SMED30028675

Overview
NameSMED30028675
Smed IDSMED30028675
Length (bp)727
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30028675 (SMED30028675) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30028675 (SMED30028675) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028675

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028675h1SMcG0008470 Contig4425newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028675h1SMcG0008470 Contig4425uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028675h1SMcG0008469 Contig4425newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028675h1SMcG0008469 Contig4425uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028675h1SMcG0008470 Contig4597GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028675h1SMcG0016518 Contig4597GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30028675h1SMcG0008470 Contig4597GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028675h1SMcG0016518 Contig4597GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30028675h1SMcG0008470 dd_Smed_v4_6515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30028675h1SMcG0008470 dd_Smed_v4_6515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30028675h1SMcG0008470 dd_Smed_v4_6515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028675h1SMcG0008470 dd_Smed_v4_2558_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028675h1SMcG0008470 dd_Smed_v4_2558_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30028675h1SMcG0008470 dd_Smed_v4_2558_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30028675h1SMcG0008470 Contig46397newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028675h1SMcG0008470 Contig46397uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30028675 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.020172:7028..7705 +2536
v31.030531:6069..6670 -2276
Homology
BLAST of SMED30028675 vs. TrEMBL
Match: A0A4Y2MCT8 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_238801_1 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.475e-19
Identity = 30/64 (46.88%), Postives = 43/64 (67.19%), Query Frame = 3
Query:  438 SFQKATAMVSSLNVVNDCAERGIALVSSFNSFLTKSEEDKQYLLQTIEQHRKEFPYAKKLTVRK 629
            S+ K+  +  +L V ND AERG+ L+  FN  LT  EE KQ+LLQ +E HRK++P  KK T+++
Sbjct:  154 SYLKSQEIFQNLRVFNDTAERGVKLMQDFNGLLTADEEQKQFLLQCVEDHRKQYPDCKKATLKQ 217          

HSP 2 Score: 57.3806 bits (137), Expect = 2.475e-19
Identity = 35/105 (33.33%), Postives = 61/105 (58.10%), Query Frame = 2
Query:   11 IFASLIYIKAWIQCTIPADAPLNDLEFIKLLIYYKDVSPSISETALKTIRRHLWYLNAE--FISLFSKYLSG*EKQPCCLLEATNGEIFW*SERRKVHPQHKVSF 319
            +F   +Y+K+W++ +    APLNDL F+K L  Y++++  IS  ALK    +LWYLN E   +++F K ++   K+  C++E    E    +ER+ +   ++V F
Sbjct:   12 LFLVTVYVKSWLESSSAIGAPLNDLMFLKKLKKYENINQGISSIALKKFCNYLWYLNEESSILAIFDKNVNIASKK--CVIENLKQENLH-TERKCIVQPNEVPF 113          
BLAST of SMED30028675 vs. TrEMBL
Match: A0A4Y2FRP4 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_257139_1 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 4.210e-19
Identity = 29/64 (45.31%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  438 SFQKATAMVSSLNVVNDCAERGIALVSSFNSFLTKSEEDKQYLLQTIEQHRKEFPYAKKLTVRK 629
            S+ K+  +  +L VVND  ERG+ L+  FN  LT  EE KQ+LLQ +E HRK++   KK T+++
Sbjct:  535 SYLKSQEIFQNLRVVNDTTERGVKLMQDFNGLLTVDEEQKQFLLQCVEDHRKQYKNCKKATLKR 598          

