTFNRSSTLIQHQRSH----TGERPYRCAVCGKGFCRSSTLLQHHRV 506          

HSP 7 Score: 53.9138 bits (128), Expect = 7.105e-6
Identity = 24/46 (52.17%), Postives = 28/46 (60.87%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHH 2316
            CPDC K F   S L  H R H+GERPY C  C K F ++ TL +HH
Sbjct:  459 CPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHH 504          
BLAST of Zinc finger and BTB domain containing 41 vs. UniProt/SwissProt
Match: sp|Q8R0T2|ZN768_MOUSE (Zinc finger protein 768 OS=Mus musculus OX=10090 GN=Znf768 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 3.440e-14
Identity = 54/196 (27.55%), Postives = 80/196 (40.82%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPG--YNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSIL----GGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIG 1335
            C  C K+F   + L  HQRIHTGEKPY CE+C KAF+QS  L +H+ TH      +  Y C  C   F   S L  H++T    +    P       +++  L  +  + H   +     G  Y+ N+ ++S     TG              +  +++      + E  F CP C         L +H   H  G
Sbjct:  291 CGICGKSFGRGSTLIQHQRIHTGEKPYKCEVCSKAFSQSSDLIKHQRTH----TGERPYKCPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAIHARTHLPG 482          

HSP 2 Score: 67.781 bits (164), Expect = 3.622e-10
Identity = 34/90 (37.78%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRR 1023
            +   C  C KTF  ++ L  HQR HTGE+PY C +CGK F +S +L +H   H    + +  Y C  C   F   S L  H++T    RR
Sbjct:  483 RTYSCPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHHRVH----SGERPYKCDDCGKAFSQSSDLIRHQRTHAAGRR 568          

HSP 3 Score: 58.151 bits (139), Expect = 3.801e-7
Identity = 29/87 (33.33%), Postives = 42/87 (48.28%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            + +K  KC  C K F  ++VL +H R H   + Y C  CGK FN+S +L +H+ +H      +  Y C  C   F   S L  H + 
Sbjct:  452 AREKPFKCPECGKRFGQSSVLAIHARTHLPGRTYSCPDCGKTFNRSSTLIQHQRSH----TGERPYRCAVCGKGFCRSSTLLQHHRV 534          

HSP 4 Score: 53.9138 bits (128), Expect = 7.023e-6
Identity = 24/46 (52.17%), Postives = 28/46 (60.87%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHH 2316
            CPDC K F   S L  H R H+GERPY C  C K F ++ TL +HH
Sbjct:  487 CPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHH 532          
BLAST of Zinc finger and BTB domain containing 41 vs. TrEMBL
Match: G4VRP2 (Putative zinc finger protein OS=Schistosoma mansoni OX=6183 GN=Smp_151950 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.327e-27
Identity = 54/82 (65.85%), Postives = 64/82 (78.05%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            C YC+K F+L NVLKVH+RIHTGEKPYVCEIC KAFNQSGSLNRH+NTH  R + + +Y CRFC  +F H S L++HE   H
Sbjct:  167 CRYCNKAFSLMNVLKVHERIHTGEKPYVCEICNKAFNQSGSLNRHKNTHTKRSSDNRSYSCRFCPRQFLHSSQLQDHETMEH 248          
BLAST of Zinc finger and BTB domain containing 41 vs. TrEMBL
Match: A0A183SZP4 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9692 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 2.625e-27
Identity = 57/93 (61.29%), Postives = 70/93 (75.27%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            ++ E   +   C YC K F L NVLKVH+RIHTGEKPY+CEIC KAFNQSGSLNRH+NTHR R + + +Y CRFC+ +F H S L++HE TAH
Sbjct:  141 LDAEKRARKFVCRYCHKAFGLMNVLKVHERIHTGEKPYICEICHKAFNQSGSLNRHKNTHRKRCSDNRSYPCRFCSCEFLHSSHLQDHENTAH 233          
BLAST of Zinc finger and BTB domain containing 41 vs. TrEMBL
Match: A0A183PA14 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS11200 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.780e-27
Identity = 61/122 (50.00%), Postives = 79/122 (64.75%), Query Frame = 1
Query:  664 ASPNSQNQSTESPIAPSGTTNSPIEEESTK------KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            ++PN  + S +    P+  T  P+  +S        +   C YC+K F+L NVLKVH+RIHTGEKPYVCEIC KAFNQSGSLNRH+NTH  R + + +Y CRFC  +F H S L++HE   H
Sbjct:  120 SNPNDSDDSLKQLTNPNKDTGKPVYSKSNNNDDKRPRKFICRYCNKAFSLMNVLKVHERIHTGEKPYVCEICNKAFNQSGSLNRHKNTHTKRSSDNRSYSCRFCPRQFLHSSQLQDHETVEH 241          

HSP 2 Score: 63.5438 bits (153), Expect = 1.950e-6
Identity = 38/116 (32.76%), Postives = 57/116 (49.14%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRPTVLSSTKLKVIPNK---PSMSKDSESAAPDV--------NNSTNGSTYTMTNSPPCSFGTNSL 2493
            C  C+K F+  + L++H R H+GE+PY CE C+K F+Q+G+L RH  T   R +   S   +  P +    S  +D E+    +        +N T  + YT    P  S  T SL
Sbjct:  160 CRYCNKAFSLMNVLKVHERIHTGEKPYVCEICNKAFNQSGSLNRHKNTHTKRSSDNRSYSCRFCPRQFLHSSQLQDHETVEHSMEMNISISKSNDTRVNDYTTVKLPTSSLSTTSL 275          
BLAST of Zinc finger and BTB domain containing 41 vs. TrEMBL
Match: A0A183QJG2 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.955e-26
Identity = 54/82 (65.85%), Postives = 64/82 (78.05%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            C YC+K F+L NVLKVH+RIHTGEKPYVCEIC KAFNQSGSLNRH+NTH  R + + +Y CRFC  +F H S L++HE   H
Sbjct:  160 CRYCNKAFSLMNVLKVHERIHTGEKPYVCEICNKAFNQSGSLNRHKNTHTKRSSDNRSYSCRFCPRQFLHSSQLQDHETVEH 241          

HSP 2 Score: 62.003 bits (149), Expect = 5.560e-6
Identity = 29/85 (34.12%), Postives = 50/85 (58.82%), Query Frame = 1
Query: 2083 SSPTSSGHTTQSSSNKTTDI---FFSRKGGSERRK-----CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            S+P  S  + +  +N T D     +S+   ++ ++     C  C+K F+  + L++H R H+GE+PY CE C+K F+Q+G+L RH
Sbjct:  120 SNPNDSDDSLKQLTNTTKDTGKSIYSKSNNNDDKRPRKFICRYCNKAFSLMNVLKVHERIHTGEKPYVCEICNKAFNQSGSLNRH 204          
BLAST of Zinc finger and BTB domain containing 41 vs. TrEMBL
Match: A0A183JBN9 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS94 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 6.518e-26
Identity = 60/110 (54.55%), Postives = 76/110 (69.09%), Query Frame = 1
Query:  682 NQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            N+ T  PI      N   +++  +K + C YC+K F+L NVLKVH+RIHTGEKPYVCEIC KAFNQSGSLNRH+NTH  R + + +Y CRFC  +F H S L++HE   H
Sbjct:  144 NKDTGKPIYSKSNNN---DDKRPRKFI-CRYCNKAFSLMNVLKVHERIHTGEKPYVCEICNKAFNQSGSLNRHKNTHTKRSSDNRSYSCRFCPRQFLHSSQLQDHETVEH 249          

HSP 2 Score: 63.1586 bits (152), Expect = 4.014e-6
Identity = 38/116 (32.76%), Postives = 57/116 (49.14%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRPTVLSSTKLKVIPNK---PSMSKDSESAAPDV--------NNSTNGSTYTMTNSPPCSFGTNSL 2493
            C  C+K F+  + L++H R H+GE+PY CE C+K F+Q+G+L RH  T   R +   S   +  P +    S  +D E+    +        +N T  + YT    P  S  T SL
Sbjct:  168 CRYCNKAFSLMNVLKVHERIHTGEKPYVCEICNKAFNQSGSLNRHKNTHTKRSSDNRSYSCRFCPRQFLHSSQLQDHETVEHSMEMNISISKSNDTRVNDYTTVKLPTSSLSTTSL 283          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Cavefish
Match: ENSAMXT00000047252.1 (pep primary_assembly:Astyanax_mexicanus-2.0:11:8223842:8230372:1 gene:ENSAMXG00000037382.1 transcript:ENSAMXT00000047252.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 1.413e-16
Identity = 46/156 (29.49%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  562 TDQNLPNQDIEDNSLKPMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEE--------STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            T++  P++D+ D + K M     SP  +PEL+    P + ++           T +P + E          K+++KC+YC + F  A+   +H+R+HTGEKP+ C ICGK F     L  H   H    + +  Y CR C   F     +  HE+ 
Sbjct:   76 TEKTAPSEDVLDETSKSM-----SPGHVPELD--QKPLTASECNSEASEADALTENPTDLELSSRGRPRKEKRVIKCEYCGRPFNHASAYIIHRRVHTGEKPFTCPICGKIFPYKSVLKIHLRIH----SGEKPYTCRVCGKAFTQACTVRVHERV 220          

HSP 2 Score: 56.6102 bits (135), Expect = 3.717e-8
Identity = 23/45 (51.11%), Postives = 29/45 (64.44%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            CP C K F  +S L+IH R HSGE+PY C  C K F+Q  T++ H
Sbjct:  173 CPICGKIFPYKSVLKIHLRIHSGEKPYTCRVCGKAFTQACTVRVH 217          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Cavefish
Match: ENSAMXT00000034080.1 (pep primary_assembly:Astyanax_mexicanus-2.0:11:8226713:8229466:1 gene:ENSAMXG00000037382.1 transcript:ENSAMXT00000034080.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 2.994e-15
Identity = 46/153 (30.07%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  562 TDQNLPNQDIEDNSLKPMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEEST--------KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            T++  P++D+ D + K M     SP  +PEL+    P + ++           T +P + E +        K+++KC+YC + F  A+   +H+R+HTGEKP+ C+IC +AF Q  +L  H   H   ++      C  C   FP+ S+L+ H
Sbjct:   74 TEKTAPSEDVLDETSKSM-----SPGHVPELD--QKPLTASECNSEASEADALTENPTDLELSSRGRPRKEKRVIKCEYCGRPFNHASAYIIHRRVHTGEKPFSCQICSRAFAQLSNLRSHMKVH---NSPKKPVACPICGKIFPYKSVLKIH 216          

HSP 2 Score: 68.9366 bits (167), Expect = 1.215e-11
Identity = 28/52 (53.85%), Postives = 36/52 (69.23%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRH 900
            S KK + C  C K F   +VLK+H RIH+GEKPY C +CGKAF Q+ +L+ H
Sbjct:  193 SPKKPVACPICGKIFPYKSVLKIHLRIHSGEKPYTCRVCGKAFTQACTLDTH 244          

HSP 3 Score: 56.9954 bits (136), Expect = 7.195e-8
Identity = 25/49 (51.02%), Postives = 29/49 (59.18%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTC 2325
            CP C K F  +S L+IH R HSGE+PY C  C K F+Q  TL  H   C
Sbjct:  200 CPICGKIFPYKSVLKIHLRIHSGEKPYTCRVCGKAFTQACTLDTHSKYC 248          

HSP 4 Score: 50.8322 bits (120), Expect = 5.262e-6
Identity = 29/72 (40.28%), Postives = 41/72 (56.94%), Query Frame = 1
Query: 2134 TDIFFSRKGG--SERR--KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRP 2337
            TD+  S +G    E+R  KC  C + F   SA  IH R H+GE+P++C+ CS+ F+Q   L R H+   N P
Sbjct:  124 TDLELSSRGRPRKEKRVIKCEYCGRPFNHASAYIIHRRVHTGEKPFSCQICSRAFAQLSNL-RSHMKVHNSP 194          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Cavefish
Match: ENSAMXT00000056464.1 (pep primary_assembly:Astyanax_mexicanus-2.0:11:8221969:8233747:1 gene:ENSAMXG00000037382.1 transcript:ENSAMXT00000056464.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 1.831e-14
Identity = 46/157 (29.30%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  562 TDQNLPNQDIEDNSLKPMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEE--------STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH---RYRDATDSNYI-CRFCNTKFPHGSLLENH 996
            T++  P++D+ D + K M     SP  +PEL+    P + ++           T +P + E          K+++KC+YC + F  A+   +H+R+HTGEKP+ C+IC +AF Q  +L  H   H   ++        + C  C   FP+ S+L+ H
Sbjct:  100 TEKTAPSEDVLDETSKSM-----SPGHVPELD--QKPLTASECNSEASEADALTENPTDLELSSRGRPRKEKRVIKCEYCGRPFNHASAYIIHRRVHTGEKPFSCQICSRAFAQLSNLRSHMKVHNSPKFLSMQHRKPVACPICGKIFPYKSVLKIH 249          

HSP 2 Score: 72.0182 bits (175), Expect = 1.088e-12
Identity = 31/82 (37.80%), Postives = 44/82 (53.66%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            +K + C  C K F   +VLK+H RIH+GEKPY C +CGKAF Q+ ++  H   H     +   ++C  C   F     L+ H
Sbjct:  228 RKPVACPICGKIFPYKSVLKIHLRIHSGEKPYTCRVCGKAFTQACTVRVHERVH----WSIKPFLCSKCGKGFSQIGTLKAH 305          

HSP 3 Score: 57.3806 bits (137), Expect = 5.165e-8
Identity = 23/45 (51.11%), Postives = 29/45 (64.44%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            CP C K F  +S L+IH R HSGE+PY C  C K F+Q  T++ H
Sbjct:  233 CPICGKIFPYKSVLKIHLRIHSGEKPYTCRVCGKAFTQACTVRVH 277          

HSP 4 Score: 57.3806 bits (137), Expect = 5.786e-8
Identity = 23/52 (44.23%), Postives = 32/52 (61.54%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRH 900
            S +K   C  C K FT A  ++VH+R+H   KP++C  CGK F+Q G+L  H
Sbjct:  254 SGEKPYTCRVCGKAFTQACTVRVHERVHWSIKPFLCSKCGKGFSQIGTLKAH 305          

