Leucine-rich repeat-containing protein 71

Overview
NameLeucine-rich repeat-containing protein 71
Smed IDSMED30028668
Length (bp)1782
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine-rich repeat-containing protein 71 (SMED30028668) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine-rich repeat-containing protein 71 (SMED30028668) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine-rich repeat-containing protein 71 (SMED30028668) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine-rich repeat-containing protein 71 (SMED30028668) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028668

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028668SMESG000006778.1 SmedASXL_016179SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30028668SMESG000006778.1 dd_Smed_v4_12043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30028668SMESG000006778.1 dd_Smed_v4_12043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30028668SMESG000006778.1 dd_Smed_v4_12043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30028668SMESG000006778.1 dd_Smed_v6_10715_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30028668SMESG000006778.1 dd_Smed_v6_12043_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30028668SMESG000006778.1 dd_Smed_v4_12043_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Human
Match: LRRC71 (leucine rich repeat containing 71 [Source:HGNC Symbol;Acc:HGNC:26556])

HSP 1 Score: 191.815 bits (486), Expect = 4.556e-53
Identity = 178/563 (31.62%), Postives = 276/563 (49.02%), Query Frame = 3
Query:   66 AMGKKTEKAIKEKP--TVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCE-TIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPLSRRGDQK-DRPVS--VRXXXXXXXXXXXXINAVK-----GKKDPKEEKHETKNPK--SKKDDSKLVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQADNM---SEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQN--SALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRD 1700
            A+ KK E+A KEKP   +    E   K+PE YQC G   TDF EL            C R   G+T                   K   RP+   H P     S  +K ++DD  P +  S         ++  +   +P + VE +  D   +V EI +R W V+  ++ +F  C   LT+L  I+ W+VGLT + ++   E L  C  T++ +++E N     ++YH+L+  DS +  ++LR  NI   GA+L+   L TL ++ N  L+ L+L    +GD GA ++A  L++NR+LL LSL++  I D G ++LA+++  + LT  E+  RR+++ E+   E ++S S   SR GD K DR  S  V  S+    +K +K   +K     GKK  K  +   K  K  S +  ++  P K+D  K         + K SR+  +   + +  ++   SE   E  + ++PLL  VE  + GK+ + GN +LL LNL RNRI E G+E   A + +Q   S   S+     GLL L L  N F+     Y +IQ ++L RD
Sbjct:   25 AVTKKGERAAKEKPATVLPPVGEEEPKSPEEYQCSGVLETDFAEL------------CTR--WGYTDF----------------PKVVNRPR--PHPPFVPSASLSEKATLDD--PRLSGSCSLN----SLESKYVFFRPTIQVELEQEDS-KSVKEIYIRGWKVEERILGVFSKCLPPLTQLQAINLWKVGLTDKTLTTFIELLPLCSSTLRKVSLEGN-PLPEQSYHKLMALDSTIAHLSLRNNNIDDRGAQLLGQALSTL-HSCNRTLVSLNLGFNHIGDEGAGYIADGLRLNRSLLWLSLAHNRIQDKGALKLAEVLRAFELTHTEVVERRRLLLEKGTQERSRSPS--SSRHGDSKTDREKSQMVGISNSALVDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDATKAGKGKVTIPEQKPSRAKGIKIGSREKRSILLESELVVEATEVVNPLLEPVEHRD-GKVFMPGNKVLLHLNLIRNRITEVGLEGFLATVQYQMQFSKAKSASKGPVGLLWLSLAKNCFAPQCPAYAIIQELMLPRD 543          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Human
Match: LRRC34 (leucine rich repeat containing 34 [Source:HGNC Symbol;Acc:HGNC:28408])

HSP 1 Score: 58.151 bits (139), Expect = 2.871e-8
Identity = 41/132 (31.06%), Postives = 65/132 (49.24%), Query Frame = 3
Query:  636 LTSEAISQLAETLSKCETIKFLTIENNQEASSENYH--ELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQ 1025
            +T E    L++ L  C  I  L +  N       Y+  +L++   NL  +NL + +I P+G +LIA  L       N  L  L +TG  + + G +F A  L+IN +L  L L +CD+G    I  A +++Q
Sbjct:  107 VTGEDFWILSKILKNCLYINGLDVGYNLLCDVGAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHK-----NRTLKYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLGMQSVIAFATVLTQ 233          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Human
Match: LRRC34 (leucine rich repeat containing 34 [Source:HGNC Symbol;Acc:HGNC:28408])

HSP 1 Score: 57.7658 bits (138), Expect = 3.304e-8
Identity = 41/132 (31.06%), Postives = 65/132 (49.24%), Query Frame = 3
Query:  636 LTSEAISQLAETLSKCETIKFLTIENNQEASSENYH--ELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQ 1025
            +T E    L++ L  C  I  L +  N       Y+  +L++   NL  +NL + +I P+G +LIA  L       N  L  L +TG  + + G +F A  L+IN +L  L L +CD+G    I  A +++Q
Sbjct:   46 VTGEDFWILSKILKNCLYINGLDVGYNLLCDVGAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHK-----NRTLKYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLGMQSVIAFATVLTQ 172          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Human
Match: NOD2 (nucleotide binding oligomerization domain containing 2 [Source:HGNC Symbol;Acc:HGNC:5331])

HSP 1 Score: 54.6842 bits (130), Expect = 5.392e-7
Identity = 56/211 (26.54%), Postives = 96/211 (45.50%), Query Frame = 3
Query:  450 IKPTFCALKP----ALCVETDNADKP-------DNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDE 1043
            +K TFC++ P    AL     +  +P       ++V +I V +      ++   G+C     +   IS          I +L E    CE ++ L + NN+  +  + +  +L+    N   + L    IT  GA+++A+ L      GN+ L  L   G  +GD GA  LA AL  +++L  LSL   +IG  G   LA M+++ ++ +E
Sbjct:  767 LKLTFCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQ------LLPCLGVCKALYLRDNNIS-------DRGICKLIECALHCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGL-----RGNTSLQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEE 959          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Human
Match: NOD2 (nucleotide binding oligomerization domain containing 2 [Source:HGNC Symbol;Acc:HGNC:5331])

HSP 1 Score: 54.299 bits (129), Expect = 6.808e-7
Identity = 56/211 (26.54%), Postives = 96/211 (45.50%), Query Frame = 3
Query:  450 IKPTFCALKP----ALCVETDNADKP-------DNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDE 1043
            +K TFC++ P    AL     +  +P       ++V +I V +      ++   G+C     +   IS          I +L E    CE ++ L + NN+  +  + +  +L+    N   + L    IT  GA+++A+ L      GN+ L  L   G  +GD GA  LA AL  +++L  LSL   +IG  G   LA M+++ ++ +E
Sbjct:  740 LKLTFCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQ------LLPCLGVCKALYLRDNNIS-------DRGICKLIECALHCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGL-----RGNTSLQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEE 932          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Zebrafish
Match: si:ch211-81a5.5 (si:ch211-81a5.5 [Source:ZFIN;Acc:ZDB-GENE-060503-892])

HSP 1 Score: 137.502 bits (345), Expect = 1.768e-34
Identity = 147/501 (29.34%), Postives = 250/501 (49.90%), Query Frame = 3
Query:  300 GKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDF-C--------PEVVNSIGFK--PRTFVIKPTFCALK-----PALC--VETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMM---SERNMMESAKSVSPPLSRRGDQKDRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETKNPKSKKDDSKLVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQADNM--SEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRDHKAKSSNSETE 1733
             +K SK DK    ++ +P  +        + DD+ C        PE+   +G K  P   V +P     +     P  C  +E +N +  +NV E+ +  W VD  ++++      SL+ L  +  WR+GLT    + +  T+S C  ++ + +E N     ++YH L+  DS LT+++LR   I  +GA+LI   L    ++ N  L  L+L    +GD GA+ +A+ L++NR+LLSLSLS   IGD+G   LA+++  + LT EEI  RR+++    + NM++S+      L    D  +  +SV S+S  D+  K   +  K + +PK+E+   ++P +KK+++K+   KKDN        KA +S+  +    + L ++ +    S+A    +D++ PLL        GK++  GN  L  LNLS N + E  ++   +++  Q            GLL+L L  NRF    D +  IQ M+  +   +K+S S+ E
Sbjct:    5 AEKPSKVDKVDSAIEEEPKPK--------TADDYQCSGHLQLEFPELCKLMGVKEIPSVKVKRPRILESRMTKWSPGRCLQIELENEEH-NNVKEVKISGWTVDELMLQVLSKILPSLSNLLCLRMWRIGLTDGTFTSMKNTVSLCSNLRKVVLEGN-PLPEQSYHLLLGEDSMLTELSLRNNRIGEEGARLIGSALSN-PHSANKNLRSLNLAYNRIGDAGALHIAQGLRLNRSLLSLSLSYNHIGDNGAARLAEVLGPFALTHEEIVERRKLLIKGDQSNMVQSS------LVSLADSHEPALSVPSNSSLDQISKSAKHTTKKRDNPKKEEKPAQSPAAKKEEAKVA--KKDN--------KAPRSQAGKGKDKNLLVSEQEGTSPSQAVEVTVDTVIPLLDPGIVHTGGKVIHPGNTCLTSLNLSGNELSEQSLKVFLSSLESQ---------CEGGLLRLSLSKNRFPSDCDTFLKIQEMMSQKHPLSKNSTSQME 469          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Zebrafish
Match: nod2 (nucleotide-binding oligomerization domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-061108-4])

HSP 1 Score: 58.9214 bits (141), Expect = 1.389e-8
Identity = 45/132 (34.09%), Postives = 70/132 (53.03%), Query Frame = 3
Query:  636 LTSEAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQ 1025
            ++ E I +L E   +CE  + + + NN+  +  ++ +  L+KS  N   + L   NIT  GA+ +A+ L     + N  L  L L G  +GD GA  LA AL  ++TL+ LSL +  +G +G   LAK I Q
Sbjct:  795 ISDEGIRKLLEKGIECENFQKIALFNNKLTDTCTQYFSCLLKSKQNFLALRLGNNNITSVGAEQLAEGL-----SYNQSLQFLGLWGNKVGDRGAEVLADALTNSKTLIWLSLVDNGVGSAGACALAKFIRQ 921          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Xenopus
Match: emp3 (epithelial membrane protein 3 [Source:Xenbase;Acc:XB-GENE-952486])