HSP 2 Score: 59.6918 bits (143), Expect = 4.210e-19
Identity = 36/105 (34.29%), Postives = 62/105 (59.05%), Query Frame = 2
Query:   11 IFASLIYIKAWIQCTIPADAPLNDLEFIKLLIYYKDVSPSISETALKTIRRHLWYLNAE--FISLFSKYLSG*EKQPCCLLEATNGEIFW*SERRKVHPQHKVSF 319
            +F   +Y+K+W++ +    APLNDL F+K L  Y++++  IS  ALK    HLWYLN E   +++F K ++   K+   ++E    E    +ER+++   ++VSF
Sbjct:  394 LFLVTVYVKSWLESSSAIGAPLNDLIFLKKLKKYENINQGISSIALKKFCNHLWYLNEESSILAIFDKNVNITSKKR--IIENLKRENLH-TERKRIVQPNEVSF 495          
BLAST of SMED30028675 vs. TrEMBL
Match: H3AY42 (Uncharacterized protein OS=Latimeria chalumnae OX=7897 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 5.051e-19
Identity = 49/147 (33.33%), Postives = 71/147 (48.30%), Query Frame = 3
Query:  198 FSQSISVDEKNSLAACLRQLMEKSSGDQKEERCIR-----STKYPSAFHNVTFKDFVXXXXXXXXXXXXXXXXXPTDASTRQQTPSFQKATAMVSSLNVVNDCAERGIALVSSFNSFLTKSEEDKQYLLQTIEQHRKEFPYAKKLTV 623
            F   + +DEK ++   L+++  K S D  +   ++      T+ PSAF     K F  +  L    L         D     Q   ++ A  +V  L VVND AE+ +AL+  FN  LT +EE KQ+LL  + QHRK  P +KK TV
Sbjct:   89 FDPLVPLDEKRAMLQALKEV--KGSEDPPKRIKLQLSDLGVTRKPSAFITQQTKGFFNALGLPKGFLHK-------DPEVWLQDSDYEAAQKIVKGLKVVNDTAEKDVALIQEFNDHLTHNEEQKQFLLHIVSQHRKLCPNSKKSTV 226          

HSP 2 Score: 57.7658 bits (138), Expect = 5.051e-19
Identity = 27/65 (41.54%), Postives = 41/65 (63.08%), Query Frame = 2
Query:    5 FAIFASLIYIKAWIQCTIPADAPLNDLEFIKLLIYYKDVSPSISETALKTIRRHLWYLNAEFISL 199
            FAI     YI+AW+   I   APLNDL+F++ L  Y  ++  +++ A++ +  HLWYL+ E ISL
Sbjct:   24 FAITGG--YIQAWLSAPIATSAPLNDLKFLERLQKYSKINKGVADGAIQKLLGHLWYLSEELISL 86          
BLAST of SMED30028675 vs. TrEMBL
Match: S6CVV7 (Uncharacterized protein OS=Cotesia congregata OX=51543 GN=CcPL6.029 PE=4 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.868e-15
Identity = 33/102 (32.35%), Postives = 52/102 (50.98%), Query Frame = 2
Query:    2 EFAIFASLIYIKAWIQCTIPADAPLNDLEFIKLLIYYKDVSPSISETALKTIRRHLWYLNAEF--ISLFSKYLS-G*EKQPCCLLEATNGEIFW*SERRKVH 298
            +  +F   IY+  W +  + A AP  DL F+K +  YK ++  ISE  L   + HLWYLN E   +S F + +S   +++    LE    + F  S+R  +H
Sbjct:  469 DICLFIVFIYVPFWFEAPLAALAPNQDLRFLKAVYQYKTINKQISEAVLNKFKNHLWYLNGETAALSFFDENISFSIKRKMVKALENNENQDFDSSKRYGIH 570          

HSP 2 Score: 54.6842 bits (130), Expect = 1.868e-15
Identity = 26/73 (35.62%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  411 DASTRQQTPSFQKATAMVSSLNVVNDCAERGIALVSSFNSFLTKSEEDKQYLLQTIEQHRKEFPYAKKLTVRK 629
            D  T      + +   +V +L VVND AER I L   + + LT  E+ KQYL+Q + +++K++P A K  + K
Sbjct:  608 DVETWADNNDYLEGLRIVKNLQVVNDVAERAIKLTQEYINILTTREDQKQYLIQVVSEYKKKYPNATKAYLTK 680          
BLAST of SMED30028675 vs. TrEMBL
Match: B9W4L3 (Uncharacterized protein Cc8K15.2 OS=Cotesia congregata OX=51543 GN=Cc8K15.2 PE=4 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.370e-15
Identity = 33/102 (32.35%), Postives = 51/102 (50.00%), Query Frame = 2
Query:    2 EFAIFASLIYIKAWIQCTIPADAPLNDLEFIKLLIYYKDVSPSISETALKTIRRHLWYLNAEF--ISLFSKYLS-G*EKQPCCLLEATNGEIFW*SERRKVH 298
            +  +F   IY+  W +  + A AP  DL F+K +  YK +   ISE  L   + HLWYLN E   +S F + +S   +++    LE    + F  S+R  +H
Sbjct:  475 DICLFIVFIYVPFWFEAPLAALAPNQDLRFLKAVYQYKTIDKQISEAVLNKFKNHLWYLNGETAALSFFDENISFSIKRKMVKALENNENQDFDSSKRYGIH 576          