HSP 5 Score: 55.0694 bits (131), Expect = 2.829e-7
Identity = 32/83 (38.55%), Postives = 45/83 (54.22%), Query Frame = 1
Query: 2134 TDIFFSRKGG--SERR--KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRPTVLSSTKLKVI 2370
            TD+  S +G    E+R  KC  C + F   SA  IH R H+GE+P++C+ CS+ F+Q   L R H+   N P  LS    K +
Sbjct:  150 TDLELSSRGRPRKEKRVIKCEYCGRPFNHASAYIIHRRVHTGEKPFSCQICSRAFAQLSNL-RSHMKVHNSPKFLSMQHRKPV 231          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Cavefish
Match: ENSAMXT00000031188.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001626.1:125101:126261:-1 gene:ENSAMXG00000038280.1 transcript:ENSAMXT00000031188.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 3.649e-14
Identity = 57/204 (27.94%), Postives = 82/204 (40.20%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLD--AKSNNLHNDNFKFNYPGYNL----NNDIKSDALTPTGNDDVDVKTDSSGIIKDHSI----LGGSNESGFTCPYCQLGLNDIRDLGVHLSQHNI 1332
            +K  +C  C K FT    LK+HQRIHTGEKPY C  CGK+FNQ+GSL  H+  H      +  + C  C   F   S L+ H++         +P + S    +  SL    + + +H     F      +    +  +K      TG           G I+  ++       + E  F CP C      I  L  H   H +
Sbjct:   65 EKPYQCSECGKCFTQQGDLKIHQRIHTGEKPYQCSECGKSFNQNGSLTAHQRIH----TGEKPFHCSDCGKNFNRQSSLKTHQRI----HTGEKPYHCSECGQSFRSLGILTRHHLIHTGEKPFQCADCGMTFRESGTLKKHERIHTGERPYQCSECGKGFIQQSALKKHQCSHAEEKPFQCPECGQSFRQISKLQKHQQIHKV 260          

HSP 2 Score: 66.2402 bits (160), Expect = 6.714e-11
Identity = 64/221 (28.96%), Postives = 83/221 (37.56%), Query Frame = 1
Query:  703 IAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF-PHGSLLENHEKTAHHNRRSG-RPRNLSTTDNNANSLDA-----------KSNNLHNDNFKFNYPGYNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQH 1326
            ++P   T    EEE T    +C  C K FT    L+ HQRIHTGEKPY C  CGK F Q G L  H+  H      +  Y C  C   F  +GSL      TAH    +G +P + S    N N   +           K  +       F   G    + +      P    D  +    SG +K H  +  + E  + C  C  G      L  H   H
Sbjct:   23 LSPQDQTQIDKEEEGTSH--RCPDCGKIFTKQRDLRKHQRIHTGEKPYQCSECGKCFTQQGDLKIHQRIH----TGEKPYQCSECGKSFNQNGSL------TAHQRIHTGEKPFHCSDCGKNFNRQSSLKTHQRIHTGEKPYHCSECGQSFRSLGILTRHHLIHTGEKPFQCADCGMTFRESGTLKKHERI-HTGERPYQCSECGKGFIQQSALKKHQCSH 230          

HSP 3 Score: 62.3882 bits (150), Expect = 1.286e-9
Identity = 30/62 (48.39%), Postives = 37/62 (59.68%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDS 936
            +K  +C  C  TF  +   K HQRIHTGE+PY C  CGK+FNQ G+L  H   H +R  T S
Sbjct:  317 EKPYQCTECGMTFRESGTFKKHQRIHTGERPYQCSECGKSFNQLGTLKTHTPAHSHRRETVS 378          

HSP 4 Score: 59.6918 bits (143), Expect = 7.887e-9
Identity = 34/86 (39.53%), Postives = 43/86 (50.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRR 1023
            C  C  +F   + LK HQRIHTGEKPY C  CG  F +SG+  +H+  H      +  Y C  C   F     L+ H   AH +RR
Sbjct:  294 CSECGMSFRRISKLKKHQRIHTGEKPYQCTECGMTFRESGTFKKHQRIH----TGERPYQCSECGKSFNQLGTLKTH-TPAHSHRR 374          

HSP 5 Score: 55.0694 bits (131), Expect = 2.455e-7
Identity = 25/46 (54.35%), Postives = 30/46 (65.22%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            +CPDC K FT +  LR H R H+GE+PY C  C K F+Q G LK H
Sbjct:   41 RCPDCGKIFTKQRDLRKHQRIHTGEKPYQCSECGKCFTQQGDLKIH 86          

HSP 6 Score: 54.6842 bits (130), Expect = 2.975e-7
Identity = 32/109 (29.36%), Postives = 46/109 (42.20%), Query Frame = 1
Query:  748 TKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSL 1074
             +K+ +C  C  +F   + LK HQ IHT EKPY C  CG +F +   L +H+  H      +  Y C  C   F      + H++         RP   S    + N L
Sbjct:  260 VEKVYQCSECGSSFNQESSLKRHQIIHTAEKPYCCSECGMSFRRISKLKKHQRIH----TGEKPYQCTECGMTFRESGTFKKHQRI----HTGERPYQCSECGKSFNQL 360          

HSP 7 Score: 54.6842 bits (130), Expect = 3.670e-7
Identity = 30/86 (34.88%), Postives = 44/86 (51.16%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            + +K  +C  C ++F   + L+ HQ+IH  EK Y C  CG +FNQ  SL RH+  H      +  Y C  C   F   S L+ H++
Sbjct:  231 AEEKPFQCPECGQSFRQISKLQKHQQIHKVEKVYQCSECGSSFNQESSLKRHQIIH----TAEKPYCCSECGMSFRRISKLKKHQR 312          

HSP 8 Score: 52.373 bits (124), Expect = 1.737e-6
Identity = 23/46 (50.00%), Postives = 32/46 (69.57%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            +C +C K FT +  L+IH R H+GE+PY C  C K+F+QNG+L  H
Sbjct:   69 QCSECGKCFTQQGDLKIHQRIHTGEKPYQCSECGKSFNQNGSLTAH 114          

HSP 9 Score: 51.2174 bits (121), Expect = 3.876e-6
Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHL 2319
            C DC K F  +S+L+ H R H+GE+PY C  C ++F   G L RHHL
Sbjct:  126 CSDCGKNFNRQSSLKTHQRIHTGEKPYHCSECGQSFRSLGILTRHHL 172          

HSP 10 Score: 51.2174 bits (121), Expect = 3.979e-6
Identity = 30/96 (31.25%), Postives = 45/96 (46.88%), Query Frame = 1
Query:  712 SGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHE 999
            SGT        + ++  +C  C K F   + LK HQ  H  EKP+ C  CG++F Q   L +H+  H+     +  Y C  C + F   S L+ H+
Sbjct:  192 SGTLKKHERIHTGERPYQCSECGKGFIQQSALKKHQCSHAEEKPFQCPECGQSFRQISKLQKHQQIHK----VEKVYQCSECGSSFNQESSLKRHQ 283          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Cavefish
Match: ENSAMXT00000026722.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001270.1:231767:233107:1 gene:ENSAMXG00000043423.1 transcript:ENSAMXT00000026722.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 8.308e-14
Identity = 54/163 (33.13%), Postives = 78/163 (47.85%), Query Frame = 1
Query:  601 SLKPMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEE----STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLD 1077
            S K   T  TS P+LPE  +  S + +     S    S +  S ++      + +K   C  C K F+  + L+ HQRIHTGEKPY C  CGK+FNQ  +L RH+  H    + +  Y C  C   F H S L+ H++  H   +S    +   + N  N+L 
Sbjct:   81 STKVSSTKQTSSPTLPE-QMQKSTDKKKTHHCSDCGKSFSYQSTLQLHQRIHTGEKPYHCSDCGKNFSYQSHLQQHQRIHTGEKPYHCSDCGKSFNQRNALQRHQRIH----SGEKPYHCLDCGKSFNHQSNLQQHQRI-HTGEKSHHCTDCGKSFNQQNALQ 237          

HSP 2 Score: 62.003 bits (149), Expect = 1.805e-9
Identity = 33/84 (39.29%), Postives = 47/84 (55.95%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +K   C  C K+F   + L++HQRIHTGEKPY C  CG++FNQ  +L  H+  H      +  Y C  C   F + S L +H++
Sbjct:  302 EKPYHCSDCGKSFNRQSHLQLHQRIHTGEKPYYCSECGRSFNQQSNLTAHQRIH----TGEKPYYCSECGRSFNNQSNLTSHQR 381          

HSP 3 Score: 62.003 bits (149), Expect = 2.129e-9
Identity = 32/79 (40.51%), Postives = 41/79 (51.90%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            C  C K+F   N L+ HQRIHTGEKPY C  CGK+F+    L  H+  H      +  Y C  C   F H S  + H++
Sbjct:  223 CTDCGKSFNQQNALQQHQRIHTGEKPYHCSDCGKSFSYQSRLKAHQRIH----TGEKPYHCSECGKSFGHHSHFQLHQR 297          

HSP 4 Score: 59.3066 bits (142), Expect = 1.369e-8
Identity = 32/84 (38.10%), Postives = 42/84 (50.00%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +K   C  C K+F+  + LK HQRIHTGEKPY C  CGK+F        H+  H      +  Y C  C   F   S L+ H++
Sbjct:  246 EKPYHCSDCGKSFSYQSRLKAHQRIHTGEKPYHCSECGKSFGHHSHFQLHQRIH----TGEKPYHCSDCGKSFNRQSHLQLHQR 325          

HSP 5 Score: 58.9214 bits (141), Expect = 1.972e-8
Identity = 32/84 (38.10%), Postives = 43/84 (51.19%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +K   C  C K+F   +  ++HQRIHTGEKPY C  CGK+FN+   L  H+  H      +  Y C  C   F   S L  H++
Sbjct:  274 EKPYHCSECGKSFGHHSHFQLHQRIHTGEKPYHCSDCGKSFNRQSHLQLHQRIH----TGEKPYYCSECGRSFNQQSNLTAHQR 353          

HSP 6 Score: 58.151 bits (139), Expect = 3.291e-8
Identity = 33/87 (37.93%), Postives = 47/87 (54.02%), Query Frame = 1
Query:  742 ESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
             S +K   C  C K+F   + L+ HQRIHTGEK + C  CGK+FNQ  +L +H+  H      +  Y C  C   F + S L+ H++
Sbjct:  187 HSGEKPYHCLDCGKSFNHQSNLQQHQRIHTGEKSHHCTDCGKSFNQQNALQQHQRIH----TGEKPYHCSDCGKSFSYQSRLKAHQR 269          

HSP 7 Score: 56.6102 bits (135), Expect = 9.905e-8
Identity = 26/51 (50.98%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHR 903
            +K   C  C K+F   + L  HQRIHTGEKPY C  CGK+F  S SL +H+
Sbjct:  386 EKPFHCADCGKSFRYQSHLHFHQRIHTGEKPYQCSDCGKSFRYSRSLKKHK 436          

HSP 8 Score: 56.225 bits (134), Expect = 1.199e-7
Identity = 29/79 (36.71%), Postives = 41/79 (51.90%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            C  C ++F   + L  HQRIHTGEKPY C  CG++FN   +L  H+  H      +  + C  C   F + S L  H++
Sbjct:  335 CSECGRSFNQQSNLTAHQRIHTGEKPYYCSECGRSFNNQSNLTSHQRIH----TGEKPFHCADCGKSFRYQSHLHFHQR 409          

HSP 9 Score: 51.2174 bits (121), Expect = 5.086e-6
Identity = 28/78 (35.90%), Postives = 39/78 (50.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHE 999
            C  C ++F   + L  HQRIHTGEKP+ C  CGK+F     L+ H+  H      +  Y C  C   F +   L+ H+
Sbjct:  363 CSECGRSFNNQSNLTSHQRIHTGEKPFHCADCGKSFRYQSHLHFHQRIH----TGEKPYQCSDCGKSFRYSRSLKKHK 436          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001747.1 (pep scaffold:Pmarinus_7.0:GL479152:3602:4030:-1 gene:ENSPMAG00000001584.1 transcript:ENSPMAT00000001747.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 5.931e-16
Identity = 37/89 (41.57%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSG 1029
            +C +CD  F   + LK H R HTGE+PY CE+CG+AF+Q  +L +H  TH      +  Y C  C   F H S L  HE+T    R  G
Sbjct:    6 QCLHCDSRFFKTDDLKRHMRTHTGERPYCCEVCGRAFSQLCNLKKHWITH----TGERQYRCALCGRAFKHFSGLRLHERTHTGERPYG 90          

HSP 2 Score: 55.4546 bits (132), Expect = 2.272e-9
Identity = 23/49 (46.94%), Postives = 30/49 (61.22%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            +C  CD +F     L+ H R H+GERPY CE C + FSQ   LK+H +T
Sbjct:    6 QCLHCDSRFFKTDDLKRHMRTHTGERPYCCEVCGRAFSQLCNLKKHWIT 54          

HSP 3 Score: 53.5286 bits (127), Expect = 9.505e-9
Identity = 19/47 (40.43%), Postives = 31/47 (65.96%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHR 903
            +C  C + F   + L++H+R HTGE+PY C++CG+AF    ++  HR
Sbjct:   62 RCALCGRAFKHFSGLRLHERTHTGERPYGCDVCGRAFAHYSNMKAHR 108          

HSP 4 Score: 53.1434 bits (126), Expect = 1.333e-8
Identity = 20/51 (39.22%), Postives = 29/51 (56.86%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            G  + +C  C + F   S LR+H R H+GERPY C+ C + F+    +K H
Sbjct:   57 GERQYRCALCGRAFKHFSGLRLHERTHTGERPYGCDVCGRAFAHYSNMKAH 107          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004792.1 (pep scaffold:Pmarinus_7.0:GL479046:11287:22931:1 gene:ENSPMAG00000004344.1 transcript:ENSPMAT00000004792.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 6.600e-16
Identity = 43/109 (39.45%), Postives = 53/109 (48.62%), Query Frame = 1
Query:  685 QSTESPIAPSGTTNSPIEEESTKKILK---CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            Q+    +  S +   P+      K L+   C  CDK FT  N LK H RIHTGEKPYVCE+CGKAF Q   L  H   H      +  Y C  C  +F   S L+ H +
Sbjct:   19 QTCACVVTRSSSHAEPLRHARIHKGLRPFICSLCDKAFTQGNQLKTHMRIHTGEKPYVCEVCGKAFAQKCQLVFHTRMH---HGDEKPYGCDVCGLRFATSSNLKIHVR 124          

HSP 2 Score: 54.299 bits (129), Expect = 3.141e-8
Identity = 29/94 (30.85%), Postives = 41/94 (43.62%), Query Frame = 1
Query:  730 PIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            P++          ++C   F  ++ L  H R HTGEKPY+C  CGK F  SG L +H  +H      +  +IC  C   +     L  H    H
Sbjct:  150 PVKRHQGHVNWAANFCSIFFLQSSSLITHARKHTGEKPYICNTCGKCFCSSGELKKHSRSH----TGERPFICEICGNLYTDAKNLRKHLNRVH 239          

