40S ribosomal protein SA

Overview
Name40S ribosomal protein SA
Smed IDSMED30028665
Length (bp)1228
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 40S ribosomal protein SA (SMED30028665) t-SNE clustered cells

Violin plots show distribution of expression levels for 40S ribosomal protein SA (SMED30028665) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 40S ribosomal protein SA (SMED30028665) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 40S ribosomal protein SA (SMED30028665) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028665

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028665SMESG000016079.1 SmedASXL_005562SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028665SMESG000016079.1 SmedASXL_005562SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30028665SMESG000016079.1 SmedASXL_001746SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028665SMESG000016079.1 SmedASXL_001746SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30028665SMESG000016079.1 dd_Smed_v4_8634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028665SMESG000044545.1 Contig4657GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028665SMESG000016079.1 Contig51165newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028665SMESG000016079.1 Contig51165uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028665SMESG000016079.1 Contig4657GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
whole organismSMED30028665SMESG000016079.1 Contig51165newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30028665SMESG000016079.1 Contig51165uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30028665SMESG000016079.1 dd_Smed_v4_12899_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028665SMESG000016079.1 SMED_04831_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30028665SMESG000016079.1 SMED_04831_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 40S ribosomal protein SA vs. Ensembl Human
Match: RPSA (ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:6502])

HSP 1 Score: 256.144 bits (653), Expect = 5.829e-83
Identity = 115/200 (57.50%), Postives = 147/200 (73.50%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEE 903
              + DV   L A  H G  N +FQMEQY++ R   G ++I + + +EK+ LAA AIVA+ENP D+ V+SS+ + QRAVLKFA  TGA  +AGRFTPGTFTNQIQ AFR+PRLL+V+DP ADHQ + E+S+VNLP IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE 209          
BLAST of 40S ribosomal protein SA vs. Ensembl Human
Match: RPSA (ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:6502])

HSP 1 Score: 257.299 bits (656), Expect = 5.911e-83
Identity = 115/200 (57.50%), Postives = 147/200 (73.50%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEE 903
              + DV   L A  H G  N +FQMEQY++ R   G ++I + + +EK+ LAA AIVA+ENP D+ V+SS+ + QRAVLKFA  TGA  +AGRFTPGTFTNQIQ AFR+PRLL+V+DP ADHQ + E+S+VNLP IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE 209          
BLAST of 40S ribosomal protein SA vs. Ensembl Human
Match: RPSA (ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:6502])

HSP 1 Score: 250.751 bits (639), Expect = 2.558e-80
Identity = 115/205 (56.10%), Postives = 147/205 (71.71%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQ-----RAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEE 903
              + DV   L A  H G  N +FQMEQY++ R   G ++I + + +EK+ LAA AIVA+ENP D+ V+SS+ + Q     RAVLKFA  TGA  +AGRFTPGTFTNQIQ AFR+PRLL+V+DP ADHQ + E+S+VNLP IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQVCGTVRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE 214          
BLAST of 40S ribosomal protein SA vs. Ensembl Human
Match: RPSA (ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:6502])

HSP 1 Score: 124.405 bits (311), Expect = 4.237e-34
Identity = 59/105 (56.19%), Postives = 75/105 (71.43%), Query Frame = 1
Query:  310 DNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAF 624
            + DV   L A  H G  N +FQMEQY++ R   G ++I + + +EK+ LAA AIVA+ENP D+ V+SS+ + QRAVLKFA  TGA  +AGRFTPGTFTNQIQ AF
Sbjct:   12 EEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116          
BLAST of 40S ribosomal protein SA vs. Ensembl Celegans
Match: rps-0 (40S ribosomal protein SA [Source:UniProtKB/Swiss-Prot;Acc:P46769])