HSP 1 Score: 209.149 bits (531), Expect = 7.870e-60
Identity = 185/567 (32.63%), Postives = 271/567 (47.80%), Query Frame = 3
Query:   69 MGKKTEKAIKEKPTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPLSRRGDQK-DRPVSVRXXXXXXXXXXXXINAVKGK-----------KDPKEEKHET-----------KNPKSKKDDSKLVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRD 1700
            MGKK+EKA K+K      E+    + + YQC G    DF EL            C R   GFT + +   +  +            R  V    P SE+ + +D D   D      N  G  P     K  F   KP + VET+  D   +V  I V  W +D  ++ +F  C  +LT L  IS W V LT    SQ  E L  C  IK + +E N     ++Y++LI     L +++LR   IT DGAKLI++ L  L  T N  L  L+L+   + D GA +LA AL+I+R+LL L LS+  IGD G + LA+++  + LT +EI  RR+++ +++  E  +S  P LSR GD + DRP S +S +  +K +K    +   K              KEEK  T           +  ++KK+D K    +  N +      K ++S  S+   L++         E   E  +  HPLL   E+ + GK+ + GN +L+ LNL RNRI E G+  L AA+  Q S LI    S TGLL+L +  N F   N+ +  +Q ++L+RD
Sbjct:    1 MGKKSEKAQKDKVAAGNAEDESRNSGD-YQCTGILEQDFPEL------------CGR--AGFTESEIPRVTLCH------------RTAVT---PTSEKNAADDSDGASD----KDNPGGGGP----TKDKFSYFKPKIEVETEGEDG-KSVKVIFVHGWKIDHRMMGIFSKCLPALTALQGISLWNVALTESTFSQFLEILPHCPNIKTVVLEGN-PLPEQSYYKLISDHLPLVRISLRNNMITDDGAKLISEALQALKTT-NKNLATLNLSFNHISDLGAGYLAEALRIDRSLLCLDLSHNQIGDQGTLALAEVLGPFPLTHKEIVERRRLLMDKDSHELQRS--PTLSRNGDARNDRPQSHQSYAAVEKPEKAPAASKTNKSMAKKKDKDKDPQKKEEKSTTSLQGGNSTVSGQGGQAKKEDPKAAKKQLPNPEQKNSKVKPVRS-ASKRVPLTE--------HELHVEPAEITHPLLEPAESRD-GKVFLPGNRVLINLNLLRNRITEKGLNGLLAAVEAQESKLIPGSKSHTGLLRLCVGKNLFPPDNETFIKLQELMLSRD 514          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Xenopus
Match: emp3 (epithelial membrane protein 3 [Source:Xenbase;Acc:XB-GENE-952486])

HSP 1 Score: 206.068 bits (523), Expect = 1.730e-58
Identity = 187/578 (32.35%), Postives = 271/578 (46.89%), Query Frame = 3
Query:   69 MGKKTEKAIKEKPTVQTTE-----------EIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPLSRRGDQK-DRPVSVRXXXXXXXXXXXXINAVKGK-----------KDPKEEKHET-----------KNPKSKKDDSKLVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRD 1700
            MGKK+EKA K+K      E           E  + T   YQC G    DF EL            C R   GFT + +   +  +            R  V    P SE+ + +D D   D      N  G  P     K  F   KP + VET+  D   +V  I V  W +D  ++ +F  C  +LT L  IS W V LT    SQ  E L  C  IK + +E N     ++Y++LI     L +++LR   IT DGAKLI++ L  L  T N  L  L+L+   + D GA +LA AL+I+R+LL L LS+  IGD G + LA+++  + LT +EI  RR+++ +++  E  +S  P LSR GD + DRP S +S +  +K +K    +   K              KEEK  T           +  ++KK+D K    +  N +      K ++S  S+   L++         E   E  +  HPLL   E+ + GK+ + GN +L+ LNL RNRI E G+  L AA+  Q S LI    S TGLL+L +  N F   N+ +  +Q ++L+RD
Sbjct:    1 MGKKSEKAQKDKVAAGNAEDESRNSANASMERASLTVGDYQCTGILEQDFPEL------------CGR--AGFTESEIPRVTLCH------------RTAVT---PTSEKNAADDSDGASD----KDNPGGGGP----TKDKFSYFKPKIEVETEGEDG-KSVKVIFVHGWKIDHRMMGIFSKCLPALTALQGISLWNVALTESTFSQFLEILPHCPNIKTVVLEGN-PLPEQSYYKLISDHLPLVRISLRNNMITDDGAKLISEALQALKTT-NKNLATLNLSFNHISDLGAGYLAEALRIDRSLLCLDLSHNQIGDQGTLALAEVLGPFPLTHKEIVERRRLLMDKDSHELQRS--PTLSRNGDARNDRPQSHQSYAAVEKPEKAPAASKTNKSMAKKKDKDKDPQKKEEKSTTSLQGGNSTVSGQGGQAKKEDPKAAKKQLPNPEQKNSKVKPVRS-ASKRVPLTE--------HELHVEPAEITHPLLEPAESRD-GKVFLPGNRVLINLNLLRNRITEKGLNGLLAAVEAQESKLIPGSKSHTGLLRLCVGKNLFPPDNETFIKLQELMLSRD 526          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Xenopus
Match: emp3 (epithelial membrane protein 3 [Source:Xenbase;Acc:XB-GENE-952486])

HSP 1 Score: 142.895 bits (359), Expect = 1.028e-36
Identity = 126/398 (31.66%), Postives = 188/398 (47.24%), Query Frame = 3
Query:  453 KPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPLSRRGDQK-DRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETKNPKSKKDDSKLVPG-KKDNAKVAIDMTKAIKSKVSRSGRL-----SKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKL 1625
            K  F   KP + VET+  D   +V  I V  W +D  ++ +F  C  +LT L                         + I+ + +E N     ++Y++LI     L +++LR   IT DGAKLI++ L  L  T N  L  L+L+   + D GA +LA AL+I+R+LL L LS+  IGD G + LA+++  + LT +EI  RR+++ +++  E  +  SP LSR GD + DRP S +S +  +          K +K P   K      K K  D    P     +  + I     +       G L      K       + +   E  +  HPLL   E+ + GK+ + GN +L+ LNL RNRI E G+  L AA+  Q S LI    S TGLL+L
Sbjct:   26 KDKFSYFKPKIEVETEGEDG-KSVKVIFVHGWKIDHRMMGIFSKCLPALTAL-------------------------QGIRTVVLEGN-PLPEQSYYKLISDHLPLVRISLRNNMITDDGAKLISEALQALKTT-NKNLATLNLSFNHISDLGAGYLAEALRIDRSLLCLDLSHNQIGDQGTLALAEVLGPFPLTHKEIVERRRLLMDKDSHELQR--SPTLSRNGDARNDRPQSHQSYAAVE----------KPEKAPAASKTNKSMAKKKDKDKVCCPVLAVSHYHLCIWAIPGLVRMFPSQGNLRYSVCRKEQKSVYFLPQLHVEPAEITHPLLEPAESRD-GKVFLPGNRVLINLNLLRNRITEKGLNGLLAAVEAQESKLIPGSKSHTGLLRL 382          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Xenopus
Match: lrrc34 (leucine rich repeat containing 34 [Source:NCBI gene;Acc:100127617])

HSP 1 Score: 51.9878 bits (123), Expect = 1.880e-6
Identity = 43/147 (29.25%), Postives = 69/147 (46.94%), Query Frame = 3
Query:  663 AETLSKCETIKFLTIENNQEASSENY---HELIKSDSNLTKVNLRYCNITPDGAKLIA----------------DELGT-------LTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQ 1025
            A TL  C   + + +   Q  S E++    +++  +S +T ++LRY  +T +GA  IA                +E+GT            N+ LL L +TG  +G+ G +  A  L+IN TL  L L +CD+G    I LA ++ Q
Sbjct:   38 ASTLKLCGNNRLVQV---QRVSDEDFLVLAQVLSKNSFITNLDLRYNRVTDNGAAHIATFLQNNSSVLCLNIMGNEIGTDGSEHITKALHRNTTLLSLRMTGNKIGNKGGMLFASMLQINSTLEELDLGDCDLGIQSLIALATVLLQ 181          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Mouse
Match: Lrrc71 (leucine rich repeat containing 71 [Source:MGI Symbol;Acc:MGI:1921735])