HSP 3 Score: 49.2914 bits (116), Expect = 1.712e-6
Identity = 22/45 (48.89%), Postives = 27/45 (60.00%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            C  CDK FT  + L+ H R H+GE+PY CE C K F+Q   L  H
Sbjct:   49 CSLCDKAFTQGNQLKTHMRIHTGEKPYVCEVCGKAFAQKCQLVFH 93          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005225.1 (pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1 gene:ENSPMAG00000004710.1 transcript:ENSPMAT00000005225.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 8.232e-16
Identity = 35/86 (40.70%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            ++ KCD+CDK+F   + L+ H RIHTGE+PY+C++C KAFNQ+ +L  H   H      +  Y C++C+  F     ++ H K AH
Sbjct: 1689 RLYKCDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIHMKKH----TGEKPYKCQYCDMAFSQKGNMKIHIKRAH 1770          

HSP 2 Score: 74.7146 bits (182), Expect = 1.124e-13
Identity = 41/121 (33.88%), Postives = 59/121 (48.76%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSG------RPRNLSTTDNNANSLDAKSNNLHNDN 1107
            +C++C KTF   + L  H RIHTGE+P+ CE CG+AFNQ G+L  H+  H      +  Y C FC   F     L  H +  H + + G      +  + S       SL+A  + +H D 
Sbjct:  164 RCEHCMKTFQKPSQLIRHIRIHTGERPFTCEECGRAFNQKGALQIHKAKH----TGERPYRCAFCPHTFSQRGNLRAHIQRVHSDAKPGGEQPVFQCEDCSCVFKKLGSLNAHISRMHADE 280          

HSP 3 Score: 70.8626 bits (172), Expect = 1.771e-12
Identity = 34/77 (44.16%), Postives = 43/77 (55.84%), Query Frame = 1
Query:  739 EESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            EEST++  +C YC+K F  ++ LK H R HTGEKP+ C  CG+ F  SG L  H  TH    A    Y C  C+  F
Sbjct:  948 EESTRRSYRCGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGFVSSGVLKAHMRTHTGEKA----YKCDLCDATF 1020          

HSP 4 Score: 61.2326 bits (147), Expect = 1.284e-9
Identity = 34/86 (39.53%), Postives = 42/86 (48.84%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNR 1020
            +C YC+K F  ++ LK H R HTGEKPY C  C ++F  SG L  H  TH    A    Y C  C+  F     L+ H  T    R
Sbjct:  636 RCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIRTHVGLKA----YKCVMCDGTFTTNGSLKRHMSTHSETR 717          

HSP 5 Score: 61.2326 bits (147), Expect = 1.374e-9
Identity = 29/79 (36.71%), Postives = 39/79 (49.37%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            +   + +K  KC  C + F  + VLK H R HTGEK Y C++C   F  +GSL RH   H     +   + C FC   F
Sbjct:  974 VRSHTGEKPFKCAQCGRGFVSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHMVMH----TSMHPFKCPFCEESF 1048          

HSP 6 Score: 58.9214 bits (141), Expect = 6.673e-9
Identity = 24/45 (53.33%), Postives = 30/45 (66.67%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            C +C + F  + AL+IH  KH+GERPY C FC  TFSQ G L+ H
Sbjct:  193 CEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAH 237          

HSP 7 Score: 58.9214 bits (141), Expect = 7.020e-9
Identity = 30/91 (32.97%), Postives = 44/91 (48.35%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            I   + +K  +C  C ++F  + VLK H R H G K Y C +C   F  +GSL RH +TH    +    ++C +C   F      + H KT
Sbjct:  654 IRSHTGEKPYRCGQCSRSFVSSGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRHMSTH----SETRPFMCPYCQKTFKTSVNCKKHMKT 740          

HSP 8 Score: 58.151 bits (139), Expect = 1.290e-8
Identity = 23/45 (51.11%), Postives = 31/45 (68.89%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            C  CDK F   +AL+IH +KH+GE+PY C++C   FSQ G +K H
Sbjct: 1721 CQVCDKAFNQTNALQIHMKKHTGEKPYKCQYCDMAFSQKGNMKIH 1765          

HSP 9 Score: 55.4546 bits (132), Expect = 8.709e-8
Identity = 27/87 (31.03%), Postives = 40/87 (45.98%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRS 1026
            C  C +TF+    LK H  +H  E+  +C  CG  F     L RH + HR   +    + CR C+ +F   S L  H ++ +  R S
Sbjct:   60 CPDCGRTFSRIASLKAHIMLHEKEENLMCTECGDEFTLQSQLERHMDMHRQELSGARTFTCRICHQEFQRVSTLREHMRSHYKIRAS 146          

HSP 10 Score: 53.9138 bits (128), Expect = 2.321e-7
Identity = 20/46 (43.48%), Postives = 27/46 (58.70%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            KC  C + F     L+ H R H+GE+ Y C+ C  TF+ NG+L RH
Sbjct:  984 KCAQCGRGFVSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRH 1029          

HSP 11 Score: 53.5286 bits (127), Expect = 3.423e-7
Identity = 30/74 (40.54%), Postives = 37/74 (50.00%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFP-HGSL 984
            C YC+K F   + L  H RIHT EKPY C  C +AF    +L  HR TH         ++C  C+  F   GSL
Sbjct:  458 CPYCNKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAHRKTH----TGLKEFMCPLCDKLFSTQGSL 527          

HSP 12 Score: 53.1434 bits (126), Expect = 3.601e-7
Identity = 27/72 (37.50%), Postives = 34/72 (47.22%), Query Frame = 1
Query:  712 SGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDA 927
            SG   + I      K  KC  CD TFT    LK H   H+  +P++C  C K F  S +  +H  THRY  A
Sbjct:  675 SGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRHMSTHSETRPFMCPYCQKTFKTSVNCKKHMKTHRYELA 746          

HSP 13 Score: 52.373 bits (124), Expect = 6.728e-7
Identity = 26/58 (44.83%), Postives = 32/58 (55.17%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDA 927
            K   C  CDK F+    LKVH R+HTG KP+ C  C K F  SG    H  +H ++DA
Sbjct:  510 KEFMCPLCDKLFSTQGSLKVHIRLHTGAKPFDCPHCNKKFRTSGHRKSHIASH-FKDA 566          

HSP 14 Score: 51.9878 bits (123), Expect = 1.009e-6
Identity = 23/46 (50.00%), Postives = 28/46 (60.87%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            KC  CDK F   S L+ H R H+GERPY C+ C K F+Q   L+ H
Sbjct: 1692 KCDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIH 1737          

HSP 15 Score: 51.2174 bits (121), Expect = 1.566e-6
Identity = 27/79 (34.18%), Postives = 38/79 (48.10%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            I   + +K  KC  C + F + + L  H++ HTG K ++C +C K F+  GSL  H   H      D    C  CN KF
Sbjct:  475 IRIHTHEKPYKCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVHIRLHTGAKPFD----CPHCNKKF 549          

HSP 16 Score: 50.8322 bits (120), Expect = 2.271e-6
Identity = 25/79 (31.65%), Postives = 37/79 (46.84%), Query Frame = 1
Query:  712 SGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYIC 948
            SG   + +   + +K  KCD CD TFT    L  H  +HT   P+ C  C ++F  S    +H  TH+     D++  C
Sbjct:  995 SGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHMVMHTSMHPFKCPFCEESFRTSLHCRKHMRTHQEHGDADADDEC 1073          

HSP 17 Score: 50.447 bits (119), Expect = 2.712e-6
Identity = 24/70 (34.29%), Postives = 35/70 (50.00%), Query Frame = 1
Query:  703 IAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            I    T +  ++  + +K  KC  C+  F+    LKVH R+HTG KP+ C  C + F  SG    H  +H
Sbjct: 1183 ITVKSTLDCHVKTHTGQKHFKCHICNSPFSTKGSLKVHMRLHTGAKPFKCPHCEQRFRTSGHRKSHIQSH 1252          

HSP 18 Score: 50.0618 bits (118), Expect = 3.966e-6
Identity = 25/60 (41.67%), Postives = 34/60 (56.67%), Query Frame = 1
Query: 2137 DIFFSRKGGSER-RKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            D   S   G +R  +C  C+K F   S L+ H R H+GE+PY C  CS++F  +G LK H
Sbjct:  622 DGMLSDGSGLDRPYRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAH 681          

HSP 19 Score: 49.6766 bits (117), Expect = 4.137e-6
Identity = 20/51 (39.22%), Postives = 27/51 (52.94%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            G +  +C  C + F     L+ H R H G + Y C  C  TF+ NG+LKRH
Sbjct:  659 GEKPYRCGQCSRSFVSSGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRH 709          

HSP 20 Score: 48.9062 bits (115), Expect = 7.224e-6
Identity = 25/54 (46.30%), Postives = 30/54 (55.56%), Query Frame = 1
Query: 2152 RKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            R G S R  C  C K F   S L  H R H+GERP+ CE C + F+Q G L+ H
Sbjct:  158 RSGFSHR--CEHCMKTFQKPSQLIRHIRIHTGERPFTCEECGRAFNQKGALQIH 209          

HSP 21 Score: 48.9062 bits (115), Expect = 7.599e-6
Identity = 19/45 (42.22%), Postives = 29/45 (64.44%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            CP CDK F+ + +L++H R H+G +P+ C  C+K F  +G  K H
Sbjct:  514 CPLCDKLFSTQGSLKVHIRLHTGAKPFDCPHCNKKFRTSGHRKSH 558          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006856.1 (pep scaffold:Pmarinus_7.0:GL476534:515915:516469:1 gene:ENSPMAG00000006196.1 transcript:ENSPMAT00000006856.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 3.256e-15
Identity = 35/85 (41.18%), Postives = 48/85 (56.47%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNR 1020
            C  C K F  A  L++H+R HTGEKPY C  CG+AF++SG L++HR TH    A +  + C  C   F     L++H  T   +R
Sbjct:   32 CALCGKAFGTAWNLRIHERKHTGEKPYECNACGRAFSESGHLDKHRATH----AAERPFKCDTCGRAFAQARYLKSHRATHAADR 112          

HSP 2 Score: 55.4546 bits (132), Expect = 2.341e-9
Identity = 27/86 (31.40%), Postives = 43/86 (50.00%), Query Frame = 1
Query:  739 EESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            + + +K  +C+ C + F+ +  L  H+  H  E+P+ C+ CG+AF Q+  L  HR TH    A D  + C  C   F     L+ H
Sbjct:   51 KHTGEKPYECNACGRAFSESGHLDKHRATHAAERPFKCDTCGRAFAQARYLKSHRATH----AADRPFECGACGKTFTLARYLDRH 132          

HSP 3 Score: 53.5286 bits (127), Expect = 1.254e-8
Identity = 23/48 (47.92%), Postives = 29/48 (60.42%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            C  C K F     LRIH RKH+GE+PY C  C + FS++G L +H  T
Sbjct:   32 CALCGKAFGTAWNLRIHERKHTGEKPYECNACGRAFSESGHLDKHRAT 79          

HSP 4 Score: 52.373 bits (124), Expect = 3.015e-8
Identity = 23/67 (34.33%), Postives = 35/67 (52.24%), Query Frame = 1
Query:  712 SGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            SG  +      + ++  KCD C + F  A  LK H+  H  ++P+ C  CGK F  +  L+RHR+ H
Sbjct:   70 SGHLDKHRATHAAERPFKCDTCGRAFAQARYLKSHRATHAADRPFECGACGKTFTLARYLDRHRSRH 136          

HSP 5 Score: 49.6766 bits (117), Expect = 2.215e-7
Identity = 25/72 (34.72%), Postives = 33/72 (45.83%), Query Frame = 1
Query:  805 LKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNR 1020
            L  H+R HTGE+P+ C +CGKAF  + +L  H   H      +  Y C  C   F     L+ H  T    R
Sbjct:   17 LHKHRRTHTGERPFTCALCGKAFGTAWNLRIHERKH----TGEKPYECNACGRAFSESGHLDKHRATHAAER 84          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Sea Lamprey
Match: ZNF436 (zinc finger protein 436 [Source:HGNC Symbol;Acc:HGNC:20814])

HSP 1 Score: 74.7146 bits (182), Expect = 1.339e-14
Identity = 40/113 (35.40%), Postives = 60/113 (53.10%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSG--RPRNLSTTDNNANSLDAKSNNLH 1098
            C  C ++F++A+ L  H+R+HTGE+PY C  CG+AF+Q  SL +H+  H    + +  + C  C   F H + L  HEKT H  R +G  + R  +     A   D +S   H
Sbjct:   34 CAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQGRH----SAEKPHACATCGKAFSHRAFLRKHEKT-HAERVAGLVKERRFACERCCATFFDNQSRQRH 141          

HSP 2 Score: 72.7886 bits (177), Expect = 6.407e-14
Identity = 35/94 (37.23%), Postives = 51/94 (54.26%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLS 1047
            C+ C  TF      + HQ  HTGE+P+VCE+CGKAF+   +L +H++TH    + D  ++C  C   FPH + L+ H K   H     +P   S
Sbjct:  125 CERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKHQSTH----SGDRPHVCELCGKAFPHATNLKQHLK--RHTEDKNKPHACS 212          

HSP 3 Score: 57.7658 bits (138), Expect = 5.677e-9
Identity = 35/103 (33.98%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  742 ESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLST 1050
            E   K   C  C + F     L  H R HTGE+P+VC  CG+AF    +L +H  TH      +  ++C  C   F   S L  H + AH  +R  RP++  T
Sbjct:  203 EDKNKPHACSECGRRFLSVRELAQHARTHTGERPHVCAECGRAFAAVSTLRKHARTH----TGERPHVCPQCGRAFTSSSNLRAHAR-AHAGQR--RPQHACT 298          

HSP 4 Score: 56.6102 bits (135), Expect = 1.171e-8
Identity = 26/80 (32.50%), Postives = 38/80 (47.50%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C + F   + L+ H R HTGE+P+VC  CG+AF  S +L  H   H  +      + C  C  +F     L  H+ +
Sbjct:  239 CAECGRAFAAVSTLRKHARTHTGERPHVCPQCGRAFTSSSNLRAHARAHAGQ--RRPQHACTQCGCRFARAGALRKHQSS 316          

HSP 5 Score: 53.9138 bits (128), Expect = 9.956e-8
Identity = 22/49 (44.90%), Postives = 30/49 (61.22%), Query Frame = 1
Query: 2167 ERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            +R  CP C + F   S+L  H R H+GERPYAC  C ++FS   +L +H
Sbjct:    2 KRHACPQCGRCFALRSSLTKHARTHTGERPYACAACGRSFSVASSLVKH 50          