HSP 2 Score: 54.299 bits (129), Expect = 3.370e-15
Identity = 25/73 (34.25%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  411 DASTRQQTPSFQKATAMVSSLNVVNDCAERGIALVSSFNSFLTKSEEDKQYLLQTIEQHRKEFPYAKKLTVRK 629
            D  T      + +   +V +L +VND AER I L   + + LT  E+ KQYL+Q + +++K++P A K  + K
Sbjct:  614 DVETWADNNDYLEGLRIVKNLQIVNDVAERAIKLTQEYINILTTREDQKQYLIQVVSEYKKKYPNATKACLTK 686          
BLAST of SMED30028675 vs. Planmine SMEST
Match: SMESG000047115.1 (SMESG000047115.1)

HSP 1 Score: 157.532 bits (397), Expect = 7.233e-50
Identity = 89/99 (89.90%), Postives = 90/99 (90.91%), Query Frame = 3
Query:  195 LFSQSISVDEKNSLAACLRQLMEKSSGDQKEERCIRSTKYPSAFHNVTFKDFVXXXXXXXXXXXXXXXX-XPTDASTRQQTPSFQKATAMVSSLNVVND 488
            LFSQ ISVDEKNSLAACLRQLMEKSSGDQKEERCI STKYPSAFHNVTFKDFVTSSFLLF   LL +   SPTDASTRQQTPSFQKATAMVSSLNVVND
Sbjct:  709 LFSQRISVDEKNSLAACLRQLMEKSSGDQKEERCIHSTKYPSAFHNVTFKDFVTSSFLLFFIALLLSTIFSPTDASTRQQTPSFQKATAMVSSLNVVND 807          

HSP 2 Score: 58.151 bits (139), Expect = 7.233e-50
Identity = 27/39 (69.23%), Postives = 31/39 (79.49%), Query Frame = 1
Query:  490 VPSEELHWCHHSTHFSQNRRRTSSTCSKLLNNIAKSFHM 606
            +PSEELHWCHHSTHFS N+RR      KLLN+IAKSF +
Sbjct:  808 LPSEELHWCHHSTHFSPNQRRK----KKLLNSIAKSFQI 842          

HSP 3 Score: 100.138 bits (248), Expect = 6.971e-24
Identity = 58/104 (55.77%), Postives = 69/104 (66.35%), Query Frame = 2
Query:   47 QCTIPADAPLNDLEFIKLLIYYKDVSPSISETALKTIRRHLWYLNAEFIS--LFSKYLSG*EKQPCC-----LLEATNGEIFW*SERRKVHPQ------HKVSF 319
            +C IPA+A LNDLEFIKLLI YKDVSPSIS+TALKTIRRH WYLNAEFIS  LFS+ +S  EK         L+E ++G+     E R +H        H V+F
Sbjct:  657 ECPIPANASLNDLEFIKLLIDYKDVSPSISQTALKTIRRHFWYLNAEFISMVLFSQRISVDEKNSLAACLRQLMEKSSGDQ---KEERCIHSTKYPSAFHNVTF 757          
BLAST of SMED30028675 vs. Planmine SMEST
Match: SMESG000047115.1 (SMESG000047115.1)