HSP 1 Score: 169.474 bits (428), Expect = 3.274e-45
Identity = 166/565 (29.38%), Postives = 273/565 (48.32%), Query Frame = 3
Query:   66 AMGKKTEKAIKEK--PTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCE-TIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPLSRRGDQK---DRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETKNPKSKKDD-------SKLVPGKKDNA-----KVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISF--QNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRD 1700
            A+ KK ++A K+K   T+    E   K PE YQC G   TDF EL      GY     +   K  T   +   S  +    +K   DD+RP        S   SQ   +S                        +   +P + VE +  D    V EI +R W V+  ++ +F  C  SL++L  I+ W+VGLT + ++     L  C  T++ +++E N     +++ +L+  DS +  ++LR  NI   GA+L+   L TL  + N  L+ L+L    +GD GA ++A  L++NR+LL LSL++  I D G ++LA+++  + LT  E+  RR+++  +   E ++S S   SR GD K   ++  ++  S+    +K+EK+ ++K  K   ++K +T     K++        ++  P K+D A     KV I   K  K K ++ G   K +   ++  +   E  + ++PLL  VE  + GK+ + GN +LL LNL RN+I E G+E    A+ +  Q S   +S  +  GLL L L  N F      + +IQ ++L RD
Sbjct:   25 AVTKKGDRAAKDKTASTLPPVGEDEPKNPEEYQCTGVLETDFAELCTRS--GY-----VDFPKVVTRPRVQQSSVPSASTSEKPVLDDQRP--------SASCSQSSLES-----------------------KYVFFRPTIQVELEQEDS-KAVKEIYIRGWKVEDRILGIFSKCLPSLSQLQAINLWKVGLTDKTLTTFIALLPLCSSTLRKVSLEGN-PIPEQSFSKLMGLDSTIVHLSLRNNNINDHGAQLLGQALSTLQNS-NRTLVSLNLAFNHIGDVGAGYIADGLRLNRSLLWLSLAHNHIQDKGALKLAEVLRPFELTHREVVERRRLLLVKGTQERSRSPS--SSRYGDSKAEREKSQTLGISNVTLVDKQEKMQSLKAPKTISKKKEKTGEVVKKEEKLGSGQSPTQGTPKKEDAAKAGKGKVTIPEQKMSKGKATKMGAKEKRSILLES-EQLVVEATEMVNPLLEPVEHRD-GKVFLPGNKVLLHLNLLRNQITEVGLEGFLTAVQYQVQVSKPKTSPKAPLGLLWLSLAKNCFDPQCPTHVMIQELMLPRD 544          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Mouse
Match: Lrrc71 (leucine rich repeat containing 71 [Source:MGI Symbol;Acc:MGI:1921735])

HSP 1 Score: 57.3806 bits (137), Expect = 2.664e-9
Identity = 37/98 (37.76%), Postives = 54/98 (55.10%), Query Frame = 3
Query: 1413 ENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISF--QNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRD 1700
            E  + ++PLL  VE  + GK+ + GN +LL LNL RN+I E G+E    A+ +  Q S   +S  +  GLL L L  N F      + +IQ ++L RD
Sbjct:   43 EATEMVNPLLEPVEHRD-GKVFLPGNKVLLHLNLLRNQITEVGLEGFLTAVQYQVQVSKPKTSPKAPLGLLWLSLAKNCFDPQCPTHVMIQELMLPRD 139          
BLAST of Leucine-rich repeat-containing protein 71 vs. UniProt/SwissProt
Match: sp|Q8N4P6|LRC71_HUMAN (Leucine-rich repeat-containing protein 71 OS=Homo sapiens OX=9606 GN=LRRC71 PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 2.188e-52
Identity = 178/563 (31.62%), Postives = 276/563 (49.02%), Query Frame = 3
Query:   66 AMGKKTEKAIKEKP--TVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCE-TIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPLSRRGDQK-DRPVS--VRXXXXXXXXXXXXINAVK-----GKKDPKEEKHETKNPK--SKKDDSKLVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQADNM---SEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQN--SALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRD 1700
            A+ KK E+A KEKP   +    E   K+PE YQC G   TDF EL            C R   G+T                   K   RP+   H P     S  +K ++DD  P +  S         ++  +   +P + VE +  D   +V EI +R W V+  ++ +F  C   LT+L  I+ W+VGLT + ++   E L  C  T++ +++E N     ++YH+L+  DS +  ++LR  NI   GA+L+   L TL ++ N  L+ L+L    +GD GA ++A  L++NR+LL LSL++  I D G ++LA+++  + LT  E+  RR+++ E+   E ++S S   SR GD K DR  S  V  S+    +K +K   +K     GKK  K  +   K  K  S +  ++  P K+D  K         + K SR+  +   + +  ++   SE   E  + ++PLL  VE  + GK+ + GN +LL LNL RNRI E G+E   A + +Q   S   S+     GLL L L  N F+     Y +IQ ++L RD
Sbjct:   25 AVTKKGERAAKEKPATVLPPVGEEEPKSPEEYQCSGVLETDFAEL------------CTR--WGYTDF----------------PKVVNRPR--PHPPFVPSASLSEKATLDD--PRLSGSCSLN----SLESKYVFFRPTIQVELEQEDS-KSVKEIYIRGWKVEERILGVFSKCLPPLTQLQAINLWKVGLTDKTLTTFIELLPLCSSTLRKVSLEGN-PLPEQSYHKLMALDSTIAHLSLRNNNIDDRGAQLLGQALSTL-HSCNRTLVSLNLGFNHIGDEGAGYIADGLRLNRSLLWLSLAHNRIQDKGALKLAEVLRAFELTHTEVVERRRLLLEKGTQERSRSPS--SSRHGDSKTDREKSQMVGISNSALVDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDATKAGKGKVTIPEQKPSRAKGIKIGSREKRSILLESELVVEATEVVNPLLEPVEHRD-GKVFMPGNKVLLHLNLIRNRITEVGLEGFLATVQYQMQFSKAKSASKGPVGLLWLSLAKNCFAPQCPAYAIIQELMLPRD 543          
BLAST of Leucine-rich repeat-containing protein 71 vs. UniProt/SwissProt
Match: sp|Q9D3W5|LRC71_MOUSE (Leucine-rich repeat-containing protein 71 OS=Mus musculus OX=10090 GN=Lrrc71 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 2.290e-44
Identity = 166/565 (29.38%), Postives = 273/565 (48.32%), Query Frame = 3
Query:   66 AMGKKTEKAIKEK--PTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCE-TIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPLSRRGDQK---DRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETKNPKSKKDD-------SKLVPGKKDNA-----KVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISF--QNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRD 1700
            A+ KK ++A K+K   T+    E   K PE YQC G   TDF EL      GY     +   K  T   +   S  +    +K   DD+RP        S   SQ   +S                        +   +P + VE +  D    V EI +R W V+  ++ +F  C  SL++L  I+ W+VGLT + ++     L  C  T++ +++E N     +++ +L+  DS +  ++LR  NI   GA+L+   L TL  + N  L+ L+L    +GD GA ++A  L++NR+LL LSL++  I D G ++LA+++  + LT  E+  RR+++  +   E ++S S   SR GD K   ++  ++  S+    +K+EK+ ++K  K   ++K +T     K++        ++  P K+D A     KV I   K  K K ++ G   K +   ++  +   E  + ++PLL  VE  + GK+ + GN +LL LNL RN+I E G+E    A+ +  Q S   +S  +  GLL L L  N F      + +IQ ++L RD
Sbjct:   25 AVTKKGDRAAKDKTASTLPPVGEDEPKNPEEYQCTGVLETDFAELCTRS--GY-----VDFPKVVTRPRVQQSSVPSASTSEKPVLDDQRP--------SASCSQSSLES-----------------------KYVFFRPTIQVELEQEDS-KAVKEIYIRGWKVEDRILGIFSKCLPSLSQLQAINLWKVGLTDKTLTTFIALLPLCSSTLRKVSLEGN-PIPEQSFSKLMGLDSTIVHLSLRNNNINDHGAQLLGQALSTLQNS-NRTLVSLNLAFNHIGDVGAGYIADGLRLNRSLLWLSLAHNHIQDKGALKLAEVLRPFELTHREVVERRRLLLVKGTQERSRSPS--SSRYGDSKAEREKSQTLGISNVTLVDKQEKMQSLKAPKTISKKKEKTGEVVKKEEKLGSGQSPTQGTPKKEDAAKAGKGKVTIPEQKMSKGKATKMGAKEKRSILLES-EQLVVEATEMVNPLLEPVEHRD-GKVFLPGNKVLLHLNLLRNQITEVGLEGFLTAVQYQVQVSKPKTSPKAPLGLLWLSLAKNCFDPQCPTHVMIQELMLPRD 544          
BLAST of Leucine-rich repeat-containing protein 71 vs. UniProt/SwissProt
Match: sp|Q53B88|NOD2_HYLLA (Nucleotide-binding oligomerization domain-containing protein 2 OS=Hylobates lar OX=9580 GN=NOD2 PE=3 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 4.298e-8
Identity = 57/211 (27.01%), Postives = 98/211 (46.45%), Query Frame = 3
Query:  450 IKPTFCALKPALCVET----DNADKP-------DNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDE 1043
            +K TFC++ PA C        +  +P       ++V +I V +      ++   G+C     +   IS          I +L E    CE ++ L + NN+  +  + +  +L+    N   + L   +ITP GA+++A+ L      GN+ L  L   G  +GD GA  LA AL  +++L  LSL   +IG  G   LA M+++ ++ +E
Sbjct:  767 LKLTFCSVGPAECAALAFVLQHLRRPVALQLDYNSVGDIGVEQ------LLPCLGVCKALYLRDNNIS-------DRGICKLIECALHCEQLQKLVLFNNKLTDGCAHSMAKLLACRQNFLALRLGNNHITPAGAQVLAEGL-----RGNTSLQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEE 959          
BLAST of Leucine-rich repeat-containing protein 71 vs. UniProt/SwissProt
Match: sp|Q8IZ02|LRC34_HUMAN (Leucine-rich repeat-containing protein 34 OS=Homo sapiens OX=9606 GN=LRRC34 PE=2 SV=3)