HSP 6 Score: 51.9878 bits (123), Expect = 3.579e-7
Identity = 26/60 (43.33%), Postives = 31/60 (51.67%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH---HLTCKNRPTVLS 2349
            C  C K F+  S LR H   HSG+RP+ CE C K F     LK+H   H   KN+P   S
Sbjct:  153 CELCGKAFSHHSTLRKHQSTHSGDRPHVCELCGKAFPHATNLKQHLKRHTEDKNKPHACS 212          

HSP 7 Score: 51.2174 bits (121), Expect = 5.882e-7
Identity = 22/52 (42.31%), Postives = 30/52 (57.69%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHH 2316
            G     C  C + F+  S+L  H R H+GERPYAC  C + FSQ  +L++H 
Sbjct:   28 GERPYACAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQ 79          

HSP 8 Score: 48.521 bits (114), Expect = 5.418e-6
Identity = 28/99 (28.28%), Postives = 42/99 (42.42%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHT-------GEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNR 1020
            S +K   C  C K F+    L+ H++ H         E+ + CE C   F  + S  RH+ TH      +  ++C  C   F H S L  H+ T   +R
Sbjct:   83 SAEKPHACATCGKAFSHRAFLRKHEKTHAERVAGLVKERRFACERCCATFFDNQSRQRHQTTH----TGERPFVCELCGKAFSHHSTLRKHQSTHSGDR 177          

HSP 9 Score: 47.7506 bits (112), Expect = 7.643e-6
Identity = 25/61 (40.98%), Postives = 33/61 (54.10%), Query Frame = 1
Query: 2167 ERR-KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT-CKNRPTV 2343
            ERR  C  C   F    + + H   H+GERP+ CE C K FS + TL++H  T   +RP V
Sbjct:  120 ERRFACERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKHQSTHSGDRPHV 180          

HSP 10 Score: 47.7506 bits (112), Expect = 7.988e-6
Identity = 19/51 (37.25%), Postives = 27/51 (52.94%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            G     C +C + F   S LR H R H+GERP+ C  C + F+ +  L+ H
Sbjct:  233 GERPHVCAECGRAFAAVSTLRKHARTHTGERPHVCPQCGRAFTSSSNLRAH 283          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 72.7886 bits (177), Expect = 1.991e-13
Identity = 34/88 (38.64%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRF--CNTKFPHGSLLENHEKTAH 1011
            K   CDYC K FT    L+ H+R+HTGEKPY C+IC K F++ G+L  H  TH+        ++C+   CN  F     ++ H+   H
Sbjct:  619 KPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKP----FVCKLENCNKTFTQLGNMKAHQNRFH 702          

HSP 2 Score: 69.3218 bits (168), Expect = 2.349e-12
Identity = 35/96 (36.46%), Postives = 47/96 (48.96%), Query Frame = 1
Query:  715 GTTNSPIEEESTKKILK--CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            G    P   ++T+ + K  C YC + F+ A  L+VH R H G KP+VC+ CGK F Q G+L  H   H      +  Y C  C+ KF     L  H
Sbjct:  576 GGVEKPKGTQNTRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLH----TGEKPYSCDICDKKFSRKGNLAAH 667          

HSP 3 Score: 56.6102 bits (135), Expect = 2.011e-8
Identity = 23/48 (47.92%), Postives = 30/48 (62.50%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLT 2322
            C  C K+FT    LR H R H+GE+PY+C+ C K FS+ G L  H +T
Sbjct:  623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVT 670          

HSP 4 Score: 54.299 bits (129), Expect = 8.596e-8
Identity = 18/49 (36.73%), Postives = 31/49 (63.27%), Query Frame = 1
Query: 2167 ERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            ++ +CP C + F+  + L +H R H G +P+ C++C K F+Q G L+ H
Sbjct:  591 KKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTH 639          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 69.707 bits (169), Expect = 2.066e-12
Identity = 33/75 (44.00%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            S +K  KC  C+K F +++ LK+H R HTGEKP  C+ICGK FN+S +L++H  TH+ +      Y C  C+  F
Sbjct:  791 SGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQKK------YKCSDCSKSF 859          

HSP 2 Score: 58.9214 bits (141), Expect = 3.275e-9
Identity = 34/91 (37.36%), Postives = 42/91 (46.15%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            ++  S  K  KC  C + F+    L  H R H+GEKPY C IC K F  S SL  H  TH      +    C+ C  +F   S L  H KT
Sbjct:  759 LKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTH----TGEKPLQCKICGKRFNESSNLSKHIKT 845          

HSP 3 Score: 52.7582 bits (125), Expect = 2.744e-7
Identity = 21/51 (41.18%), Postives = 33/51 (64.71%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            G +  KC  C+K+F   S+L+IH R H+GE+P  C+ C K F+++  L +H
Sbjct:  792 GEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKH 842          

HSP 4 Score: 49.6766 bits (117), Expect = 2.838e-6
Identity = 26/77 (33.77%), Postives = 39/77 (50.65%), Query Frame = 1
Query:  775 CDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C +TF     L  H ++H+  KPY C+ C + F+   +L +H  TH    + +  Y C  CN KF   S L+ H +T
Sbjct:  745 CHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTH----SGEKPYKCHICNKKFAISSSLKIHIRT 817          

HSP 5 Score: 48.9062 bits (115), Expect = 4.489e-6
Identity = 21/46 (45.65%), Postives = 28/46 (60.87%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            KC  C + F+ E  L  H R HSGE+PY C  C+K F+ + +LK H
Sbjct:  769 KCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIH 814          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 63.929 bits (154), Expect = 1.014e-10
Identity = 34/96 (35.42%), Postives = 41/96 (42.71%), Query Frame = 1
Query:  760 LKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYIC---------RFCNTKFPHGSLLENHEKTAHHNR 1020
              CD C K FT    LK H R HT E+P++C ICGKAF +     RH + H  +      Y+C           C  KF     L  H KT    R
Sbjct:  569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGK----KRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESGRR 660          

HSP 2 Score: 48.521 bits (114), Expect = 5.611e-6
Identity = 22/62 (35.48%), Postives = 30/62 (48.39%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRPTVLSSTKLK 2364
            C  C K+FT    L+ H R H+ ERP+ C  C K F++    KRH      +   +   KLK
Sbjct:  571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLK 632          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Yeast
Match: MIG2 (Zinc finger transcriptional repressor; cooperates with Mig1p in glucose-induced gene repression; under low glucose conditions relocalizes to mitochondrion, where it interacts with Ups1p, antagonizes mitochondrial fission factor Dnm1p, indicative of a role in mitochondrial fusion or regulating morphology; regulates filamentous growth in response to glucose depletion; activated in stochastic pulses of nuclear localization in response to low glucose [Source:SGD;Acc:S000003177])

HSP 1 Score: 56.225 bits (134), Expect = 1.282e-8
Identity = 29/70 (41.43%), Postives = 39/70 (55.71%), Query Frame = 1
Query:  709 PSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEI--CGKAFNQSGSLNRHRNTH 912
            P   TN P++ E+  +  +CD C + F      K H R HTGEKP+ C    CGK+F++S  L RH  TH
Sbjct:    2 PKKQTNFPVDNEN--RPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Yeast
Match: COM2 (Transcription factor that binds IME1 Upstream Activation Signal (UAS)ru; COM2 transcription is regulated by Haa1p, Sok2p and Zap1p transcriptional activators; may bind the IME1 promoter under all growth conditions to negatively regulate its transcription in the absence of a positive regulator that binds more effectively; repressor activity may depend on phosphorylation by PKA; C. albicans homolog (MNL1) plays a role in adaptation to stress [Source:SGD;Acc:S000000932])

HSP 1 Score: 53.5286 bits (127), Expect = 1.211e-7
Identity = 24/54 (44.44%), Postives = 33/54 (61.11%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQR-IHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            K   C++CD+ F     LK H R +H  EKP+ C IC K F++S +LN+H  TH
Sbjct:  387 KQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKTH 440          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Nematostella
Match: EDO29094 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4M0])

HSP 1 Score: 72.0182 bits (175), Expect = 4.155e-15
Identity = 41/98 (41.84%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  712 SGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            SG  NS +   S +K  KCD CDK F+ A  L+ H  IH+G KP+ C+ CGK FNQSG+L +H   H    +    Y C  C   F     L+ H KT
Sbjct:   13 SGALNSHLRIHSGQKPYKCDECDKCFSEAGSLRKHLMIHSGHKPHKCDECGKCFNQSGNLKKHLMIH----SGQKPYKCDECGKCFNQSGSLKTHAKT 106          

HSP 2 Score: 63.5438 bits (153), Expect = 3.244e-12
Identity = 32/74 (43.24%), Postives = 41/74 (55.41%), Query Frame = 1
Query:  691 TESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
             +   + +G+    +   S  K  KCD C K F  +  LK H  IH+G+KPY C+ CGK FNQSGSL  H  TH
Sbjct:   34 CDKCFSEAGSLRKHLMIHSGHKPHKCDECGKCFNQSGNLKKHLMIHSGQKPYKCDECGKCFNQSGSLKTHAKTH 107          

HSP 3 Score: 55.4546 bits (132), Expect = 1.987e-9
Identity = 24/50 (48.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            KCD C K F  +  L  H RIH+G+KPY C+ C K F+++GSL +H   H
Sbjct:    2 KCDECGKCFNQSGALNSHLRIHSGQKPYKCDECDKCFSEAGSLRKHLMIH 51          

HSP 4 Score: 49.2914 bits (116), Expect = 3.337e-7
Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            G +  KC +CDK F+   +LR H   HSG +P+ C+ C K F+Q+G LK+H
Sbjct:   25 GQKPYKCDECDKCFSEAGSLRKHLMIHSGHKPHKCDECGKCFNQSGNLKKH 75          

HSP 5 Score: 48.9062 bits (115), Expect = 3.937e-7
Identity = 22/46 (47.83%), Postives = 30/46 (65.22%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            KC +C K F    AL  H R HSG++PY C+ C K FS+ G+L++H
Sbjct:    2 KCDECGKCFNQSGALNSHLRIHSGQKPYKCDECDKCFSEAGSLRKH 47          

HSP 6 Score: 45.4394 bits (106), Expect = 6.789e-6
Identity = 22/51 (43.14%), Postives = 31/51 (60.78%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            G +  KC +C K F     L+ H   HSG++PY C+ C K F+Q+G+LK H
Sbjct:   53 GHKPHKCDECGKCFNQSGNLKKHLMIHSGQKPYKCDECGKCFNQSGSLKTH 103          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Nematostella
Match: EDO48956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI19])

HSP 1 Score: 72.4034 bits (176), Expect = 2.831e-14
Identity = 50/142 (35.21%), Postives = 70/142 (49.30%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDN--FKFNYPG--YNLNNDIKSDALTPTG 1176
            KC+ C K FTL   L+ H  +HTGEKPY C +CG+AF+Q GSL  H  TH         Y C+ C   F   S L +H KT H N ++ +         + N+L A+   +H+    +K    G  +   ND+K  +   TG
Sbjct:   32 KCETCGKEFTLLKHLQRHHLVHTGEKPYKCHLCGRAFSQQGSLQAHSRTH----TGIKPYKCQICGRAFALQSPLMSHMKT-HSNEKNFKCETCGKAFTHRNTL-ARHQLIHSGTRPYKCEECGKTFTQTNDLKRHSRIHTG 167          

HSP 2 Score: 59.3066 bits (142), Expect = 8.134e-10
Identity = 33/81 (40.74%), Postives = 41/81 (50.62%), Query Frame = 1
Query:  727 SPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            S ++  S +K  KC+ C K FT  N L  HQ IH+G +PY CE CGK F Q+  L RH   H         Y C  C+  F
Sbjct:  104 SHMKTHSNEKNFKCETCGKAFTHRNTLARHQLIHSGTRPYKCEECGKTFTQTNDLKRHSRIH----TGIRPYKCHVCSKSF 180          

HSP 3 Score: 56.9954 bits (136), Expect = 5.170e-9
Identity = 30/69 (43.48%), Postives = 37/69 (53.62%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            KC+ C KTFT  N LK H RIHTG +PY C +C K+F    +L  H  TH      +  Y+C  C   F
Sbjct:  144 KCEECGKTFTQTNDLKRHSRIHTGIRPYKCHVCSKSFTVEFTLVCHLRTH----TGERPYVCDHCGKTF 208          

HSP 4 Score: 52.373 bits (124), Expect = 2.215e-7
Identity = 22/39 (56.41%), Postives = 26/39 (66.67%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQ 879
            KC  C K+FT+   L  H R HTGE+PYVC+ CGK F Q
Sbjct:  172 KCHVCSKSFTVEFTLVCHLRTHTGERPYVCDHCGKTFTQ 210          

HSP 5 Score: 49.6766 bits (117), Expect = 1.436e-6
Identity = 21/46 (45.65%), Postives = 29/46 (63.04%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            KC  C K+FT    L+ H+  H+GE+PY C  C + FSQ G+L+ H
Sbjct:   32 KCETCGKEFTLLKHLQRHHLVHTGEKPYKCHLCGRAFSQQGSLQAH 77          

HSP 6 Score: 49.6766 bits (117), Expect = 1.491e-6
Identity = 22/39 (56.41%), Postives = 25/39 (64.10%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQ 2292
            KC  C K FT E  L  H R H+GERPY C+ C KTF+Q
Sbjct:  172 KCHVCSKSFTVEFTLVCHLRTHTGERPYVCDHCGKTFTQ 210          

HSP 7 Score: 48.521 bits (114), Expect = 4.134e-6
Identity = 25/46 (54.35%), Postives = 27/46 (58.70%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            KC  C K FT  + L  H   HSG RPY CE C KTF+Q   LKRH
Sbjct:  116 KCETCGKAFTHRNTLARHQLIHSGTRPYKCEECGKTFTQTNDLKRH 161          

HSP 8 Score: 47.7506 bits (112), Expect = 6.878e-6
Identity = 29/84 (34.52%), Postives = 34/84 (40.48%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            K  KC  CDK F     L+ H  IH   K + CE CGK F     L RH   H      +  Y C  C   F     L+ H +T
Sbjct:    1 KKFKCPTCDKAFIRNYTLQCHMLIHKNVKEHKCETCGKEFTLLKHLQRHHLVH----TGEKPYKCHLCGRAFSQQGSLQAHSRT 80          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Nematostella
Match: EDO31301 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYA3])

HSP 1 Score: 70.4774 bits (171), Expect = 8.428e-14
Identity = 37/104 (35.58%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  685 QSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            +  E   +  G+    I   +  K  KC+ CD+ FT  +  K H R+HTG++PY CE CGK FN   +  RH N H+     +  Y C  C+ KF   + L+NH
Sbjct:   75 EYCEKVFSDFGSHKRHIRLHTGYKPFKCEQCDREFTRLDSYKNHIRLHTGDRPYKCETCGKQFNYLTTYKRHLNIHK----GEKPYACNLCDKKFTRQNYLKNH 174          