HSP 1 Score: 157.532 bits (397), Expect = 8.394e-50
Identity = 89/99 (89.90%), Postives = 90/99 (90.91%), Query Frame = 3
Query:  195 LFSQSISVDEKNSLAACLRQLMEKSSGDQKEERCIRSTKYPSAFHNVTFKDFVXXXXXXXXXXXXXXXX-XPTDASTRQQTPSFQKATAMVSSLNVVND 488
            LFSQ ISVDEKNSLAACLRQLMEKSSGDQKEERCI STKYPSAFHNVTFKDFVTSSFLLF   LL +   SPTDASTRQQTPSFQKATAMVSSLNVVND
Sbjct:  735 LFSQRISVDEKNSLAACLRQLMEKSSGDQKEERCIHSTKYPSAFHNVTFKDFVTSSFLLFFIALLLSTIFSPTDASTRQQTPSFQKATAMVSSLNVVND 833          

HSP 2 Score: 58.151 bits (139), Expect = 8.394e-50
Identity = 27/39 (69.23%), Postives = 31/39 (79.49%), Query Frame = 1
Query:  490 VPSEELHWCHHSTHFSQNRRRTSSTCSKLLNNIAKSFHM 606
            +PSEELHWCHHSTHFS N+RR      KLLN+IAKSF +
Sbjct:  834 LPSEELHWCHHSTHFSPNQRRK----KKLLNSIAKSFQI 868          

HSP 3 Score: 127.872 bits (320), Expect = 1.903e-33
Identity = 71/119 (59.66%), Postives = 82/119 (68.91%), Query Frame = 2
Query:    2 EFAIFASLIYIKAWIQCTIPADAPLNDLEFIKLLIYYKDVSPSISETALKTIRRHLWYLNAEFIS--LFSKYLSG*EKQPCC-----LLEATNGEIFW*SERRKVHPQ------HKVSF 319
            EFA FASL+YI AWIQC IPA+A LNDLEFIKLLI YKDVSPSIS+TALKTIRRH WYLNAEFIS  LFS+ +S  EK         L+E ++G+     E R +H        H V+F
Sbjct:  668 EFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSISQTALKTIRRHFWYLNAEFISMVLFSQRISVDEKNSLAACLRQLMEKSSGDQ---KEERCIHSTKYPSAFHNVTF 783          
BLAST of SMED30028675 vs. Planmine SMEST
Match: SMESG000047115.1 (SMESG000047115.1)

HSP 1 Score: 157.532 bits (397), Expect = 1.122e-49
Identity = 89/99 (89.90%), Postives = 90/99 (90.91%), Query Frame = 3
Query:  195 LFSQSISVDEKNSLAACLRQLMEKSSGDQKEERCIRSTKYPSAFHNVTFKDFVXXXXXXXXXXXXXXXX-XPTDASTRQQTPSFQKATAMVSSLNVVND 488
            LFSQ ISVDEKNSLAACLRQLMEKSSGDQKEERCI STKYPSAFHNVTFKDFVTSSFLLF   LL +   SPTDASTRQQTPSFQKATAMVSSLNVVND
Sbjct:  709 LFSQRISVDEKNSLAACLRQLMEKSSGDQKEERCIHSTKYPSAFHNVTFKDFVTSSFLLFFIALLLSTIFSPTDASTRQQTPSFQKATAMVSSLNVVND 807          

HSP 2 Score: 57.7658 bits (138), Expect = 1.122e-49
Identity = 27/38 (71.05%), Postives = 30/38 (78.95%), Query Frame = 1
Query:  490 VPSEELHWCHHSTHFSQNRRRTSSTCSKLLNNIAKSFH 603
            +PSEELHWCHHSTHFS N+RR      KLLN+IAKSF 
Sbjct:  808 LPSEELHWCHHSTHFSPNQRRK----KKLLNSIAKSFQ 841          

HSP 3 Score: 100.138 bits (248), Expect = 6.966e-24
Identity = 58/104 (55.77%), Postives = 69/104 (66.35%), Query Frame = 2
Query:   47 QCTIPADAPLNDLEFIKLLIYYKDVSPSISETALKTIRRHLWYLNAEFIS--LFSKYLSG*EKQPCC-----LLEATNGEIFW*SERRKVHPQ------HKVSF 319
            +C IPA+A LNDLEFIKLLI YKDVSPSIS+TALKTIRRH WYLNAEFIS  LFS+ +S  EK         L+E ++G+     E R +H        H V+F
Sbjct:  657 ECPIPANASLNDLEFIKLLIDYKDVSPSISQTALKTIRRHFWYLNAEFISMVLFSQRISVDEKNSLAACLRQLMEKSSGDQ---KEERCIHSTKYPSAFHNVTF 757          
BLAST of SMED30028675 vs. Planmine SMEST
Match: SMESG000047115.1 (SMESG000047115.1)