HSP 1 Score: 58.151 bits (139), Expect = 1.379e-7
Identity = 41/132 (31.06%), Postives = 65/132 (49.24%), Query Frame = 3
Query:  636 LTSEAISQLAETLSKCETIKFLTIENNQEASSENYH--ELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQ 1025
            +T E    L++ L  C  I  L +  N       Y+  +L++   NL  +NL + +I P+G +LIA  L       N  L  L +TG  + + G +F A  L+IN +L  L L +CD+G    I  A +++Q
Sbjct:  107 VTGEDFWILSKILKNCLYINGLDVGYNLLCDVGAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHK-----NRTLKYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLGMQSVIAFATVLTQ 233          
BLAST of Leucine-rich repeat-containing protein 71 vs. UniProt/SwissProt
Match: sp|Q53B87|NOD2_PANTR (Nucleotide-binding oligomerization domain-containing protein 2 OS=Pan troglodytes OX=9598 GN=NOD2 PE=3 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.562e-6
Identity = 56/211 (26.54%), Postives = 95/211 (45.02%), Query Frame = 3
Query:  450 IKPTFCALKPALCVET----DNADKP-------DNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDE 1043
            +K TFC++ PA C        +  +P       ++V +I V +      ++   G+C     +   IS          I +L E    CE ++ L + NN+  +  + +  +L+    N   + L    IT  GA+++A  L      GN+ L  L   G  +GD GA  LA AL  +++L  LSL   +IG  G   LA M+++ ++ +E
Sbjct:  767 LKLTFCSVGPAECAALAFVLQHLRRPVALQLDYNSVGDIGVEQ------LLPCLGVCKALYLRDNNIS-------DRGICKLIECALHCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAQGL-----RGNTSLQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEE 959          
BLAST of Leucine-rich repeat-containing protein 71 vs. TrEMBL
Match: A0A0B7BKQ4 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF195344 PE=4 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 1.114e-91
Identity = 201/526 (38.21%), Postives = 295/526 (56.08%), Query Frame = 3
Query:   69 MGKKTEKAI-KEK---PTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFK--PRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPLSRRGDQKDRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETKNPKSKKDDSK------------------LVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQ 1574
            MGKK EK++ KE+   P  +T E  +NKT EPY+C GNF+ DFTEL +++   Y   V  R K     + + SDS  + +A KK     +   + + + DSE                 +N   F+  P+T+ I+  F   KP++ VE DN DK D VTE+SV+ W VD  ++++F   +  L+KL T++FW VGLT E +  LA  L  C  +K L ++ N     +N+ ELI   S +  ++LRYCNIT +GA  +A  LGT  Y  N+KL+ L+L+G  +GD+GA  LA  L+INRTLLSL+L+N +IGD G I++++ +S++ LT EE+  RR+MMS++  +E     SP  SRR D +DRP SV S S      K+K+   K +   K+ K +TK PK +K+D+K                   V G+  +A  A+D TK+      +     K  + ADN     +++ D I PLL   E I+ G+L I+GN ML+ LNLSRN+IGE G+     A+ +Q
Sbjct:    1 MGKKVEKSVSKERQPNPAGRTEETDLNKTTEPYKCNGNFLVDFTELCKQRQMTYIPSVITRPKLQILQSIVTSDSKLDKKADKK-----QAAVISETEHDSE-----------------INEAVFEGPPKTYTIRDKFSFFKPSVQVELDNNDKWDTVTELSVKGWKVDEPMMDVFQHSWIHLSKLHTVNFWNVGLTEETLHTLAIFLPHCANVKNLILDGNT-GPQQNWSELIGEKSLIQNLSLRYCNITDNGAAEMAKLLGTAKY-ANTKLISLNLSGNLIGDYGAAQLAEGLRINRTLLSLTLTNNNIGDQGAIKISEALSRFPLTHEEVVMRRKMMSDKGSIERK---SPLPSRRADSRDRPGSV-SKSLPADKSKQKLPPKKKESKGKDLKEDTKTPKKEKEDTKGASRKEPRGIRGAPANQNAVTGRMSSAS-AVDATKSQSKTKDKKKERGKFTSDADN-----ADSQDQISPLLDAAEYID-GQLWIAGNRMLINLNLSRNKIGEIGIAAFLQAMQYQ 491          
BLAST of Leucine-rich repeat-containing protein 71 vs. TrEMBL
Match: A0A267FIU4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021745g1 PE=4 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 8.014e-86
Identity = 204/576 (35.42%), Postives = 316/576 (54.86%), Query Frame = 3
Query:   69 MG-KKTEKAIKEKPTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMS---ERNM---------MESAKSVSPPLSRRGDQKDRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETKNP-KSKKDDSKLVPGK------KDNAKVAIDMTKAIKSKVSRSGRLSKLNNQAD---NMSEAASENMDSIHPLLHKVE-AIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRDHKAKSSNS 1724
            MG KK++K+ +       +EE  +K  E YQ  GNF +DF EL +E       PV +R K+   ++ + ++  +     +K +K+DK+  + Q   + E+ + E+K         V+  +GFKP+TF +K     +KP + ++ +N DKPD V+E+  + W ++  +++  G CF  L +L TI FWRV  ++E I++LAE L + ++++ L++E N   + ENY +LI+ DSNLTK+ LR+  IT  GA  I+++L  L     SKL+ LDL+   + D GA  LA+AL+ NRTL+ LSLSN  + D G   LA+  S++ LT EE   RR+++S   ER             S+ +V+PP SRRG   DRPVSVRS  ++              K   + K E K   K++K+DSK   GK      KD+   A  +        + S        +      + +  S+  DS HPLL +V+ A  PG LL+ GN +L +LNLSRN+I + GV +   AIS+Q + +   K + TGL+KL LQGN FS  ++ Y+++Q  + +RD    SSN+
Sbjct:    7 MGRKKSDKSAR-------SEEQEDKVNESYQPTGNFQSDFVELCKEMKMYRPPPVFLRPKR--PSSPIQNEQQTQAPTNRK-AKEDKKASMAQQMFEPEEETPEEK--------AVIEQLGFKPKTFTVKYYLDLMKPCVHIDLENPDKPDTVSEVHAKNWKLELPMLKTLGRCFEKLNRLHTIVFWRVAASAEVIAELAELLRQLDSVRCLSLEANGHVTDENYADLIRVDSNLTKLQLRFNQITDAGAARISEQLSGLR-DPPSKLVSLDLSSNCVQDGGATALAQALRTNRTLIHLSLSNNRVSDRGATALAESCSRFYLTHEETVERRRLLSTAAERRTGLSPESCQSRPSSSAVTPPPSRRG-AADRPVSVRSGQEKLGRTGGTGKTPGKGKKDDKAKPEEKAKNKAQKEDSK-AKGKGAQASEKDSKSSAATLKSGKGKGGNNSSSSGGGRVKVSTPLQLDQEESQPPDSDHPLLERVDTAYAPGYLLVPGNHVLALLNLSRNQITDKGVLQWKTAISYQLAYMSKQKVNGTGLMKLLLQGNPFSTESESYRILQQAMSSRDPVGSSSNT 561          
BLAST of Leucine-rich repeat-containing protein 71 vs. TrEMBL
Match: A0A267E108 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021745g2 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 1.717e-85
Identity = 203/576 (35.24%), Postives = 315/576 (54.69%), Query Frame = 3
Query:   69 MG-KKTEKAIKEKPTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMS---ERNM---------MESAKSVSPPLSRRGDQKDRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETKNP-KSKKDDSKLVPGK------KDNAKVAIDMTKAIKSKVSRSGRLSKLNNQAD---NMSEAASENMDSIHPLLHKVE-AIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRDHKAKSSNS 1724
            MG KK++K+ +       +EE  +K  E YQ  GNF +DF EL +E       PV +R K+   ++ + ++  +     +K +K+DK+  + Q   + E+ + E+K         V+  +GFKP+TF +K     +KP + ++ +N DKPD V+E+  + W ++  +++  G CF  L +L TI FWRV  ++E I++LAE L + ++++ L++E N   + ENY +LI+ DSNLTK+ LR+  IT  GA  I+++L  L     SKL+ LDL+   + D GA  LA+AL+ NRTL+ LSLSN  + D G   LA+  S++ LT EE   RR+++S   ER             S+ +V+PP SRRG   DRPVSVRS  ++              K   + K E K   K++K+DSK   GK      KD+   A  +        + S        +      + +  S+  DS HPLL +V+ A  PG LL+ GN +L +LNLSRN I + GV +   A+S+Q + +   K + TGL+KL LQGN FS  ++ Y+++Q  + +RD    SSN+
Sbjct:    7 MGRKKSDKSAR-------SEEQEDKVNESYQPTGNFQSDFVELCKEMKMYRPPPVFLRPKR--PSSPIQNEQQTQAPTNRK-AKEDKKASMAQQMVEPEEETPEEK--------AVIEQLGFKPKTFTVKYYLDLMKPCVHIDLENPDKPDTVSEVHAKNWKLELPMLKTLGRCFEKLNRLHTIVFWRVAASAEVIAELAELLRQLDSVRCLSLEANGHVTDENYADLIRVDSNLTKLQLRFNQITDAGAARISEQLSGLR-DPPSKLVSLDLSSNCVQDGGATALAQALRTNRTLIHLSLSNNRVSDRGATALAESCSRFYLTHEETVERRRLLSTAAERRTGLSPESCQSRPSSSAVTPPPSRRG-AADRPVSVRSGQEKLGRTGGTGKTPGKGKKDDKAKPEEKAKNKAQKEDSK-AKGKGAQASEKDSKSSAATLKSGKGKGGNNSSSSGGGRVKVSTPLQLDQEESQPPDSDHPLLERVDTAYAPGYLLVPGNHVLTLLNLSRNLITDKGVLQWKTAVSYQLAYMSKQKVNGTGLMKLLLQGNPFSTESESYRILQQAMSSRDPVGSSSNT 561          
BLAST of Leucine-rich repeat-containing protein 71 vs. TrEMBL
Match: A0A3Q0KNQ3 (Putative leucine rich repeat-containing OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 1.779e-85
Identity = 200/560 (35.71%), Postives = 296/560 (52.86%), Query Frame = 3
Query:   69 MGKKTEKAIKEKPTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPLSRRGDQKDRPV--SVRXXXXXXXXXXXXINAVKGK--KDPKEEKHETKNPKSKKDDSKLVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSS---RTGLLKLFLQGNRFSDSNDKYQLIQNMILNRDHKAKSSNSE 1727
            MGKK+ K   + P V      +   P+ Y   GN   DF  L ++    +   V  +  +      ++S  +S      K SKDDK+              Q    S+  +  E+   +GF P TF +  T   LKP + ++ +N DKP+ V E+S++ W + +S +++   CF    KL+ + FWRVG T+E I+QLA  LS   TIK LTI+ N+     +Y +LI   +NLTK+ LRYC I P  AK I+  LGT+ Y  N KL+ LDL+G  LGD G I+LA AL+ NRTLL+LS+SN  I D GCI LAK+ISQ+ LT EEI  RR   SE++  ES    S PL RR  +       + + S++     K++  +V+G+  KD    K +    K KK DS   P K +  +       + KSK  R+ R +K  +  + + E++ E  + I+P+L K   +EP  LLI GNF+L  LNLSRN IG +G++ L  AI++Q + L    ++    TG+L L    N F+   +    I  ++ +RD  A+  N++
Sbjct:    1 MGKKSAK--DKSPKVGDLH--ITSDPKDYVVTGNLENDFHGLCKQSGVTHCPVVSTKHSQAIITQTVSSLPSS------KRSKDDKKS------------PQSQNSSVTKYSDEIQPPLGFNPTTFKLCKTLEYLKPKIIIQQENPDKPETVNEVSIKGWKISNSQLDVLIKCFSVANKLSKLVFWRVGFTAEQITQLASFLSTNNTIKSLTIDANEALEIGSYAQLIDESNNLTKLRLRYCEIGPMEAKSISQRLGTMQYV-NKKLINLDLSGNQLGDEGTIYLAEALRTNRTLLTLSVSNNKITDIGCIALAKVISQFFLTHEEIVYRRLCQSEKSKSESIPLTSSPLGRRKSKVSPSARDASKESTQGVSGAKKRDKSVRGRNAKDIDSSKDDKSGGKGKKSDSSNSPKKANQEQ----NRSSGKSKTGRNTRSAKQTSDTERL-ESSPETNELINPILDKAIYVEPYGLLIVGNFILAFLNLSRNSIGINGLKALLEAITYQVNLLNVENATLNLGTGILTLLFDDNAFNPDCEMITSIHELLASRDPTARIINND 532          
BLAST of Leucine-rich repeat-containing protein 71 vs. TrEMBL
Match: A0A267DVZ1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021745g3 PE=4 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 3.381e-85
Identity = 203/576 (35.24%), Postives = 315/576 (54.69%), Query Frame = 3
Query:   69 MG-KKTEKAIKEKPTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMS---ERNM---------MESAKSVSPPLSRRGDQKDRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETKNP-KSKKDDSKLVPGK------KDNAKVAIDMTKAIKSKVSRSGRLSKLNNQAD---NMSEAASENMDSIHPLLHKVE-AIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRDHKAKSSNS 1724
            MG KK++K+ +       +EE  +K  E YQ  GNF +DF EL +E       PV +R K+   ++ + ++  +     +K +K+DK+  + Q   + E+ + E+K         V+  +GFKP+TF +K     +KP + ++ +N DKPD V+E+  + W ++  +++    CF  L +L TI FWRV  ++E I++LAE L + ++++ L++E N   + ENY +LI+ DSNLTK+ LR+  IT  GA  I+++L  L     SKL+ LDL+   + D GA  LA+AL+ NRTL+ LSLSN  + D G   LA+  S++ LT EE   RR+++S   ER             S+ +V+PP SRRG   DRPVSVRS  ++              K   + K E K   K++K+DSK   GK      KD+   A  +        + S        +      + +  S+  DS HPLL +V+ A  PG LL+ GN +L +LNLSRN+I + GV +   AIS+Q + +   K + TGL+KL LQGN FS  ++ Y+++Q  + +RD    SSN+
Sbjct:    7 MGRKKSDKSAR-------SEEQEDKVNESYQPTGNFQSDFVELCKEMKMYRPPPVFLRPKR--PSSPIQNEQQTQAPTNRK-AKEDKKASMAQQMVEPEEETPEEK--------AVIEQLGFKPKTFTVKYYLDLMKPCVHIDLENPDKPDTVSEVHAKNWKLELPMLKTLSRCFEKLNRLHTIVFWRVAASAEVIAELAELLRQLDSVRCLSLEANGHVTDENYADLIRVDSNLTKLQLRFNQITDAGAARISEQLSGLR-DPPSKLVSLDLSSNCVQDGGATALAQALRTNRTLIHLSLSNNRVSDRGATALAESCSRFYLTHEETVERRRLLSTAAERRTGLSPESCQSRPSSSAVTPPPSRRG-ATDRPVSVRSGQEKLGRTGGTGKTPGKGKKDDKAKPEEKAKNKAQKEDSK-AKGKGAQASEKDSKSSAATLKSGKGKGGNNSSSSGGGRVKVSTPLQLDQEESQPPDSDHPLLERVDTAYAPGYLLVPGNHVLALLNLSRNQITDKGVLQWKTAISYQLAYMSKQKVNGTGLMKLLLQGNPFSTESESYRILQQAMSSRDPVGSSSNT 561          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Cavefish
Match: si:ch211-81a5.5 (si:ch211-81a5.5 [Source:ZFIN;Acc:ZDB-GENE-060503-892])