HSP 2 Score: 60.4622 bits (145), Expect = 1.951e-10
Identity = 28/68 (41.18%), Postives = 37/68 (54.41%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            C++C K F  +  LK H R+HTGE+PY CE+CG  F   G L RH  TH      +  + C +C   F
Sbjct:   18 CEHCGKRFNKSYNLKTHLRVHTGERPYQCEVCGHGFANLGDLKRHSRTH----TGEKPFKCEYCEKVF 81          

HSP 3 Score: 48.9062 bits (115), Expect = 1.835e-6
Identity = 23/50 (46.00%), Postives = 26/50 (52.00%), Query Frame = 1
Query:  763 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            KC+ C K F      K H  IH GEKPY C +C K F +   L  H NTH
Sbjct:  129 KCETCGKQFNYLTTYKRHLNIHKGEKPYACNLCDKKFTRQNYLKNHLNTH 178          

HSP 4 Score: 48.1358 bits (113), Expect = 2.995e-6
Identity = 23/51 (45.10%), Postives = 28/51 (54.90%), Query Frame = 1
Query: 2161 GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            G +   C  C K+F     L+ H R H+GERPY CE C   F+  G LKRH
Sbjct:   12 GGKSYTCEHCGKRFNKSYNLKTHLRVHTGERPYQCEVCGHGFANLGDLKRH 62          

HSP 5 Score: 47.3654 bits (111), Expect = 6.124e-6
Identity = 22/46 (47.83%), Postives = 29/46 (63.04%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            KC  CD++FT   + + H R H+G+RPY CE C K F+   T KRH
Sbjct:  101 KCEQCDREFTRLDSYKNHIRLHTGDRPYKCETCGKQFNYLTTYKRH 146          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Nematostella
Match: EDO46374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQI8])

HSP 1 Score: 72.4034 bits (176), Expect = 1.081e-13
Identity = 37/82 (45.12%), Postives = 50/82 (60.98%), Query Frame = 1
Query:  760 LKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            + CD C K+F+ +N L  H+RIHTG+KP+ C+ CG+AF Q G+L RH+ TH     T   Y+C  CN  F   S L  H +T
Sbjct:    1 MTCDVCLKSFSRSNTLITHKRIHTGDKPFNCDQCGRAFRQPGNLTRHKLTH----TTVKPYVCPQCNKAFNRASNLHTHMRT 78          

HSP 2 Score: 60.8474 bits (146), Expect = 6.845e-10
Identity = 31/93 (33.33%), Postives = 47/93 (50.54%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            +   +  ++ KC  C K F     L+ H   HTGE+P+ CEICGK F  + +LN H+ TH    A    + C+ C   F   + L+ H  ++H
Sbjct:  189 MRTHAETRLYKCTICGKGFNQKGNLQAHIYGHTGERPFKCEICGKGFTLASTLNTHKRTH----AMKKPFECQVCGKSFYQKNALKTHYISSH 277          

HSP 3 Score: 56.6102 bits (135), Expect = 1.769e-8
Identity = 24/62 (38.71%), Postives = 37/62 (59.68%), Query Frame = 1
Query:  715 GTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRH 900
            G   + I   + ++  KC+ C K FTLA+ L  H+R H  +KP+ C++CGK+F Q  +L  H
Sbjct:  211 GNLQAHIYGHTGERPFKCEICGKGFTLASTLNTHKRTHAMKKPFECQVCGKSFYQKNALKTH 272          

HSP 4 Score: 50.0618 bits (118), Expect = 2.641e-6
Identity = 27/88 (30.68%), Postives = 41/88 (46.59%), Query Frame = 1
Query:  649 ELNIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
             ++    P + +Q   +   P   T   +   + K  + C  C+K F  A+ L  H R HT  KP+VC+ C K F+Q   +  HR TH
Sbjct:   21 RIHTGDKPFNCDQCGRAFRQPGNLTRHKLTHTTVKPYV-CPQCNKAFNRASNLHTHMRTHTNYKPFVCDFCKKGFHQKIDMKIHRYTH 107          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Nematostella
Match: EDO35006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP5])

HSP 1 Score: 72.4034 bits (176), Expect = 3.615e-13
Identity = 38/85 (44.71%), Postives = 51/85 (60.00%), Query Frame = 1
Query:  748 TKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +K  L C  CDKTF  ++ L +H R+HTGEKP+ C+ CGKAF  SG+L  H  TH      +  Y C +C+  F H S L+NH +
Sbjct:  189 SKPTLTCPKCDKTFIHSHGLNLHLRVHTGEKPFTCKHCGKAFAHSGNLTVHLRTH----TGEKPYQCEYCHQAFNHSSNLKNHMR 269          

HSP 2 Score: 67.3958 bits (163), Expect = 1.327e-11
Identity = 57/209 (27.27%), Postives = 84/209 (40.19%), Query Frame = 1
Query:  724 NSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNL--HND----NFKFNYPGYNLNNDIKSDALTPTGNDDVDVKTDSSGI-----IKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHL 1317
            N  +   + +K   C +C K F  +  L VH R HTGEKPY CE C +AFN S +L  H   H      +  Y CR C+  F   S L NH  +    +           D +   LD  + +L  HND      +F    + + + +     T TG      +  S        +K H +   + E  + CP C++      DL  H+
Sbjct:  209 NLHLRVHTGEKPFTCKHCGKAFAHSGNLTVHLRTHTGEKPYQCEYCHQAFNHSSNLKNHMRLH----TGEKPYKCRACDRTFSRSSHLRNHVISHSLGKTETPMHRCEVCDKSFPELDLLTEHLKTHNDMRPHQCRFCGKAFTVPSGLAVHLRTHTGEKPYRCEYCSRAFSHSSNLKVH-VRTHTGEKPYNCPTCKITFARSSDLRRHV 412          

HSP 3 Score: 64.3142 bits (155), Expect = 1.363e-10
Identity = 35/101 (34.65%), Postives = 50/101 (49.50%), Query Frame = 1
Query:  703 IAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
             A SG     +   + +K  +C+YC + F  ++ LK H R+HTGEKPY C  C + F++S  L  H  +H         + C  C+  FP   LL  H KT
Sbjct:  230 FAHSGNLTVHLRTHTGEKPYQCEYCHQAFNHSSNLKNHMRLHTGEKPYKCRACDRTFSRSSHLRNHVISHSLGKTETPMHRCEVCDKSFPELDLLTEHLKT 330          

HSP 4 Score: 60.8474 bits (146), Expect = 1.571e-9
Identity = 41/129 (31.78%), Postives = 56/129 (43.41%), Query Frame = 1
Query:  610 PMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            PM        S PEL++     +++  T + + P                 +C +C K FT+ + L VH R HTGEKPY CE C +AF+ S +L  H  TH      +  Y C  C   F   S L  H
Sbjct:  307 PMHRCEVCDKSFPELDLL----TEHLKTHNDMRPH----------------QCRFCGKAFTVPSGLAVHLRTHTGEKPYRCEYCSRAFSHSSNLKVHVRTH----TGEKPYNCPTCKITFARSSDLRRH 411          

HSP 5 Score: 52.7582 bits (125), Expect = 5.304e-7
Identity = 23/46 (50.00%), Postives = 30/46 (65.22%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            +C  C K FT  S L +H R H+GE+PY CE+CS+ FS +  LK H
Sbjct:  338 QCRFCGKAFTVPSGLAVHLRTHTGEKPYRCEYCSRAFSHSSNLKVH 383          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Medaka
Match: ENSORLT00000038984.1 (pep primary_assembly:ASM223467v1:19:1011628:1015115:-1 gene:ENSORLG00000022350.1 transcript:ENSORLT00000038984.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 8.966e-15
Identity = 46/108 (42.59%), Postives = 61/108 (56.48%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSL 1074
            +K LKC+ C KTF  A  L+ H RIH+GE+P+ CE+CGK+F Q+G L  HR  H      +  + CR C   F   S L +H +T H   R     + + T NNANSL
Sbjct:  311 QKPLKCEQCPKTFRHAVNLRNHLRIHSGERPFACELCGKSFRQAGQLKIHRRVH----TGERPFSCRECGKSFTQQSSLISHGRT-HSTERPFACSSCNKTFNNANSL 413          

HSP 2 Score: 69.707 bits (169), Expect = 8.756e-12
Identity = 32/75 (42.67%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            ST++   C  C+KTF  AN LK+H R+HTGEKPY C++C K+F+Q   L  H+   R+  +    YIC  C  ++
Sbjct:  393 STERPFACSSCNKTFNNANSLKLHVRVHTGEKPYACDLCDKSFSQGSHLRTHQ---RHVHSGGKQYICDRCGKRY 464          

HSP 3 Score: 67.781 bits (164), Expect = 3.846e-11
Identity = 33/87 (37.93%), Postives = 50/87 (57.47%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            S ++   C+ C K+F  A  LK+H+R+HTGE+P+ C  CGK+F Q  SL  H  TH    +T+  + C  CN  F + + L+ H + 
Sbjct:  337 SGERPFACELCGKSFRQAGQLKIHRRVHTGERPFSCRECGKSFTQQSSLISHGRTH----STERPFACSSCNKTFNNANSLKLHVRV 419          

HSP 4 Score: 60.077 bits (144), Expect = 8.269e-9
Identity = 43/152 (28.29%), Postives = 68/152 (44.74%), Query Frame = 1
Query:  556 HNTD--QNLPNQDIEDNSLK-PMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEE--ESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            H TD        D+E+ +++ P     T       +++AA      ++  SP  P+  +++P +         L C  C K+F   + LK H  IHTGEKP+ C +CG+AF Q  S+  H  TH    + +  + C  C   F     L+ H
Sbjct:  104 HQTDNAGKASQADVEEGAMEAPFVPAVTVKDKRGTIDLAAIAE---RAASSPQPPAHESSNPQDSNVHEAWSTLSCSVCGKSFATQSNLKSHFLIHTGEKPFACSVCGRAFRQRHSMQSHMCTH----SGERPFQCSDCGKSFYKKWRLKMH 248          

HSP 5 Score: 56.9954 bits (136), Expect = 7.766e-8
Identity = 29/82 (35.37%), Postives = 39/82 (47.56%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            C  C K+FT  + L  H R H+ E+P+ C  C K FN + SL  H   H      +  Y C  C+  F  GS L  H++  H
Sbjct:  372 CRECGKSFTQQSSLISHGRTHSTERPFACSSCNKTFNNANSLKLHVRVH----TGEKPYACDLCDKSFSQGSHLRTHQRHVH 449          

HSP 6 Score: 55.8398 bits (133), Expect = 2.043e-7
Identity = 26/46 (56.52%), Postives = 28/46 (60.87%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            KC  C K F     LR H R HSGERP+ACE C K+F Q G LK H
Sbjct:  315 KCEQCPKTFRHAVNLRNHLRIHSGERPFACELCGKSFRQAGQLKIH 360          

HSP 7 Score: 55.4546 bits (132), Expect = 2.208e-7
Identity = 29/85 (34.12%), Postives = 43/85 (50.59%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHE 999
            S ++  +C  C K+F     LK+H   HTGEKP+ C++CG+ FN   +L+RH   H      +  +IC  C   F     L  H+
Sbjct:  225 SGERPFQCSDCGKSFYKKWRLKMHAISHTGEKPHSCDVCGRRFNLLQNLHRHALMH----TGEKLFICSECGKGFTRAVTLRTHQ 305          

HSP 8 Score: 53.1434 bits (126), Expect = 1.209e-6
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 1
Query: 2089 PTSSGHTTQSSSNKTTDIFFSRKGGSER-RKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            P S     +S + +++ I   R   +ER   C  C+K F   ++L++H R H+GE+PYAC+ C K+FSQ   L+ H
Sbjct:  369 PFSCRECGKSFTQQSSLISHGRTHSTERPFACSSCNKTFNNANSLKLHVRVHTGEKPYACDLCDKSFSQGSHLRTH 444          

HSP 9 Score: 51.6026 bits (122), Expect = 3.740e-6
Identity = 27/77 (35.06%), Postives = 36/77 (46.75%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            CD C + F L   L  H  +HTGEK ++C  CGK F ++ +L     TH++         C  C   F H   L NH
Sbjct:  260 CDVCGRRFNLLQNLHRHALMHTGEKLFICSECGKGFTRAVTL----RTHQFIHTGQKPLKCEQCPKTFRHAVNLRNH 332          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Medaka
Match: ENSORLT00000029076.1 (pep primary_assembly:ASM223467v1:19:1011628:1029001:-1 gene:ENSORLG00000022350.1 transcript:ENSORLT00000029076.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 8.966e-15
Identity = 46/108 (42.59%), Postives = 61/108 (56.48%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSL 1074
            +K LKC+ C KTF  A  L+ H RIH+GE+P+ CE+CGK+F Q+G L  HR  H      +  + CR C   F   S L +H +T H   R     + + T NNANSL
Sbjct:  311 QKPLKCEQCPKTFRHAVNLRNHLRIHSGERPFACELCGKSFRQAGQLKIHRRVH----TGERPFSCRECGKSFTQQSSLISHGRT-HSTERPFACSSCNKTFNNANSL 413          

HSP 2 Score: 69.707 bits (169), Expect = 8.756e-12
Identity = 32/75 (42.67%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKF 969
            ST++   C  C+KTF  AN LK+H R+HTGEKPY C++C K+F+Q   L  H+   R+  +    YIC  C  ++
Sbjct:  393 STERPFACSSCNKTFNNANSLKLHVRVHTGEKPYACDLCDKSFSQGSHLRTHQ---RHVHSGGKQYICDRCGKRY 464          

HSP 3 Score: 67.781 bits (164), Expect = 3.846e-11
Identity = 33/87 (37.93%), Postives = 50/87 (57.47%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            S ++   C+ C K+F  A  LK+H+R+HTGE+P+ C  CGK+F Q  SL  H  TH    +T+  + C  CN  F + + L+ H + 
Sbjct:  337 SGERPFACELCGKSFRQAGQLKIHRRVHTGERPFSCRECGKSFTQQSSLISHGRTH----STERPFACSSCNKTFNNANSLKLHVRV 419          