HSP 1 Score: 157.532 bits (397), Expect = 1.151e-49
Identity = 89/99 (89.90%), Postives = 90/99 (90.91%), Query Frame = 3
Query:  195 LFSQSISVDEKNSLAACLRQLMEKSSGDQKEERCIRSTKYPSAFHNVTFKDFVXXXXXXXXXXXXXXXX-XPTDASTRQQTPSFQKATAMVSSLNVVND 488
            LFSQ ISVDEKNSLAACLRQLMEKSSGDQKEERCI STKYPSAFHNVTFKDFVTSSFLLF   LL +   SPTDASTRQQTPSFQKATAMVSSLNVVND
Sbjct:  638 LFSQRISVDEKNSLAACLRQLMEKSSGDQKEERCIHSTKYPSAFHNVTFKDFVTSSFLLFFIALLLSTIFSPTDASTRQQTPSFQKATAMVSSLNVVND 736          

HSP 2 Score: 57.7658 bits (138), Expect = 1.151e-49
Identity = 27/38 (71.05%), Postives = 30/38 (78.95%), Query Frame = 1
Query:  490 VPSEELHWCHHSTHFSQNRRRTSSTCSKLLNNIAKSFH 603
            +PSEELHWCHHSTHFS N+RR      KLLN+IAKSF 
Sbjct:  737 LPSEELHWCHHSTHFSPNQRRK----KKLLNSIAKSFQ 770          

HSP 3 Score: 100.138 bits (248), Expect = 6.880e-24
Identity = 58/104 (55.77%), Postives = 69/104 (66.35%), Query Frame = 2
Query:   47 QCTIPADAPLNDLEFIKLLIYYKDVSPSISETALKTIRRHLWYLNAEFIS--LFSKYLSG*EKQPCC-----LLEATNGEIFW*SERRKVHPQ------HKVSF 319
            +C IPA+A LNDLEFIKLLI YKDVSPSIS+TALKTIRRH WYLNAEFIS  LFS+ +S  EK         L+E ++G+     E R +H        H V+F
Sbjct:  586 ECPIPANASLNDLEFIKLLIDYKDVSPSISQTALKTIRRHFWYLNAEFISMVLFSQRISVDEKNSLAACLRQLMEKSSGDQ---KEERCIHSTKYPSAFHNVTF 686          
BLAST of SMED30028675 vs. Planmine SMEST
Match: SMESG000004000.1 (SMESG000004000.1)

HSP 1 Score: 156.762 bits (395), Expect = 1.830e-49
Identity = 89/99 (89.90%), Postives = 90/99 (90.91%), Query Frame = 3
Query:  195 LFSQSISVDEKNSLAACLRQLMEKSSGDQKEERCIRSTKYPSAFHNVTFKDFVXXXXXXXXXXXXXXXX-XPTDASTRQQTPSFQKATAMVSSLNVVND 488
            LFSQ ISVDEKNSLAACLRQLMEKSSGDQKEERCIRSTKY SAFHNVTFKDFVTSSFLLF   LL +   SPTDASTRQQTPSFQKATAMVSSLNVVND
Sbjct:  600 LFSQRISVDEKNSLAACLRQLMEKSSGDQKEERCIRSTKYTSAFHNVTFKDFVTSSFLLFFIALLLSTIFSPTDASTRQQTPSFQKATAMVSSLNVVND 698          

HSP 2 Score: 57.7658 bits (138), Expect = 1.830e-49
Identity = 27/38 (71.05%), Postives = 30/38 (78.95%), Query Frame = 1
Query:  490 VPSEELHWCHHSTHFSQNRRRTSSTCSKLLNNIAKSFH 603
            +PSEELHWCHHSTHFS N+RR      KLLN+IAKSF 
Sbjct:  699 LPSEELHWCHHSTHFSPNQRRK----KKLLNSIAKSFQ 732          