HSP 1 Score: 120.939 bits (302), Expect = 3.868e-29
Identity = 63/178 (35.39%), Postives = 105/178 (58.99%), Query Frame = 3
Query:  546 WMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSER 1079
            W VD  ++++      SL+ L  +  WR G+T   ++ L  T+  C  ++ + +E N     ++YH L+  DS +  ++LR   I  +GA+LI   L T+ ++ N  LL L++    +GD GAI++++ L+ NRTLL LSL+N  IGD+G   LA+++  + LT EEI  RRQ+M ++
Sbjct:   78 WRVDEMMVQVLNKTLPSLSNLQCLKMWRTGITENILTSLRNTIIMCTNLRTVILEGN-PIPEQSYHILMGEDSMINHLSLRNNRIGEEGARLIGSALSTV-HSANKNLLTLNMAFNCIGDEGAIYISQGLRFNRTLLCLSLANNQIGDTGASSLAEVLGPFALTHEEIIERRQLMVDQ 253          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Cavefish
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:103024894])

HSP 1 Score: 55.8398 bits (133), Expect = 1.071e-7
Identity = 38/114 (33.33%), Postives = 63/114 (55.26%), Query Frame = 3
Query:  660 LAETLSKCETIKFLTIENN--QEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSG 995
            LAE L   + I  + +++N  ++  +    E+++S+  LT +N++   I PDG K IA+ L       N  L  L+++   LGD G + LA+AL +N TL +LSL +  + D G
Sbjct:  531 LAEALRMNQIIVSINLQSNSIEDEGARALAEVLQSNRKLTSLNVQKNGIGPDGVKRIAESLKK-----NQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNSVSDKG 639          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Cavefish
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:103024894])

HSP 1 Score: 55.8398 bits (133), Expect = 1.135e-7
Identity = 38/114 (33.33%), Postives = 63/114 (55.26%), Query Frame = 3
Query:  660 LAETLSKCETIKFLTIENN--QEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSG 995
            LAE L   + I  + +++N  ++  +    E+++S+  LT +N++   I PDG K IA+ L       N  L  L+++   LGD G + LA+AL +N TL +LSL +  + D G
Sbjct:  531 LAEALRMNQIIVSINLQSNSIEDEGARALAEVLQSNRKLTSLNVQKNGIGPDGVKRIAESLKK-----NQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNSVSDKG 639          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Cavefish
Match: nod2 (nucleotide binding oligomerization domain containing 2 [Source:NCBI gene;Acc:103045336])

HSP 1 Score: 50.8322 bits (120), Expect = 3.864e-6
Identity = 42/132 (31.82%), Postives = 66/132 (50.00%), Query Frame = 3
Query:  636 LTSEAISQLAETLSKCETIKFLTIENNQEASSENYH--ELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQ 1025
            ++ E I +L E    CE  + L + NN+       H   L+++ +N   + L   NIT  GA+ +A+    L Y+    L  L L G  +GD GA  LA ALK +  L   SL +  +G+SG   LA+++ +
Sbjct:  723 ISDEGIRKLVEKGVHCECFQKLALFNNKLTDDCTRHLVTLLQAKTNFISLRLGNNNITSQGAEQLAE---GLRYS--KSLQFLGLWGNKIGDKGAEALADALKNSTALTWFSLVDNGVGNSGACALAELVKR 849          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Sea Lamprey
Match: si:ch211-81a5.5 (si:ch211-81a5.5 [Source:ZFIN;Acc:ZDB-GENE-060503-892])

HSP 1 Score: 199.134 bits (505), Expect = 3.213e-57
Identity = 172/554 (31.05%), Postives = 264/554 (47.65%), Query Frame = 3
Query:   75 KKTEKAIKEKPT--VQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSE-RNMMESAKSVSPPLSRRGDQK-DRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETK-------NPKSKKDDSKLVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQAD-NMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRD 1700
            KKTE+A +E       +TE+    TPE YQC GNF  DFT+L            C       T TGLAS                  P VV+       +     +++ +  P   +     P TF  K  F   KP + VE +N D   +V EI +R W ++  ++ +   C  ++  LTTI+FW  G+  + +      L  C  +K L +E N E    +YH+LI     +  ++LR   I  DGA+L+   L + T T N  LL L+L    + D G  ++A  L++NRTLL LSL++  IGD+G ++LA++++++ LT EE+  RR ++SE R+ +E  K  SP   RR D K D    +    K      +     K K     +K+E         N   KKDDSKL   KK +A    D+ K  K K  +SG   K    ++  M EA     ++I+PL+  VE    G++ + GN  L+ LNL+ N IG+ G+E    +I FQ     +     TG++++ LQ N F   +  ++ +  ++ +RD
Sbjct:    1 KKTERAARESKGQLSNSTEDDSINTPEEYQCNGNFEQDFTQL------------C-------TLTGLAST-----------------PAVVRRSHPPTAMENTGAENVQNVAPSEED---ITPTTFTTKDKFVYFKPCVQVEPENEDNRSSVKEIYIRGWKIEEKMMSILKKCLPAIPSLTTINFWNAGIDEDTLDMFVSVLPLCTNLKTLVLEGNPEPKL-SYHKLIGEGIMIGHLSLRNNRIDDDGARLLGQAL-STTKTTNKTLLSLNLAYNCITDLGGGYIAHGLRLNRTLLCLSLAHNKIGDNGAVKLAEILARFPLTHEEVVQRRILLSEVRSNIEIQK--SPVTVRRADSKLDHHSVIDKGEKATGKGTKPSTKKKVKHWSYYKKNEGYGGSAGPLNASLKKDDSKLT--KKVSA--VGDLAKGNKGKGVKSGNKDKKPQTSEPEMHEAP----EAINPLMDHVEH-HNGQIFLPGNQCLISLNLAWNNIGQVGLEAFLKSIRFQLEVSGTGAKKATGIMRISLQRNAFPSESKSFKEMCELMESRD 502          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Nematostella
Match: EDO30481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0M8])