HSP 4 Score: 60.077 bits (144), Expect = 8.269e-9
Identity = 43/152 (28.29%), Postives = 68/152 (44.74%), Query Frame = 1
Query:  556 HNTD--QNLPNQDIEDNSLK-PMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEE--ESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            H TD        D+E+ +++ P     T       +++AA      ++  SP  P+  +++P +         L C  C K+F   + LK H  IHTGEKP+ C +CG+AF Q  S+  H  TH    + +  + C  C   F     L+ H
Sbjct:  104 HQTDNAGKASQADVEEGAMEAPFVPAVTVKDKRGTIDLAAIAE---RAASSPQPPAHESSNPQDSNVHEAWSTLSCSVCGKSFATQSNLKSHFLIHTGEKPFACSVCGRAFRQRHSMQSHMCTH----SGERPFQCSDCGKSFYKKWRLKMH 248          

HSP 5 Score: 56.9954 bits (136), Expect = 7.766e-8
Identity = 29/82 (35.37%), Postives = 39/82 (47.56%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAH 1011
            C  C K+FT  + L  H R H+ E+P+ C  C K FN + SL  H   H      +  Y C  C+  F  GS L  H++  H
Sbjct:  372 CRECGKSFTQQSSLISHGRTHSTERPFACSSCNKTFNNANSLKLHVRVH----TGEKPYACDLCDKSFSQGSHLRTHQRHVH 449          

HSP 6 Score: 55.8398 bits (133), Expect = 2.043e-7
Identity = 26/46 (56.52%), Postives = 28/46 (60.87%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            KC  C K F     LR H R HSGERP+ACE C K+F Q G LK H
Sbjct:  315 KCEQCPKTFRHAVNLRNHLRIHSGERPFACELCGKSFRQAGQLKIH 360          

HSP 7 Score: 55.4546 bits (132), Expect = 2.208e-7
Identity = 29/85 (34.12%), Postives = 43/85 (50.59%), Query Frame = 1
Query:  745 STKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHE 999
            S ++  +C  C K+F     LK+H   HTGEKP+ C++CG+ FN   +L+RH   H      +  +IC  C   F     L  H+
Sbjct:  225 SGERPFQCSDCGKSFYKKWRLKMHAISHTGEKPHSCDVCGRRFNLLQNLHRHALMH----TGEKLFICSECGKGFTRAVTLRTHQ 305          

HSP 8 Score: 53.1434 bits (126), Expect = 1.209e-6
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 1
Query: 2089 PTSSGHTTQSSSNKTTDIFFSRKGGSER-RKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            P S     +S + +++ I   R   +ER   C  C+K F   ++L++H R H+GE+PYAC+ C K+FSQ   L+ H
Sbjct:  369 PFSCRECGKSFTQQSSLISHGRTHSTERPFACSSCNKTFNNANSLKLHVRVHTGEKPYACDLCDKSFSQGSHLRTH 444          

HSP 9 Score: 51.6026 bits (122), Expect = 3.740e-6
Identity = 27/77 (35.06%), Postives = 36/77 (46.75%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENH 996
            CD C + F L   L  H  +HTGEK ++C  CGK F ++ +L     TH++         C  C   F H   L NH
Sbjct:  260 CDVCGRRFNLLQNLHRHALMHTGEKLFICSECGKGFTRAVTL----RTHQFIHTGQKPLKCEQCPKTFRHAVNLRNH 332          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Medaka
Match: ENSORLT00000008836.2 (pep primary_assembly:ASM223467v1:17:11395122:11396276:-1 gene:ENSORLG00000007032.2 transcript:ENSORLT00000008836.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 1.634e-14
Identity = 57/222 (25.68%), Postives = 85/222 (38.29%), Query Frame = 1
Query:  694 ESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHND------NFKFNYPGYNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSILG----GSNESGFTCPYCQLGLNDIRDLGVHLSQHN 1329
            E     S   N  +   + ++   C  C+K+F   + LKVH R HTGE+P+ CE+CGK+F QS  L  H  TH      +  Y C+ C   F     L+ H +T        RP +         S+     ++           K     ++ ++D+K    T TG      +      I+  S+       + E  F C  CQ        L VHL  H 
Sbjct:   81 EKSFVQSTALNVHMRTHTGERPFTCKVCEKSFITNSDLKVHLRTHTGERPFTCEVCGKSFTQSSDLKVHMRTH----TGEKPYSCKVCGKSFSQSCKLKTHMRT----HTGERPYSCEVCGKGFPSISELKIHMRTHTGEKPFTCKICEKLFSTSSDLKIHTRTHTGEKPFSCEICKKAFIQARSLTDHMRTHTGEKPFICRVCQKRFMHRAALNVHLRTHT 294          

HSP 2 Score: 70.8626 bits (172), Expect = 2.572e-12
Identity = 53/193 (27.46%), Postives = 78/193 (40.41%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPGYNLNNDIKSDALTPTGNDDVDVKT-----DSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQHN 1329
            CD C K +T  + LK H RIHTGE+PY C++C K+F QS +LN H  TH      +  + C+ C   F   S L+ H +T        RP        +                      +  ++D+K    T TG      K        S  +K H +   + E  ++C  C  G   I +L +H+  H 
Sbjct:   49 CDTCGKVYTRRSNLKTHMRIHTGERPYSCKVCEKSFVQSTALNVHMRTH----TGERPFTCKVCEKSFITNSDLKVHLRT----HTGERPFTCEVCGKS----------------------FTQSSDLKVHMRTHTGEKPYSCKVCGKSFSQSCKLKTH-MRTHTGERPYSCEVCGKGFPSISELKIHMRTHT 210          

HSP 3 Score: 59.3066 bits (142), Expect = 1.039e-8
Identity = 30/80 (37.50%), Postives = 42/80 (52.50%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C+ C K+F   + LK H R HTGE+P++C +C K F +S  L  H  TH      +  + C  C   FP  S L+ H +T
Sbjct:  301 CEVCQKSFISTSDLKSHMRTHTGERPFLCTVCEKTFIKSSHLKVHIRTH----TGERPFCCEVCVKSFPTRSELKVHMRT 376          

HSP 4 Score: 57.3806 bits (137), Expect = 4.749e-8
Identity = 29/80 (36.25%), Postives = 39/80 (48.75%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K F     L VH R HTGE+P+ CE+C K+F  +  L  H  TH      +  ++C  C   F   S L+ H +T
Sbjct:  273 CRVCQKRFMHRAALNVHLRTHTGERPFTCEVCQKSFISTSDLKSHMRTH----TGERPFLCTVCEKTFIKSSHLKVHIRT 348          

HSP 5 Score: 56.6102 bits (135), Expect = 9.166e-8
Identity = 24/49 (48.98%), Postives = 31/49 (63.27%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            C  C+KTF  ++ LKVH R HTGE+P+ CE+C K+F     L  H  TH
Sbjct:  329 CTVCEKTFIKSSHLKVHIRTHTGERPFCCEVCVKSFPTRSELKVHMRTH 377          

HSP 6 Score: 53.9138 bits (128), Expect = 6.232e-7
Identity = 23/45 (51.11%), Postives = 31/45 (68.89%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            C  C K FT  S L++H R H+GE+PY+C+ C K+FSQ+  LK H
Sbjct:  133 CEVCGKSFTQSSDLKVHMRTHTGEKPYSCKVCGKSFSQSCKLKTH 177          

HSP 7 Score: 53.5286 bits (127), Expect = 7.230e-7
Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            C  C+K F   S L++H R H+GERP+ CE C K+F+Q+  LK H
Sbjct:  105 CKVCEKSFITNSDLKVHLRTHTGERPFTCEVCGKSFTQSSDLKVH 149          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Medaka
Match: ENSORLT00000008835.2 (pep primary_assembly:ASM223467v1:17:11029088:11029897:1 gene:ENSORLG00000030655.1 transcript:ENSORLT00000008835.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 2.776e-14
Identity = 38/91 (41.76%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  733 IEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            + + + +K   C+ C K+FT ++ L VH R HTGEKP+ CEICGK+FN+SGSL  H  TH      +  + C+ C   F   S L  H +T
Sbjct:  149 MRKHTGEKPFTCEMCGKSFTQSSRLVVHMRGHTGEKPFNCEICGKSFNRSGSLTAHLRTH----TGERPFSCKMCEKGFTQSSNLAAHMRT 235          

HSP 2 Score: 62.3882 bits (150), Expect = 5.533e-10
Identity = 30/79 (37.97%), Postives = 38/79 (48.10%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            C+ C K FT    L  H RIHTGE+PY C+ CGK++ Q G L  H   H      +  + C  C   F   S L  H +
Sbjct:  104 CETCGKVFTRRGSLITHMRIHTGERPYSCKTCGKSYIQRGDLTVHMRKH----TGEKPFTCEMCGKSFTQSSRLVVHMR 178          

HSP 3 Score: 57.7658 bits (138), Expect = 1.660e-8
Identity = 30/80 (37.50%), Postives = 38/80 (47.50%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            C  C K++     L VH R HTGEKP+ CE+CGK+F QS  L  H   H      +  + C  C   F     L  H +T
Sbjct:  132 CKTCGKSYIQRGDLTVHMRKHTGEKPFTCEMCGKSFTQSSRLVVHMRGH----TGEKPFNCEICGKSFNRSGSLTAHLRT 207          

HSP 4 Score: 57.7658 bits (138), Expect = 1.836e-8
Identity = 25/67 (37.31%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  712 SGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH 912
            SG+  + +   + ++   C  C+K FT ++ L  H R HTGE+P+ C++C K+F   GSL  H  TH
Sbjct:  198 SGSLTAHLRTHTGERPFSCKMCEKGFTQSSNLAAHMRTHTGERPFSCDLCPKSFKLRGSLTAHMRTH 264          

HSP 5 Score: 53.9138 bits (128), Expect = 2.748e-7
Identity = 29/85 (34.12%), Postives = 41/85 (48.24%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            +K   C+ C K+F  +  L  H R HTGE+P+ C++C K F QS +L  H  TH      +  + C  C   F     L  H +T
Sbjct:  183 EKPFNCEICGKSFNRSGSLTAHLRTHTGERPFSCKMCEKGFTQSSNLAAHMRTH----TGERPFSCDLCPKSFKLRGSLTAHMRT 263          

HSP 6 Score: 50.447 bits (119), Expect = 4.121e-6
Identity = 21/45 (46.67%), Postives = 30/45 (66.67%), Query Frame = 1
Query: 2179 CPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            C  C K FT  S L +H R H+GE+P+ CE C K+F+++G+L  H
Sbjct:  160 CEMCGKSFTQSSRLVVHMRGHTGEKPFNCEICGKSFNRSGSLTAH 204          

HSP 7 Score: 50.0618 bits (118), Expect = 5.354e-6
Identity = 26/77 (33.77%), Postives = 38/77 (49.35%), Query Frame = 1
Query: 2113 QSSSNKTTDIFFSRKG----------GSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            +S S +T    F+R+G          G     C  C K +     L +H RKH+GE+P+ CE C K+F+Q+  L  H
Sbjct:  100 RSHSCETCGKVFTRRGSLITHMRIHTGERPYSCKTCGKSYIQRGDLTVHMRKHTGEKPFTCEMCGKSFTQSSRLVVH 176          
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Medaka
Match: ENSORLT00000034581.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:110015849])

HSP 1 Score: 77.7962 bits (190), Expect = 3.092e-14
Identity = 35/83 (42.17%), Postives = 48/83 (57.83%), Query Frame = 1
Query:  754 KILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +I  C+ C K FT++  L VH+RIHTGEKPY C +C K+F Q G+L+ H   H      +  +IC  C  +F     LE HE+
Sbjct:  465 RIYPCEVCGKKFTMSQHLDVHKRIHTGEKPYTCRVCNKSFRQIGNLDSHMRIH----TGEKPFICSLCGKRFRQKISLETHER 543          

HSP 2 Score: 65.4698 bits (158), Expect = 2.283e-10
Identity = 44/142 (30.99%), Postives = 61/142 (42.96%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHN-----DNFKFNYPGYNLNNDIKSDALTPTG 1176
            C  C+K+F     L  H RIHTGEKP++C +CGK F Q  SL  H   H+   A    +IC+ C+  F     L+ H  T H   +  R      +     SLD+    +HN             G     ++  D + PTG
Sbjct:  497 CRVCNKSFRQIGNLDSHMRIHTGEKPFICSLCGKRFRQKISLETHERFHKKEKA----FICQLCSKGFVQKIDLKRHMLT-HTGEKPFRCEVCGKSYQEKRSLDS-HMKVHNGEPTSKGISVAPGGTRPQEEVHPDFIHPTG 632          

HSP 3 Score: 63.929 bits (154), Expect = 6.275e-10
Identity = 34/91 (37.36%), Postives = 48/91 (52.75%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPR 1038
            C+ C   F     +++H R HTG+KP+ C+ CGK F + GSL RH   H    A +  YIC FC   F   ++L+ H K+       G+PR
Sbjct:  386 CEICGVNF---RDMEIHMRTHTGQKPFRCKDCGKEFPRKGSLERHMRLH----AGERPYICEFCGKTFIENTVLKRHIKS----HTGGKPR 465          

HSP 4 Score: 62.003 bits (149), Expect = 3.114e-9
Identity = 26/46 (56.52%), Postives = 32/46 (69.57%), Query Frame = 1
Query: 2176 KCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 2313
            +C DC K+F  + +L  H R H+GERPY CEFC KTF +N  LKRH
Sbjct:  410 RCKDCGKEFPRKGSLERHMRLHAGERPYICEFCGKTFIENTVLKRH 455          

HSP 5 Score: 61.2326 bits (147), Expect = 4.779e-9
Identity = 30/84 (35.71%), Postives = 42/84 (50.00%), Query Frame = 1
Query:  751 KKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            +K  +C  C K F     L+ H R+H GE+PY+CE CGK F ++  L RH  +H         Y C  C  KF     L+ H++
Sbjct:  406 QKPFRCKDCGKEFPRKGSLERHMRLHAGERPYICEFCGKTFIENTVLKRHIKSH--TGGKPRIYPCEVCGKKFTMSQHLDVHKR 487          

HSP 6 Score: 55.0694 bits (131), Expect = 3.359e-7
Identity = 53/211 (25.12%), Postives = 84/211 (39.81%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTH----------------------RYRDATDSN--YICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPGYNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQH 1326
            C+ C K F      + H R+HTGEKP+ C  C K FNQ G++  H  TH                      R+  A +    + C  C+  F   + L  H ++  HN+ + R +    +   ++S     N+ HN   K N   +   +    D L     +    + DS   ++ H  L    E+   C  C  G+N  RD+ +H+  H
Sbjct:  207 CNICGKKFPSIRAQETHMRLHTGEKPFNCRFCHKGFNQKGNMVTHMKTHTAEKLFACTVCDEESSHSSSSERHMKAHEEQMPFSCTVCDEGFQTSAELRRHVQS--HNQPTKRAKRRKPSLTPSHSCKVCGNSFHN---KGNLLRHAETHSDDPDFLCGICGE----RADSLESLQLH--LQSHRETSRVCEIC--GVN-FRDMEIHMRTH 403          