HSP 3 Score: 95.1301 bits (235), Expect = 4.217e-22
Identity = 51/80 (63.75%), Postives = 60/80 (75.00%), Query Frame = 2
Query:   47 QCTIPADAPLNDLEFIKLLIYYKDVSPSISETALKTIRRHLWYLNAEFIS--LFSKYLSG*EKQPCC-----LLEATNGE 265
            +C  PA+A LNDLEFIKLLI YKDVSPSIS+TALKTIRRH WYLNAEFIS  LFS+ +S  EK         L+E ++G+
Sbjct:  548 ECPTPANASLNDLEFIKLLIDYKDVSPSISQTALKTIRRHFWYLNAEFISMVLFSQRISVDEKNSLAACLRQLMEKSSGD 627          
The following BLAST results are available for this feature:
BLAST of SMED30028675 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028675 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028675 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028675 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028675 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028675 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028675 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028675 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2MCT82.475e-1946.88Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2FRP44.210e-1945.31Uncharacterized protein OS=Araneus ventricosus OX=... [more]
H3AY425.051e-1933.33Uncharacterized protein OS=Latimeria chalumnae OX=... [more]
S6CVV71.868e-1532.35Uncharacterized protein OS=Cotesia congregata OX=5... [more]
B9W4L33.370e-1532.35Uncharacterized protein Cc8K15.2 OS=Cotesia congre... [more]
back to top
BLAST of SMED30028675 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028675 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028675 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028675 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028675 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028675 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047115.17.233e-5089.90SMESG000047115.1[more]
SMESG000047115.18.394e-5089.90SMESG000047115.1[more]
SMESG000047115.11.122e-4989.90SMESG000047115.1[more]
SMESG000047115.11.151e-4989.90SMESG000047115.1[more]
SMESG000004000.11.830e-4989.90SMESG000004000.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028675 ID=SMED30028675|Name=SMED30028675|organism=Schmidtea mediterranea sexual|type=transcript|length=727bp
AGAATTTGCTATCTTTGCATCCTTGATTTATATTAAAGCTTGGATTCAAT
GTACCATTCCAGCTGACGCACCTCTGAATGACCTGGAGTTTATCAAGCTT
CTTATTTATTATAAGGATGTTTCTCCCTCCATTTCTGAGACCGCATTGAA
AACGATTCGCCGACATCTCTGGTACCTTAATGCAGAATTCATTTCTCTTT
TCTCAAAGTATCTCAGTGGATGAGAAAAACAGCCTTGCTGCTTGCTTGAG
GCAACTAATGGAGAAATCTTCTGGTGATCAGAAAGAAGAAAGGTGCATCC
GCAGCACAAAGTATCCTTCAGCATTTCATAATGTGACATTTAAGGATTTT
GTGACCTCGTCGTTTCTGCTCTTTATTGCTCTTCTGCTTTCCACAATTTT
TTCTCCGACCGATGCTTCTACCAGGCAACAAACTCCATCCTTTCAGAAAG
CAACAGCAATGGTCTCTTCCTTGAATGTTGTCAATGACTGTGCCGAGCGA
GGAATTGCACTGGTGTCATCATTCAACTCATTTCTCACAAAATCGGAGGA
GGACAAGCAGTACTTGCTCCAAACTATTGAACAACATCGCAAAGAGTTTC
CATATGCAAAAAAATTAACTGTGCGGAAGATATCGCAACTTGAAGACTTT
AAGAACAACGGCTTGATATTGAATAGCATAAGAGAAATTCAATTATTTTT
TCCTAACAATTGAAAAAGTCGCAAAGC
back to top

protein sequence of SMED30028675-orf-1

>SMED30028675-orf-1 ID=SMED30028675-orf-1|Name=SMED30028675-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=178bp
MQNSFLFSQSISVDEKNSLAACLRQLMEKSSGDQKEERCIRSTKYPSAFH
NVTFKDFVTSSFLLFIALLLSTIFSPTDASTRQQTPSFQKATAMVSSLNV
VNDCAERGIALVSSFNSFLTKSEEDKQYLLQTIEQHRKEFPYAKKLTVRK
ISQLEDFKNNGLILNSIREIQLFFPNN*
back to top