HSP 1 Score: 126.716 bits (317), Expect = 3.853e-32
Identity = 106/340 (31.18%), Postives = 177/340 (52.06%), Query Frame = 3
Query:  690 IKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESA---KSVSPPLSRRGDQKDRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETKNPKSKKDDSKLVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRD 1700
            IK L+++NN     + Y+ L+  +S +  ++LR C +   GAK+I D L     T N  L  L+L    +   GA  LA+ L++NR LL+L+L +  IGD+G  +LA++IS + L+ EEI ARR ++S+++  E A   +S++ P+   G  K+RP SVRS                G    KEE+   +  ++ K        +K     +I+  KA  SK  ++  +      A    +   E ++  +PLL      E G+++I GN  L+ +NL+RN++ E GVE    A+  Q + LISS    +GL++L L  N+F+ +N  Y  + +++  +D
Sbjct:    4 IKALSLDNNP-LILQRYNALLGEESTIQHLSLRNCYVNDMGAKMIGDAL-----TVNKSLTTLNLCYNKITCDGAAKLAKGLRMNRILLTLNLGSNLIGDNGASKLAEVISSFSLSHEEIIARRLLISKKSPEEGASPSRSLNAPI---GGSKERPASVRS----------------GGHLSKEERKSREKDRASKKKEGKKQEEKAKKSASIESVKA-ASKGKKASAVKGDKKGAQQPEQEQPEVLEFPNPLLEIPLKEEGGEIVIPGNRALISINLARNKVSEMGVEAFLIAVQRQ-TELISSSPKPSGLMRLSLAKNKFAPNNGTYLRLMDIMQTKD 316          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Nematostella
Match: EDO31450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXW9])

HSP 1 Score: 58.5362 bits (140), Expect = 2.735e-9
Identity = 49/129 (37.98%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  636 LTSEAISQLAETLSKCETIKFLTIENNQEASSE-NYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            ++SE  +  AE LS  + ++ L +E N E          +K+ S L K++L   NI   GA  IA  L T     NS L  LDL    +GD GAI +A ALK N TL +L+L   +IGD G I +A  +
Sbjct:  214 VSSEDAAAFAEMLSHNQVLRKLRLEGNIEVEGAIAIASALKTKSVLRKLSLYSNNIGDKGAIAIASALKT-----NSTLEKLDLRCNNIGDEGAIAMANALKTNSTLENLNLQGNNIGDEGTISMANAL 337          

HSP 2 Score: 53.1434 bits (126), Expect = 1.342e-7
Identity = 47/119 (39.50%), Postives = 62/119 (52.10%), Query Frame = 3
Query:  636 LTSEAISQLAETLSKCETIKFLTIENNQEASSE-NYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGD 989
            ++SE  +  AE LS  + +K L +E N E          +K+ S L K++L   NI   GA  IA  L T     NS L  LDL    +GD GAI +A ALK N TL +L+L   +IGD
Sbjct:   23 VSSEDAAAFAEMLSHNQVLKELCLEGNIEVEGAIAIASALKTKSVLRKLSLYSNNIGDKGAIAIASALKT-----NSTLENLDLRCNNIGDEGAIAMANALKTNSTLENLNLQENNIGD 136          

HSP 3 Score: 47.7506 bits (112), Expect = 8.525e-6
Identity = 33/73 (45.21%), Postives = 44/73 (60.27%), Query Frame = 3
Query:  750 IKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSL 968
            +K++S L K++LR  NI  +GA  +A+ L T     NS L  L+L G  +GD G I +A ALK N TL SL L
Sbjct:  281 LKTNSTLEKLDLRCNNIGDEGAIAMANALKT-----NSTLENLNLQGNNIGDEGTISMANALKTNSTLRSLDL 348          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Nematostella
Match: EDO43196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ93])

HSP 1 Score: 55.8398 bits (133), Expect = 2.441e-8
Identity = 46/127 (36.22%), Postives = 65/127 (51.18%), Query Frame = 3
Query:  645 EAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            E    +A+ L    T+K L +E N+  +  +    + + ++S L K++L    I  +GA  IA  L T     NS L  LDL G  +GD GAI +A+AL  N TL  L L    IGD G I +AK +
Sbjct:  189 EGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMT-----NSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKAL 310          

HSP 2 Score: 55.8398 bits (133), Expect = 2.441e-8
Identity = 46/127 (36.22%), Postives = 65/127 (51.18%), Query Frame = 3
Query:  645 EAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            E    +A+ L    T+K L +E N+  +  +    + + ++S L K++L    I  +GA  IA  L T     NS L  LDL G  +GD GAI +A+AL  N TL  L L    IGD G I +AK +
Sbjct:  217 EGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMT-----NSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKAL 338          

HSP 3 Score: 55.8398 bits (133), Expect = 2.441e-8
Identity = 46/127 (36.22%), Postives = 65/127 (51.18%), Query Frame = 3
Query:  645 EAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            E    +A+ L    T+K L +E N+  +  +    + + ++S L K++L    I  +GA  IA  L T     NS L  LDL G  +GD GAI +A+AL  N TL  L L    IGD G I +AK +
Sbjct:  245 EGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMT-----NSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKAL 366          

HSP 4 Score: 55.8398 bits (133), Expect = 2.441e-8
Identity = 46/127 (36.22%), Postives = 65/127 (51.18%), Query Frame = 3
Query:  645 EAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            E    +A+ L    T+K L +E N+  +  +    + + ++S L K++L    I  +GA  IA  L T     NS L  LDL G  +GD GAI +A+AL  N TL  L L    IGD G I +AK +
Sbjct:  273 EGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMT-----NSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKAL 394          

HSP 5 Score: 54.299 bits (129), Expect = 8.574e-8
Identity = 45/127 (35.43%), Postives = 65/127 (51.18%), Query Frame = 3
Query:  645 EAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            E    +A+ L    T++ L +E N+  +  +    + + ++S L K++L    I  +GA  IA  L T     NS L  LDL G  +GD GAI +A+AL  N TL  L L    IGD G I +AK +
Sbjct:  161 EGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMT-----NSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKAL 282          

HSP 6 Score: 53.9138 bits (128), Expect = 8.880e-8
Identity = 45/127 (35.43%), Postives = 65/127 (51.18%), Query Frame = 3
Query:  645 EAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            E    +A+ L    T++ L +E N+  +  +    + + ++S L K++L    I  +GA  IA  L T     NS L  LDL G  +GD GAI +A+AL  N TL  L L    IGD G I +AK +
Sbjct:  133 EGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMT-----NSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKAL 254          

HSP 7 Score: 53.1434 bits (126), Expect = 1.776e-7
Identity = 38/88 (43.18%), Postives = 48/88 (54.55%), Query Frame = 3
Query:  756 SDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            ++S L K++L    I  +GA  IA  L T     NS L  LDL G  +GD GAI +A+AL  N TL  L L    IGD G I +AK +
Sbjct:    2 TNSTLEKLDLEGNKIGDEGAIAIAKALMT-----NSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDDGAIAIAKAL 84          

HSP 8 Score: 48.521 bits (114), Expect = 5.595e-6
Identity = 45/129 (34.88%), Postives = 65/129 (50.39%), Query Frame = 3
Query:  645 EAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPD--GAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            E    +A+ L    T++ L +E N+  +  +    + + ++S L K++L    I  +  GA  IA  L T     NS L  LDL G  +GD GAI +A+AL  N TL  L L    IGD G I +AK +
Sbjct:   47 EGAIAIAKALMTNSTLEKLDLEGNKIGDDGAIAIAKALMTNSTLEKLDLEGNKIGDEDEGAIAIAKALMT-----NSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKAL 170          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Nematostella
Match: EDO35563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL71])

HSP 1 Score: 49.6766 bits (117), Expect = 3.542e-7
Identity = 44/130 (33.85%), Postives = 67/130 (51.54%), Query Frame = 3
Query:  636 LTSEAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            ++S+    +AE LSK + ++   +  NQ  +  + +    +K++S L  ++L   NI  +GAK IA+ L T     NS L  L L    +GD GAI +A AL  N TL  L+ + C I   G   LA M+
Sbjct:   33 ISSKGCIAIAEMLSKNQWLETFILSYNQIGDEGAMSIANALKTNSTLKILDLTKNNIGNEGAKAIANALMT-----NSTLKKLHLCENNIGDEGAIAIANALMTNSTLKKLNFNTCGIRAVGAAALADML 157          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Nematostella
Match: EDO37016 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGY6])

HSP 1 Score: 50.8322 bits (120), Expect = 5.911e-7
Identity = 57/179 (31.84%), Postives = 80/179 (44.69%), Query Frame = 3
Query:  603 KLTTISFWRVGLTSEAISQLAETLSK--CETIKFLTIENNQ---EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARAL-KINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMM-ESAKSVSPPL 1118
            KLT ++     +  E    + E L+   C+  K L I NN    E +      L   +  LT +N+R  NI  +GAK I +EL       N KL  LD+    +GD GA ++  AL   N  L  L++SN +IGD G    AK I +  L +E        M   N+  E AK +   L
Sbjct:   58 KLTKLNISNNNIGDEGAKYIGEALAHENCKLTK-LNISNNNIGDEGAKYIGEALANENCKLTHLNMRRNNIGDEGAKYICEEL----RHENCKLTQLDIKYTYIGDEGAKYIGEALGHENCKLTKLNISNNNIGDEG----AKYIGE-ALANENCKLTHLNMRRNNIGDEGAKYICEEL 226          