HSP 7 Score: 51.6026 bits (122), Expect = 4.180e-6
Identity = 28/97 (28.87%), Postives = 43/97 (44.33%), Query Frame = 1
Query:  715 GTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKT 1005
            G  +S +   + +K   C  C K F     L+ H+R H  EK ++C++C K F Q   L RH  TH      +  + C  C   +     L++H K 
Sbjct:  508 GNLDSHMRIHTGEKPFICSLCGKRFRQKISLETHERFHKKEKAFICQLCSKGFVQKIDLKRHMLTH----TGEKPFRCEVCGKSYQEKRSLDSHMKV 600          
BLAST of Zinc finger and BTB domain containing 41 vs. Planmine SMEST
Match: SMESG000022366.1 (SMESG000022366.1)

HSP 1 Score: 1654.03 bits (4282), Expect = 0.000e+0
Identity = 894/902 (99.11%), Postives = 897/902 (99.45%), Query Frame = 1
Query:  502 MLFDSNSNEKCFLPITYDHNTDQNLPNQDIEDNSLKPMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPGYNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIGGNLVSGSSGINSPTNPMMSKSNPLFSSESLVHQLANLSKKLKLPPTSDFNPNMGIGSVPNTSFLPISFDRLRPTEALPNMSFXXXXXXXXXXXXXXXXXXXXXAAFVLATLSKDYFFKQRPQPLQQENNFPLSNPEFLKNQTFNQKSPLFGRLGNSNHLDFYNLFNLQKPLQNLLCXXXXXXXXXXXXXXXXXXXXXXXSCVNLEMHDNNYNVITXXXXXXXXXXXXXXXXXXKNGKPINGTKKNSVPRSSPTSSGHTTQSSSNKTTDIFFSRKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRPTVLSSTKLKVIPNKPSMSKDSESAAPDVNNSTNGSTYTMTNSPPCSFGTNSLTNPQNPHLNYMINTKALATKINETINKFDHFPDNSMFQTVSSYSTGELSRKNNEQRFPFSNNIESSEEPTVGFMDLTVNCSRHSDTVSQSNDGEAPLDIDNIDETKAPTNSLRSETEQMEISNHKINRNSNFHNQYPNSQFHNQFNNVKSHVKTVNNLLCNYSTKEIXXXXXXXXXXXFCQHCSIYFENDSIFHSHIQQHSDEKDNLKCRDCKFVAKDEVAFKDHFNYIIAKRETCKE 3207
            MLFDSNSNEKCFLPITYDHNTDQNLPNQDIEDNSLKPMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPGYNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIGGNLVSGSSGINSPTNPMMSKSNPLFSSESLVHQLANLSKKLKLPPTSDFNPNMGIGSVPNTSFLPISFDRLRPTEALPNMSFPLTNNVLPNSNPSNLSDSYNLAAFVLATLSKDYFFKQRPQPLQQENNFPLSNPEFLKNQTFNQKSPLFGRLGNSNHLDFYNLFNLQKPLQNLLCNI+NNTLPNNNNN TNKPDIENNSCVNLEMHDNNYNVITMSNSRSNSSPSMFISSRIKNGKPINGTKKNSVPRSSPTSSGHTTQSSSNKTTDIFFSRKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRPTVLSSTKLKVIPNKPSMSKDSESAAPDVNNSTNGSTYTMTNSPPCSFGTNSLTNPQNPHLNYMINTKALATKINETINKFDHFPDNSMFQTVSSYSTGELSRKNNEQRFPF+NNIESSEEPT    DLTVNCSRHSDTVSQSNDGEAPLDIDNIDETKAPTNSLR+ETEQMEISNHKINRNSNFHNQYPNSQFHNQFNNVKSHVKTVNNLLCNYSTKEILQLLLKTRRLLFCQHCSIYFENDSIFHSHIQQHSDEKDNLKCRDCKFVAKDEVAFKDHFNYIIAKRETCKE
Sbjct:    1 MLFDSNSNEKCFLPITYDHNTDQNLPNQDIEDNSLKPMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPGYNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIGGNLVSGSSGINSPTNPMMSKSNPLFSSESLVHQLANLSKKLKLPPTSDFNPNMGIGSVPNTSFLPISFDRLRPTEALPNMSFPLTNNVLPNSNPSNLSDSYNLAAFVLATLSKDYFFKQRPQPLQQENNFPLSNPEFLKNQTFNQKSPLFGRLGNSNHLDFYNLFNLQKPLQNLLCNIDNNTLPNNNNNSTNKPDIENNSCVNLEMHDNNYNVITMSNSRSNSSPSMFISSRIKNGKPINGTKKNSVPRSSPTSSGHTTQSSSNKTTDIFFSRKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRPTVLSSTKLKVIPNKPSMSKDSESAAPDVNNSTNGSTYTMTNSPPCSFGTNSLTNPQNPHLNYMINTKALATKINETINKFDHFPDNSMFQTVSSYSTGELSRKNNEQRFPFTNNIESSEEPT----DLTVNCSRHSDTVSQSNDGEAPLDIDNIDETKAPTNSLRNETEQMEISNHKINRNSNFHNQYPNSQFHNQFNNVKSHVKTVNNLLCNYSTKEILQLLLKTRRLLFCQHCSIYFENDSIFHSHIQQHSDEKDNLKCRDCKFVAKDEVAFKDHFNYIIAKRETCKE 898          
BLAST of Zinc finger and BTB domain containing 41 vs. Planmine SMEST
Match: SMESG000022366.1 (SMESG000022366.1)

HSP 1 Score: 1443.71 bits (3736), Expect = 0.000e+0
Identity = 781/790 (98.86%), Postives = 785/790 (99.37%), Query Frame = 1
Query:  502 MLFDSNSNEKCFLPITYDHNTDQNLPNQDIEDNSLKPMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPGYNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIGGNLVSGSSGINSPTNPMMSKSNPLFSSESLVHQLANLSKKLKLPPTSDFNPNMGIGSVPNTSFLPISFDRLRPTEALPNMSFXXXXXXXXXXXXXXXXXXXXXAAFVLATLSKDYFFKQRPQPLQQENNFPLSNPEFLKNQTFNQKSPLFGRLGNSNHLDFYNLFNLQKPLQNLLCXXXXXXXXXXXXXXXXXXXXXXXSCVNLEMHDNNYNVITXXXXXXXXXXXXXXXXXXKNGKPINGTKKNSVPRSSPTSSGHTTQSSSNKTTDIFFSRKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRPTVLSSTKLKVIPNKPSMSKDSESAAPDVNNSTNGSTYTMTNSPPCSFGTNSLTNPQNPHLNYMINTKALATKINETINKFDHFPDNSMFQTVSSYSTGELSRKNNEQRFPFSNNIESSEEPTVGFMDLTVNCSRHSDTVSQSNDGEAPLDIDNIDETKAPTNSLRSETEQMEISNHKI 2871
            MLFDSNSNEKCFLPITYDHNTDQNLPNQDIEDNSLKPMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPGYNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIGGNLVSGSSGINSPTNPMMSKSNPLFSSESLVHQLANLSKKLKLPPTSDFNPNMGIGSVPNTSFLPISFDRLRPTEALPNMSFPLTNNVLPNSNPSNLSDSYNLAAFVLATLSKDYFFKQRPQPLQQENNFPLSNPEFLKNQTFNQKSPLFGRLGNSNHLDFYNLFNLQKPLQNLLCNI+NNTLPNNNNN TNKPDIENNSCVNLEMHDNNYNVITMSNSRSNSSPSMFISSRIKNGKPINGTKKNSVPRSSPTSSGHTTQSSSNKTTDIFFSRKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRPTVLSSTKLKVIPNKPSMSKDSESAAPDVNNSTNGSTYTMTNSPPCSFGTNSLTNPQNPHLNYMINTKALATKINETINKFDHFPDNSMFQTVSSYSTGELSRKNNEQRFPF+NNIESSEEPT    DLTVNCSRHSDTVSQSNDGEAPLDIDNIDETKAPTNSLR+ETEQMEISNHK+
Sbjct:    1 MLFDSNSNEKCFLPITYDHNTDQNLPNQDIEDNSLKPMETNSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHNDNFKFNYPGYNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSILGGSNESGFTCPYCQLGLNDIRDLGVHLSQHNIGGNLVSGSSGINSPTNPMMSKSNPLFSSESLVHQLANLSKKLKLPPTSDFNPNMGIGSVPNTSFLPISFDRLRPTEALPNMSFPLTNNVLPNSNPSNLSDSYNLAAFVLATLSKDYFFKQRPQPLQQENNFPLSNPEFLKNQTFNQKSPLFGRLGNSNHLDFYNLFNLQKPLQNLLCNIDNNTLPNNNNNSTNKPDIENNSCVNLEMHDNNYNVITMSNSRSNSSPSMFISSRIKNGKPINGTKKNSVPRSSPTSSGHTTQSSSNKTTDIFFSRKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRHHLTCKNRPTVLSSTKLKVIPNKPSMSKDSESAAPDVNNSTNGSTYTMTNSPPCSFGTNSLTNPQNPHLNYMINTKALATKINETINKFDHFPDNSMFQTVSSYSTGELSRKNNEQRFPFTNNIESSEEPT----DLTVNCSRHSDTVSQSNDGEAPLDIDNIDETKAPTNSLRNETEQMEISNHKM 786          
BLAST of Zinc finger and BTB domain containing 41 vs. Planmine SMEST
Match: SMESG000011176.1 (SMESG000011176.1)

HSP 1 Score: 73.559 bits (179), Expect = 4.724e-13
Identity = 37/79 (46.84%), Postives = 48/79 (60.76%), Query Frame = 1
Query:  766 CDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEK 1002
            C+YC K F   + L VH+R HTGEKPY C++C  A  QS  L RH  TH  R+   S++ C++CNT F   S LE H +
Sbjct:  468 CEYCGKIFKNCSNLTVHRRSHTGEKPYKCKLCNYACAQSSKLTRHMKTHG-REGKSSHF-CKYCNTPFIVPSTLEKHMR 544          
BLAST of Zinc finger and BTB domain containing 41 vs. Planmine SMEST
Match: SMESG000029867.1 (SMESG000029867.1)

HSP 1 Score: 70.0922 bits (170), Expect = 4.092e-12
Identity = 45/125 (36.00%), Postives = 64/125 (51.20%), Query Frame = 1
Query:  727 SPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTA---HHNRRSGRPRNLSTTDNNANSLDAKSNN 1092
            S IE+E  K+   C++C K F   + L VH+R HTGEKPY C +C  A  QS  L RH  TH  R+   S + C++C T F   + LE H +       NR  G      ++  +  S D++ +N
Sbjct:  306 SEIEKE--KRQDTCEFCGKVFRNCSNLTVHRRSHTGEKPYRCHLCQYACAQSSKLTRHMKTHG-REGCRSMH-CKYCGTPFIVATTLEKHMRKCCLRESNRFLGNSFGTGSSGESEISCDSRMDN 426          
BLAST of Zinc finger and BTB domain containing 41 vs. Planmine SMEST
Match: SMESG000015209.1 (SMESG000015209.1)