HSP 2 Score: 50.0618 bits (118), Expect = 1.233e-6
Identity = 74/275 (26.91%), Postives = 124/275 (45.09%), Query Frame = 3
Query:  768 LTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARAL-KINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMM-ESAKSVSPPLSRRGDQKDRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETKNPKSKKDDSKLVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSAL 1586
            LTK+N+   NI  +GAK I + LG      N KL  L+++   +GD GA ++  AL   N  L  L++SN +IGD G    AK I +  L  E     +  +S  N+  E AK +   L+   + K   +++R         +  I     K   +E +HE  N K  + D K      + AK    + +A+  +   + +L+KLN   +N+ +  ++ +               G+ L + N  L  LN+ RN IG++G + +   +  +N  L
Sbjct:    1 LTKLNISDNNIGDEGAKYIGEALGHE----NCKLTKLNISDNNIGDEGAKYIGEALGHENCKLTKLNISNNNIGDEG----AKYIGE-ALAHENCKLTKLNISNNNIGDEGAKYIGEALANE-NCKLTHLNMR---------RNNIGDEGAKYICEELRHE--NCKLTQLDIKYTYIGDEGAKY---IGEALGHE---NCKLTKLNISNNNIGDEGAKYI---------------GEALANENCKLTHLNMRRNNIGDEGAKYICEELRHENCKL 233          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Medaka
Match: nod2 (nucleotide binding oligomerization domain containing 2 [Source:NCBI gene;Acc:101164467])

HSP 1 Score: 66.2402 bits (160), Expect = 6.349e-11
Identity = 43/130 (33.08%), Postives = 74/130 (56.92%), Query Frame = 3
Query:  636 LTSEAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            +T E I +L +   +C++ + + + NN+  +A ++++  L+K+  N   + L   NIT DGAKL+A+ L       N  L+ L L G  +GD GA  +A AL+ + +L+ LSL    +G +G   L+K+I
Sbjct:  793 ITDEGIRKLTDKGVQCDSFQKIALFNNRLTDACTQHFSHLLKTKQNFLALRLGNNNITADGAKLLAEGLKQ-----NGSLMYLGLWGNRIGDEGAEVIANALESSTSLVWLSLVGNGVGSTGACALSKVI 917          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Medaka
Match: nod2 (nucleotide binding oligomerization domain containing 2 [Source:NCBI gene;Acc:101164467])

HSP 1 Score: 66.2402 bits (160), Expect = 7.218e-11
Identity = 43/130 (33.08%), Postives = 74/130 (56.92%), Query Frame = 3
Query:  636 LTSEAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            +T E I +L +   +C++ + + + NN+  +A ++++  L+K+  N   + L   NIT DGAKL+A+ L       N  L+ L L G  +GD GA  +A AL+ + +L+ LSL    +G +G   L+K+I
Sbjct:  793 ITDEGIRKLTDKGVQCDSFQKIALFNNRLTDACTQHFSHLLKTKQNFLALRLGNNNITADGAKLLAEGLKQ-----NGSLMYLGLWGNRIGDEGAEVIANALESSTSLVWLSLVGNGVGSTGACALSKVI 917          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Medaka
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:101165263])

HSP 1 Score: 60.4622 bits (145), Expect = 4.610e-9
Identity = 47/140 (33.57%), Postives = 70/140 (50.00%), Query Frame = 3
Query:  606 LTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENN--QEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            LT ++     + S+    LAE L   + +  +  +NN  +E  ++   E+++ +  L  +N+R   I  DGAK IAD L       N  L  L L    LGD G + LA ALK+N+TLLSL L +  I + G   L K +
Sbjct:  764 LTYLNLRNNNIGSKGAKFLAEALKMNQVLTSINFQNNSIEEEGAQALAEVLQCNRKLVSLNVRKNKIGADGAKRIADALKM-----NQTLTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKAL 898          

HSP 2 Score: 50.447 bits (119), Expect = 5.169e-6
Identity = 31/90 (34.44%), Postives = 50/90 (55.56%), Query Frame = 3
Query:  750 IKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            IK +  LT ++L++  I     K++A+ L       N+ + +LDL    +G+ G IFLA ALK+N +L +L L     G SG + LA+ +
Sbjct:  954 IKFNQGLTSLHLQWNFIKSTATKVLANAL-----MSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEAL 1038          
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Medaka
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:101165263])

HSP 1 Score: 60.4622 bits (145), Expect = 4.610e-9
Identity = 47/140 (33.57%), Postives = 70/140 (50.00%), Query Frame = 3
Query:  606 LTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENN--QEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            LT ++     + S+    LAE L   + +  +  +NN  +E  ++   E+++ +  L  +N+R   I  DGAK IAD L       N  L  L L    LGD G + LA ALK+N+TLLSL L +  I + G   L K +
Sbjct:  764 LTYLNLRNNNIGSKGAKFLAEALKMNQVLTSINFQNNSIEEEGAQALAEVLQCNRKLVSLNVRKNKIGADGAKRIADALKM-----NQTLTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKAL 898          

HSP 2 Score: 50.447 bits (119), Expect = 5.169e-6
Identity = 31/90 (34.44%), Postives = 50/90 (55.56%), Query Frame = 3
Query:  750 IKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            IK +  LT ++L++  I     K++A+ L       N+ + +LDL    +G+ G IFLA ALK+N +L +L L     G SG + LA+ +
Sbjct:  954 IKFNQGLTSLHLQWNFIKSTATKVLANAL-----MSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEAL 1038          
BLAST of Leucine-rich repeat-containing protein 71 vs. Planmine SMEST
Match: SMESG000006778.1 (SMESG000006778.1)

HSP 1 Score: 1093.57 bits (2827), Expect = 0.000e+0
Identity = 548/555 (98.74%), Postives = 548/555 (98.74%), Query Frame = 3
Query:   69 MGKKTEKAIKEKPTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPLSRRGDQKDRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETKNPKSKKDDSKLVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRDHKAKSSNSETE 1733
            MGKKTEKAIKEKPTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDF PEVVNSIGFKPRTFVIKPTFCALKPALCVETDN DKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAK IADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPLSRRGDQKDRPVSVRSSSKEDKNKKEKINAVKGKKDPKEEKHETKNPKSKKDDSKLVPGK    KVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRDHKAKSSNSETE
Sbjct:    1 MGKKTEKAIKEKPTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFYPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNPDKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKFIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPLSRRGDQKDRPVSVRSSSKEDKNKKEKINAVKGKKDPKEEKHETKNPKSKKDDSKLVPGK----KVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRDHKAKSSNSETE 551          
BLAST of Leucine-rich repeat-containing protein 71 vs. Planmine SMEST
Match: SMESG000006778.1 (SMESG000006778.1)

HSP 1 Score: 1063.52 bits (2749), Expect = 0.000e+0
Identity = 541/568 (95.25%), Postives = 541/568 (95.25%), Query Frame = 3
Query:   69 MGKKTEKAIKEKPTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSV-------------SPPLSRRGDQKDRPVSVRXXXXXXXXXXXXINAVKGKKDPKEEKHETKNPKSKKDDSKLVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRDHKAKSSNSETE 1733
            MGKKTEKAIKEKPTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDK        EVVNSIGFKPRTFVIKPTFCALKPALCVETDN DKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAK IADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSV             SPPLSRRGDQKDRPVSVRSSSKEDKNKKEKINAVKGKKDPKEEKHETKNPKSKKDDSKLVPGK    KVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRDHKAKSSNSETE
Sbjct:    1 MGKKTEKAIKEKPTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGYQLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQLSQEDK--------EVVNSIGFKPRTFVIKPTFCALKPALCVETDNPDKPDNVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAETLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAKFIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSSFSRASISSTNNSPPLSRRGDQKDRPVSVRSSSKEDKNKKEKINAVKGKKDPKEEKHETKNPKSKKDDSKLVPGK----KVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASENMDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAISFQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRDHKAKSSNSETE 556          
BLAST of Leucine-rich repeat-containing protein 71 vs. Planmine SMEST
Match: SMESG000053819.1 (SMESG000053819.1)

HSP 1 Score: 58.5362 bits (140), Expect = 5.659e-9
Identity = 42/130 (32.31%), Postives = 68/130 (52.31%), Query Frame = 3
Query:  636 LTSEAISQLAETLSKCETIKFLTIENNQ--EASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            LT E I  L   L + E++K L +  N+  +  +E    LIK + ++ + NL   +I   GAK +AD +       +S +  L +TG  +GDFG +  A+A++IN +L  L L  CD+  S  I  A ++
Sbjct:    3 LTDEHIKGLCGILEEDESVKSLDLRFNRITDKGAEYIANLIKRNHSILEYNLMGNDIEEAGAKFLADAI-----VKSSTIKTLKMTGNKIGDFGGMQFAQAIQINESLEELDLGECDLKISSVISFATVL 127          
BLAST of Leucine-rich repeat-containing protein 71 vs. Planmine SMEST
Match: SMESG000053815.1 (SMESG000053815.1)

HSP 1 Score: 53.1434 bits (126), Expect = 3.366e-7
Identity = 41/135 (30.37%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  621 FWRVGLTSEAISQLAETLSKCETIKFLTIENN--QEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            F +  LT E +  L   L +  ++K L +  N   +  +     L+  +  + ++NL   +I   GA+ I+D L      GNS L +L LTG   GD+GA+  A AL+IN  L  + L  CD+     I    M+
Sbjct:   37 FRKNKLTDEQVKGLCIVLEEDVSVKSLDLRYNLISDEGAIYLRSLLLRNRTIVELNLMGNDIGEMGAERISDALA-----GNSTLKILKLTGNKFGDYGAMLFASALQINDCLEEIDLGECDLEIQSVIAYTTML 166          
BLAST of Leucine-rich repeat-containing protein 71 vs. Planmine SMEST
Match: SMESG000053815.1 (SMESG000053815.1)

HSP 1 Score: 53.1434 bits (126), Expect = 3.712e-7
Identity = 41/135 (30.37%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  621 FWRVGLTSEAISQLAETLSKCETIKFLTIENN--QEASSENYHELIKSDSNLTKVNLRYCNITPDGAKLIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSLSNCDIGDSGCIELAKMI 1019
            F +  LT E +  L   L +  ++K L +  N   +  +     L+  +  + ++NL   +I   GA+ I+D L      GNS L +L LTG   GD+GA+  A AL+IN  L  + L  CD+     I    M+
Sbjct:   59 FRKNKLTDEQVKGLCIVLEEDVSVKSLDLRYNLISDEGAIYLRSLLLRNRTIVELNLMGNDIGEMGAERISDALA-----GNSTLKILKLTGNKFGDYGAMLFASALQINDCLEEIDLGECDLEIQSVIAYTTML 188          
The following BLAST results are available for this feature:
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC714.556e-5331.62leucine rich repeat containing 71 [Source:HGNC Sym... [more]
LRRC342.871e-831.06leucine rich repeat containing 34 [Source:HGNC Sym... [more]
LRRC343.304e-831.06leucine rich repeat containing 34 [Source:HGNC Sym... [more]
NOD25.392e-726.54nucleotide binding oligomerization domain containi... [more]
NOD26.808e-726.54nucleotide binding oligomerization domain containi... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-81a5.51.768e-3429.34si:ch211-81a5.5 [Source:ZFIN;Acc:ZDB-GENE-060503-8... [more]
nod21.389e-834.09nucleotide-binding oligomerization domain containi... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
emp37.870e-6032.63epithelial membrane protein 3 [Source:Xenbase;Acc:... [more]
emp31.730e-5832.35epithelial membrane protein 3 [Source:Xenbase;Acc:... [more]
emp31.028e-3631.66epithelial membrane protein 3 [Source:Xenbase;Acc:... [more]
lrrc341.880e-629.25leucine rich repeat containing 34 [Source:NCBI gen... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Lrrc713.274e-4529.38leucine rich repeat containing 71 [Source:MGI Symb... [more]
Lrrc712.664e-937.76leucine rich repeat containing 71 [Source:MGI Symb... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N4P6|LRC71_HUMAN2.188e-5231.62Leucine-rich repeat-containing protein 71 OS=Homo ... [more]
sp|Q9D3W5|LRC71_MOUSE2.290e-4429.38Leucine-rich repeat-containing protein 71 OS=Mus m... [more]
sp|Q53B88|NOD2_HYLLA4.298e-827.01Nucleotide-binding oligomerization domain-containi... [more]
sp|Q8IZ02|LRC34_HUMAN1.379e-731.06Leucine-rich repeat-containing protein 34 OS=Homo ... [more]
sp|Q53B87|NOD2_PANTR1.562e-626.54Nucleotide-binding oligomerization domain-containi... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7BKQ41.114e-9138.21Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A267FIU48.014e-8635.42Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267E1081.717e-8535.24Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A3Q0KNQ31.779e-8535.71Putative leucine rich repeat-containing OS=Schisto... [more]
A0A267DVZ13.381e-8535.24Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch211-81a5.53.868e-2935.39si:ch211-81a5.5 [Source:ZFIN;Acc:ZDB-GENE-060503-8... [more]
nlrc31.071e-733.33NLR family CARD domain containing 3 [Source:NCBI g... [more]
nlrc31.135e-733.33NLR family CARD domain containing 3 [Source:NCBI g... [more]
nod23.864e-631.82nucleotide binding oligomerization domain containi... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-81a5.53.213e-5731.05si:ch211-81a5.5 [Source:ZFIN;Acc:ZDB-GENE-060503-8... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO304813.853e-3231.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314502.735e-937.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431962.441e-836.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355633.542e-733.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370165.911e-731.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nod26.349e-1133.08nucleotide binding oligomerization domain containi... [more]
nod27.218e-1133.08nucleotide binding oligomerization domain containi... [more]
nlrc34.610e-933.57NLR family CARD domain containing 3 [Source:NCBI g... [more]
nlrc34.610e-933.57NLR family CARD domain containing 3 [Source:NCBI g... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 71 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006778.10.000e+098.74SMESG000006778.1[more]
SMESG000006778.10.000e+095.25SMESG000006778.1[more]
SMESG000053819.15.659e-932.31SMESG000053819.1[more]
SMESG000053815.13.366e-730.37SMESG000053815.1[more]
SMESG000053815.13.712e-730.37SMESG000053815.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028668 ID=SMED30028668|Name=Leucine-rich repeat-containing protein 71|organism=Schmidtea mediterranea sexual|type=transcript|length=1782bp
TTTAAAAATCCGGAGTCTTGGAAACATATGAAAATAACTTTTTAGTCATA
AAGTAATCTTTTAAAGCAATGGGCAAAAAAACAGAAAAGGCTATTAAAGA
AAAACCAACAGTACAAACAACAGAAGAAATTGTGAATAAAACTCCTGAAC
CCTATCAATGCGTTGGAAATTTTGTGACTGACTTCACCGAGTTATGGAGG
GAACAAAATCCAGGATACCAGTTACCAGTTTGTATAAGGGATAAAAAGGG
ATTTACTGCAACAGGGCTTGCCAGTGATTCAAATTCAAATCTACAAGCAG
GAAAGAAGGGAAGCAAAGACGATAAGCGACCTCAAGTAGTTCAACATCAA
CCAGATTCTGAACAATTATCACAGGAAGATAAAGATTCAATTGATGATTT
TTGTCCAGAAGTTGTGAATTCCATAGGCTTTAAACCTCGAACATTTGTTA
TTAAACCAACCTTTTGTGCATTGAAGCCTGCCTTATGTGTTGAAACGGAC
AATGCAGATAAGCCTGACAACGTTACCGAAATTTCTGTAAGAAGATGGAT
GGTGGATTCTTCAGTTATTGAATTATTTGGCTTGTGCTTTTTTTCTCTCA
CAAAATTAACAACAATTTCATTTTGGCGTGTTGGTCTTACTTCTGAAGCA
ATCTCCCAGCTTGCTGAGACATTATCCAAGTGTGAAACTATCAAATTTTT
AACTATTGAAAACAATCAAGAAGCTTCGTCAGAAAATTACCATGAGCTGA
TTAAATCCGATAGCAATTTGACTAAAGTGAATTTACGATACTGCAACATT
ACGCCAGATGGAGCTAAGTTGATTGCTGATGAACTTGGGACATTAACATA
CACTGGAAATTCAAAGCTTTTGGTTTTGGATTTAACTGGATGTCCCTTAG
GAGATTTTGGAGCAATATTTTTGGCTAGAGCTCTGAAAATAAACAGAACA
CTTTTATCACTTTCCCTTAGCAATTGTGATATTGGCGATTCGGGATGTAT
TGAATTGGCAAAGATGATATCTCAATATATTTTAACTGATGAAGAGATAT
ACGCCAGAAGGCAGATGATGTCCGAGAGAAATATGATGGAAAGTGCTAAG
TCGGTTAGCCCGCCTTTGAGTCGAAGAGGCGACCAGAAGGATCGACCAGT
TAGTGTTAGAAGTTCTAGTAAAGAAGACAAAAATAAAAAAGAAAAGATCA
ATGCAGTTAAAGGAAAGAAGGATCCAAAAGAAGAAAAGCATGAGACCAAA
AATCCTAAAAGTAAAAAAGACGATTCCAAACTTGTTCCTGGTAAAAAAGA
TAATGCTAAAGTTGCTATAGATATGACAAAGGCGATCAAGTCAAAGGTCA
GTAGATCAGGACGACTCTCGAAATTGAATAATCAAGCCGATAACATGTCA
GAGGCTGCTAGTGAAAATATGGATAGCATTCATCCCCTTCTTCATAAGGT
TGAAGCTATTGAACCTGGAAAATTATTGATTAGCGGAAACTTTATGCTTT
TGATGTTGAATCTTTCGAGAAATCGGATCGGTGAAGATGGAGTGGAAGAG
CTATTTGCAGCAATTTCCTTTCAGAATTCAGCACTGATTTCTAGTAAAAG
TAGTCGAACTGGTTTGTTAAAGCTATTTCTACAGGGAAATAGATTTTCAG
ATTCAAATGACAAATACCAATTAATTCAAAACATGATTTTGAACCGAGAT
CACAAAGCTAAAAGTAGTAATTCAGAAACCGAATAAATTGTTATTAAATT
TTTATCGAAAATAATAAATAAATTTTTCTTCC
back to top

protein sequence of SMED30028668-orf-1

>SMED30028668-orf-1 ID=SMED30028668-orf-1|Name=SMED30028668-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=556bp
MGKKTEKAIKEKPTVQTTEEIVNKTPEPYQCVGNFVTDFTELWREQNPGY
QLPVCIRDKKGFTATGLASDSNSNLQAGKKGSKDDKRPQVVQHQPDSEQL
SQEDKDSIDDFCPEVVNSIGFKPRTFVIKPTFCALKPALCVETDNADKPD
NVTEISVRRWMVDSSVIELFGLCFFSLTKLTTISFWRVGLTSEAISQLAE
TLSKCETIKFLTIENNQEASSENYHELIKSDSNLTKVNLRYCNITPDGAK
LIADELGTLTYTGNSKLLVLDLTGCPLGDFGAIFLARALKINRTLLSLSL
SNCDIGDSGCIELAKMISQYILTDEEIYARRQMMSERNMMESAKSVSPPL
SRRGDQKDRPVSVRSSSKEDKNKKEKINAVKGKKDPKEEKHETKNPKSKK
DDSKLVPGKKDNAKVAIDMTKAIKSKVSRSGRLSKLNNQADNMSEAASEN
MDSIHPLLHKVEAIEPGKLLISGNFMLLMLNLSRNRIGEDGVEELFAAIS
FQNSALISSKSSRTGLLKLFLQGNRFSDSNDKYQLIQNMILNRDHKAKSS
NSETE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process