HSP 1 Score: 70.4774 bits (171), Expect = 5.985e-12
Identity = 45/164 (27.44%), Postives = 76/164 (46.34%), Query Frame = 1
Query:  580 NQDIEDNSLKPMET-----------------NSTSPPSLPELNIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICRFCNTKFPHGSLLENHEKTAHHNR 1020
            N++IE NSLK  ET                 +ST    +  LNI +S N+  +  +  +  +    +       ++  KC YC K F  ++ +  H+  H+ E+ YVC+ICGKAF +   LN H++TH+     +  + C FC+  +     L+ H +  H  +
Sbjct:   28 NEEIETNSLKNNETVKVEYMTYSNYNELPPNSSTINKEIDNLNIFSSENNYIKVAKGSLITNYNRQNDAGNSRRRQTFKCPYCPKVFCNSSAIAKHKLTHSDERKYVCDICGKAFKRQDHLNGHKHTHK----VNKPHACHFCDRSYSDARSLKRHYENQHQKQ 187          
The following BLAST results are available for this feature:
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF5962.107e-1650.00zinc finger protein 596 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5962.107e-1650.00zinc finger protein 596 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5962.107e-1650.00zinc finger protein 596 [Source:HGNC Symbol;Acc:HG... [more]
ZNF4201.971e-1545.57zinc finger protein 420 [Source:HGNC Symbol;Acc:HG... [more]
ZNF7684.023e-1527.55zinc finger protein 768 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mnm-27.574e-2035.50Zinc finger protein mnm-2 [Source:UniProtKB/Swiss... [more]
Y55F3AM.143.785e-1442.86pep chromosome:WBcel235:IV:1058845:1063187:-1 gene... [more]
Y55F3AM.143.785e-1442.86pep chromosome:WBcel235:IV:1058695:1067525:-1 gene... [more]
che-17.950e-1442.05Transcription factor che-1 [Source:UniProtKB/Swis... [more]
che-11.468e-1342.05Transcription factor che-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG96503.704e-1444.44gene:FBgn0029939 transcript:FBtr0339815[more]
CG96504.267e-1444.44gene:FBgn0029939 transcript:FBtr0301240[more]
CG96504.411e-1444.44gene:FBgn0029939 transcript:FBtr0309030[more]
CG96504.611e-1444.44gene:FBgn0029939 transcript:FBtr0474235[more]
CG96504.706e-1444.44gene:FBgn0029939 transcript:FBtr0474234[more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-182i3.84.846e-1529.81si:dkey-182i3.8 [Source:ZFIN;Acc:ZDB-GENE-030131-4... [more]
zgc:1735775.278e-1540.78zgc:173577 [Source:ZFIN;Acc:ZDB-GENE-071004-55][more]
si:dkey-182i3.85.454e-1529.81si:dkey-182i3.8 [Source:ZFIN;Acc:ZDB-GENE-030131-4... [more]
si:ch211-266d19.41.103e-1427.55si:ch211-266d19.4 [Source:ZFIN;Acc:ZDB-GENE-091204... [more]
si:ch211-266d19.41.158e-1427.55si:ch211-266d19.4 [Source:ZFIN;Acc:ZDB-GENE-091204... [more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBTB386.129e-1343.04zinc finger and BTB domain containing 38 [Source:H... [more]
SALL36.424e-1335.90spalt-like transcription factor 3 [Source:NCBI gen... [more]
SALL36.669e-1335.90spalt-like transcription factor 3 [Source:NCBI gen... [more]
agtr17.182e-1345.00angiotensin II receptor type 1 [Source:Xenbase;Acc... [more]
ENSXETT00000016517.18.275e-1339.58oocyte zinc finger protein XlCOF26-like [Source:NC... [more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp9402.342e-1626.02zinc finger protein 940 [Source:MGI Symbol;Acc:MGI... [more]
Zfp8537.095e-1641.41zinc finger protein 853 [Source:MGI Symbol;Acc:MGI... [more]
Zfp8538.155e-1641.41zinc finger protein 853 [Source:MGI Symbol;Acc:MGI... [more]
Zfp8539.018e-1641.41zinc finger protein 853 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7684.552e-1527.55zinc finger protein 768 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q17895|MNM2_CAEEL9.634e-1935.50Zinc finger protein mnm-2 OS=Caenorhabditis elegan... [more]
sp|Q8TC21|ZN596_HUMAN1.012e-1550.00Zinc finger protein 596 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9BXA9|SALL3_HUMAN2.106e-1427.91Sal-like protein 3 OS=Homo sapiens OX=9606 GN=SALL... [more]
sp|Q9H5H4|ZN768_HUMAN2.365e-1427.55Zinc finger protein 768 OS=Homo sapiens OX=9606 GN... [more]
sp|Q8R0T2|ZN768_MOUSE3.440e-1427.55Zinc finger protein 768 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VRP22.327e-2765.85Putative zinc finger protein OS=Schistosoma manson... [more]
A0A183SZP42.625e-2761.29Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A183PA142.780e-2750.00Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A183QJG21.955e-2665.85Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A183JBN96.518e-2654.55Uncharacterized protein OS=Schistosoma curassoni O... [more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000047252.11.413e-1629.49pep primary_assembly:Astyanax_mexicanus-2.0:11:822... [more]
ENSAMXT00000034080.12.994e-1530.07pep primary_assembly:Astyanax_mexicanus-2.0:11:822... [more]
ENSAMXT00000056464.11.831e-1429.30pep primary_assembly:Astyanax_mexicanus-2.0:11:822... [more]
ENSAMXT00000031188.13.649e-1427.94pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000026722.28.308e-1433.13pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001747.15.931e-1641.57pep scaffold:Pmarinus_7.0:GL479152:3602:4030:-1 ge... [more]
ENSPMAT00000004792.16.600e-1639.45pep scaffold:Pmarinus_7.0:GL479046:11287:22931:1 g... [more]
ENSPMAT00000005225.18.232e-1640.70pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1... [more]
ENSPMAT00000006856.13.256e-1541.18pep scaffold:Pmarinus_7.0:GL476534:515915:516469:1... [more]
ZNF4361.339e-1435.40zinc finger protein 436 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AZF11.991e-1338.64Zinc-finger transcription factor; involved in diau... [more]
ZAP12.066e-1244.00Zinc-regulated transcription factor; binds to zinc... [more]
CRZ11.014e-1035.42Transcription factor, activates transcription of s... [more]
MIG21.282e-841.43Zinc finger transcriptional repressor; cooperates ... [more]
COM21.211e-744.44Transcription factor that binds IME1 Upstream Acti... [more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO290944.155e-1541.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489562.831e-1435.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313018.428e-1435.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463741.081e-1345.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350063.615e-1344.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038984.18.966e-1542.59pep primary_assembly:ASM223467v1:19:1011628:101511... [more]
ENSORLT00000029076.18.966e-1542.59pep primary_assembly:ASM223467v1:19:1011628:102900... [more]
ENSORLT00000008836.21.634e-1425.68pep primary_assembly:ASM223467v1:17:11395122:11396... [more]
ENSORLT00000008835.22.776e-1441.76pep primary_assembly:ASM223467v1:17:11029088:11029... [more]
ENSORLT00000034581.13.092e-1442.17gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
back to top
BLAST of Zinc finger and BTB domain containing 41 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022366.10.000e+099.11SMESG000022366.1[more]
SMESG000022366.10.000e+098.86SMESG000022366.1[more]
SMESG000011176.14.724e-1346.84SMESG000011176.1[more]
SMESG000029867.14.092e-1236.00SMESG000029867.1[more]
SMESG000015209.15.985e-1227.44SMESG000015209.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028681 ID=SMED30028681|Name=Zinc finger and BTB domain containing 41|organism=Schmidtea mediterranea sexual|type=transcript|length=3271bp
AAAACAGTAACATACTAGCAAACATTCCCTATTAGACATGTGGGGATTTT
TGTCATTTTCATTTACCAGTCCTCCCTGCAATGGAGAAACGTAGAAGTTT
TAACCGAGTGTGTCAGGACTAGAGTACTGGTTTGTGCTACATTGGCCAAA
CTATGCTGCTGCTGCTGCAATTATAAAAGCGCAATGCATCCGCCCGCTAC
TCACATTTTCTTATGAGTATTTTTTGGTGGTGGTAAATTCAGTTTTCTTC
TATCGCCGTTTTTATCATTAAAGCAATTCTTTTTTTTATAAAAAAACAGA
GACCAACAATCAAACGAATAAAAAAAGCAAGAGTCCAATCGTCAAAATAA
TTCAAGTATTTCAGACAAACAAAAAAATATTCAATATTTCTACTGAAATT
TTTACCAAGTGAAAATATCGAACGAGATTTTCGCATATATTTTTTAAAAC
CATTCAATATCCTTAAGAGAAAAAAACCACCGACGAAAAAACCGGAAAAG
GATGCTTTTTGATAGCAACTCAAACGAAAAATGCTTCCTGCCAATAACTT
ATGATCACAACACCGATCAGAATTTGCCCAATCAAGACATTGAAGATAAT
TCTCTGAAACCGATGGAAACGAATTCCACTTCTCCTCCAAGTCTTCCAGA
ACTCAACATTGCTGCGTCTCCTAATTCTCAGAATCAATCGACTGAAAGTC
CAATTGCTCCTTCAGGAACGACCAATAGTCCAATTGAAGAAGAGTCGACG
AAAAAAATTTTAAAATGCGATTACTGTGATAAAACGTTTACCTTAGCAAA
CGTCCTCAAAGTCCATCAAAGAATCCATACCGGCGAAAAACCGTATGTCT
GCGAAATATGCGGCAAAGCCTTCAATCAAAGTGGCTCTCTAAATCGACAC
CGAAATACTCATAGATATCGAGATGCCACTGACAGTAACTACATTTGCCG
GTTTTGCAATACAAAATTTCCCCACGGATCATTGCTGGAGAATCATGAGA
AAACCGCACATCACAATCGCCGATCAGGAAGGCCGAGAAATCTTTCAACT
ACGGACAACAATGCAAACAGTTTGGATGCAAAATCCAACAATTTACACAA
CGATAATTTTAAATTCAATTATCCGGGATATAATTTAAATAATGATATCA
AATCCGATGCCCTGACTCCAACTGGAAATGACGATGTTGACGTAAAAACA
GATTCTAGTGGTATAATTAAGGATCATTCTATACTGGGAGGAAGCAACGA
ATCAGGATTCACATGCCCATACTGTCAACTAGGATTAAATGATATACGAG
ATTTAGGGGTGCATTTGTCCCAGCATAATATCGGAGGAAATTTAGTTTCT
GGATCGTCAGGAATAAATTCTCCAACGAATCCAATGATGAGTAAAAGTAA
CCCATTGTTTTCATCTGAATCCTTAGTTCACCAATTGGCGAATTTATCGA
AAAAACTAAAATTACCACCGACTTCAGATTTTAATCCAAACATGGGAATA
GGCTCTGTACCAAATACTTCGTTTTTACCAATTTCATTCGATAGGCTCCG
TCCCACTGAAGCGCTACCAAACATGAGTTTCCCATTAACAAACAATGTTT
TACCAAACAGCAATCCTTCCAATCTATCAGATTCCTATAATCTTGCTGCT
TTTGTGTTGGCTACTTTATCTAAAGATTATTTTTTCAAACAACGACCTCA
ACCTCTACAGCAAGAAAACAACTTTCCGCTTTCTAATCCTGAATTCTTAA
AAAACCAAACTTTCAACCAGAAATCCCCTTTATTCGGAAGACTGGGAAAT
TCCAATCACTTAGATTTCTATAATCTTTTCAATCTCCAAAAACCCCTACA
AAATTTGCTGTGCAATATCGAAAACAACACTTTACCAAACAACAATAATA
ATATTACCAACAAACCCGATATTGAAAACAATTCATGCGTCAACTTAGAA
ATGCACGACAACAACTACAATGTGATAACGATGTCGAATTCGAGGTCGAA
TTCTTCTCCATCAATGTTTATCTCATCACGAATCAAGAATGGTAAACCGA
TTAATGGCACGAAAAAGAACTCAGTTCCCCGTTCATCACCAACATCAAGT
GGACACACGACTCAGTCATCATCGAATAAAACAACAGATATTTTTTTCTC
AAGAAAAGGAGGTTCCGAGCGACGAAAATGTCCCGACTGTGACAAACAAT
TCACTTGCGAAAGCGCTCTTCGCATTCACTACCGAAAACATTCCGGAGAA
AGACCATATGCTTGCGAATTTTGTTCAAAAACATTTTCACAAAACGGAAC
TCTTAAAAGACATCATCTCACTTGTAAAAATAGACCAACTGTTCTATCCA
GTACCAAATTAAAAGTCATACCAAACAAACCGTCAATGTCAAAAGATTCT
GAGTCAGCTGCACCGGATGTCAATAATTCCACAAATGGATCAACATATAC
AATGACCAATTCTCCGCCATGTTCATTTGGAACCAATTCATTAACAAATC
CTCAAAATCCTCATTTGAATTACATGATCAACACAAAAGCATTGGCGACA
AAAATCAACGAAACCATAAATAAATTTGATCATTTCCCTGACAATTCAAT
GTTCCAAACAGTTTCATCATATTCCACAGGAGAATTGTCAAGAAAGAATA
ACGAACAGAGATTTCCATTTAGTAACAACATTGAATCTTCAGAAGAACCT
ACAGTAGGTTTTATGGATCTGACTGTTAACTGCAGCCGACACAGCGACAC
CGTTTCCCAATCAAACGACGGAGAAGCTCCACTTGACATAGACAACATAG
ATGAGACGAAAGCCCCAACAAACTCCCTTCGCAGCGAAACCGAACAAATG
GAGATCTCCAATCATAAAATAAATCGAAATTCTAATTTCCACAACCAATA
TCCCAACAGTCAATTCCACAATCAGTTCAACAACGTAAAATCCCATGTAA
AAACTGTAAACAATCTACTGTGTAATTATTCGACAAAAGAAATTCTCCAG
CTTCTATTGAAAACTCGACGCCTGTTGTTTTGTCAACATTGTTCAATTTA
TTTTGAGAACGATTCGATTTTCCACAGTCACATTCAACAACATTCCGACG
AGAAGGACAATCTGAAATGCAGGGATTGTAAATTTGTTGCCAAAGACGAG
GTGGCCTTCAAAGATCATTTCAATTATATAATTGCAAAAAGAGAAACTTG
TAAAGAGTAAAATTGACATTTTTTATTTGATTTCATTCGATTTGATTGTG
TTTTAAGTATTATTGTTATAG
back to top

protein sequence of SMED30028681-orf-1

>SMED30028681-orf-1 ID=SMED30028681-orf-1|Name=SMED30028681-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=903bp
MLFDSNSNEKCFLPITYDHNTDQNLPNQDIEDNSLKPMETNSTSPPSLPE
LNIAASPNSQNQSTESPIAPSGTTNSPIEEESTKKILKCDYCDKTFTLAN
VLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRHRNTHRYRDATDSNYICR
FCNTKFPHGSLLENHEKTAHHNRRSGRPRNLSTTDNNANSLDAKSNNLHN
DNFKFNYPGYNLNNDIKSDALTPTGNDDVDVKTDSSGIIKDHSILGGSNE
SGFTCPYCQLGLNDIRDLGVHLSQHNIGGNLVSGSSGINSPTNPMMSKSN
PLFSSESLVHQLANLSKKLKLPPTSDFNPNMGIGSVPNTSFLPISFDRLR
PTEALPNMSFPLTNNVLPNSNPSNLSDSYNLAAFVLATLSKDYFFKQRPQ
PLQQENNFPLSNPEFLKNQTFNQKSPLFGRLGNSNHLDFYNLFNLQKPLQ
NLLCNIENNTLPNNNNNITNKPDIENNSCVNLEMHDNNYNVITMSNSRSN
SSPSMFISSRIKNGKPINGTKKNSVPRSSPTSSGHTTQSSSNKTTDIFFS
RKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGT
LKRHHLTCKNRPTVLSSTKLKVIPNKPSMSKDSESAAPDVNNSTNGSTYT
MTNSPPCSFGTNSLTNPQNPHLNYMINTKALATKINETINKFDHFPDNSM
FQTVSSYSTGELSRKNNEQRFPFSNNIESSEEPTVGFMDLTVNCSRHSDT
VSQSNDGEAPLDIDNIDETKAPTNSLRSETEQMEISNHKINRNSNFHNQY
PNSQFHNQFNNVKSHVKTVNNLLCNYSTKEILQLLLKTRRLLFCQHCSIY
FENDSIFHSHIQQHSDEKDNLKCRDCKFVAKDEVAFKDHFNYIIAKRETC
KE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 115..137
e-value: 2.1E-4
score: 30.6
coord: 871..891
e-value: 120.0
score: 3.8
coord: 147..170
e-value: 0.16
score: 21.0
coord: 842..864
e-value: 14.0
score: 11.9
coord: 558..580
e-value: 0.013
score: 24.7
coord: 87..109
e-value: 0.0028
score: 26.9
coord: 586..606
e-value: 16.0
score: 11.4
coord: 253..275
e-value: 1.6
score: 17.8
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 586..606
e-value: 0.01
score: 16.2
coord: 115..137
e-value: 9.1E-6
score: 25.8
coord: 88..109
e-value: 0.0033
score: 17.8
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 560..580
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 89..109
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 844..864
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 149..171
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 117..137
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 558..585
score: 14.565
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 147..175
score: 10.408
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 586..604
score: 9.702
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 87..114
score: 15.729
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 115..142
score: 12.819
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 842..869
score: 9.349
NoneNo IPR availablePFAMPF12874zf-metcoord: 560..578
e-value: 0.0049
score: 17.2
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 581..607
e-value: 2.8E-9
score: 38.8
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 115..180
e-value: 1.8E-14
score: 55.5
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 87..114
e-value: 1.1E-12
score: 49.6
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 558..580
e-value: 3.9E-9
score: 38.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 167..187
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 512..547
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 21..80
NoneNo IPR availablePANTHERPTHR24408FAMILY NOT NAMEDcoord: 39..274
coord: 458..606
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 559..604
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 85..137