HSP 1 Score: 217.624 bits (553), Expect = 3.343e-68
Identity = 116/250 (46.40%), Postives = 160/250 (64.00%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEW-----DVKVDLFIAR---SAEEELQNKEDEVIQMNEHVEEISHGVVAQPIAQQLDDWQA-TDNW 1026
              + DV   L    H GS N NFQM+QYV+ R   G ++I + K +EK+ LAA AI AVENP D+ VVS++  +QRA+LKFA +TGA A+ GRF+PG  TNQIQK F++PRLL++SDP  DHQAV E+S+V +PVI+F NT+S +K +DI +PCNN+GE SIG MW++LARE+  +RG ISR   +     ++  DL+  R     E+E      +V +  E+ +        Q    ++DDW A T  W
Sbjct:   10 LTEEDVMKLLATQAHLGSTNLNFQMQQYVYKRRFDGPNIINVKKTWEKLLLAARAIAAVENPADVVVVSARPYAQRALLKFAAHTGATAIFGRFSPGCLTNQIQKTFKEPRLLVISDPRIDHQAVTEASYVGVPVISFVNTESPLKLIDIGVPCNNKGERSIGLMWWMLAREILILRGKISRQTGFVLEGKEIMPDLYFYRDPTETEKEETGAHADVAEAQEYQQPTDIDFTTQ--GGKVDDWAAETATW 257          
BLAST of 40S ribosomal protein SA vs. Ensembl Celegans
Match: rps-0 (40S ribosomal protein SA [Source:UniProtKB/Swiss-Prot;Acc:P46769])

HSP 1 Score: 217.624 bits (553), Expect = 3.343e-68
Identity = 116/250 (46.40%), Postives = 160/250 (64.00%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEW-----DVKVDLFIAR---SAEEELQNKEDEVIQMNEHVEEISHGVVAQPIAQQLDDWQA-TDNW 1026
              + DV   L    H GS N NFQM+QYV+ R   G ++I + K +EK+ LAA AI AVENP D+ VVS++  +QRA+LKFA +TGA A+ GRF+PG  TNQIQK F++PRLL++SDP  DHQAV E+S+V +PVI+F NT+S +K +DI +PCNN+GE SIG MW++LARE+  +RG ISR   +     ++  DL+  R     E+E      +V +  E+ +        Q    ++DDW A T  W
Sbjct:   10 LTEEDVMKLLATQAHLGSTNLNFQMQQYVYKRRFDGPNIINVKKTWEKLLLAARAIAAVENPADVVVVSARPYAQRALLKFAAHTGATAIFGRFSPGCLTNQIQKTFKEPRLLVISDPRIDHQAVTEASYVGVPVISFVNTESPLKLIDIGVPCNNKGERSIGLMWWMLAREILILRGKISRQTGFVLEGKEIMPDLYFYRDPTETEKEETGAHADVAEAQEYQQPTDIDFTTQ--GGKVDDWAAETATW 257          
BLAST of 40S ribosomal protein SA vs. Ensembl Fly
Match: sta (gene:FBgn0003517 transcript:FBtr0070290)

HSP 1 Score: 255.758 bits (652), Expect = 6.154e-83
Identity = 116/196 (59.18%), Postives = 149/196 (76.02%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIAR 891
              ++D+   L A+ H GS N NFQMEQYV+ R   G +++ + K +EK+ LAA AIVA++NP DI V+SS+   QRAVLKFA+YT    +AGRFTPG FTNQIQ AFR+PRLL+V+DP  DHQ ++E+S+VN+PVIAF NTDS ++ +DI IPCNN+   SIG MW+LLAREV R+RG+ISRS+EW V VDLF  R
Sbjct:   10 LKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDLFFYR 205          
BLAST of 40S ribosomal protein SA vs. Ensembl Fly
Match: sta (gene:FBgn0003517 transcript:FBtr0070289)

HSP 1 Score: 255.758 bits (652), Expect = 6.154e-83
Identity = 116/196 (59.18%), Postives = 149/196 (76.02%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIAR 891
              ++D+   L A+ H GS N NFQMEQYV+ R   G +++ + K +EK+ LAA AIVA++NP DI V+SS+   QRAVLKFA+YT    +AGRFTPG FTNQIQ AFR+PRLL+V+DP  DHQ ++E+S+VN+PVIAF NTDS ++ +DI IPCNN+   SIG MW+LLAREV R+RG+ISRS+EW V VDLF  R
Sbjct:   10 LKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDLFFYR 205          
BLAST of 40S ribosomal protein SA vs. Ensembl Fly
Match: sta (gene:FBgn0003517 transcript:FBtr0339594)

HSP 1 Score: 255.758 bits (652), Expect = 6.154e-83
Identity = 116/196 (59.18%), Postives = 149/196 (76.02%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIAR 891
              ++D+   L A+ H GS N NFQMEQYV+ R   G +++ + K +EK+ LAA AIVA++NP DI V+SS+   QRAVLKFA+YT    +AGRFTPG FTNQIQ AFR+PRLL+V+DP  DHQ ++E+S+VN+PVIAF NTDS ++ +DI IPCNN+   SIG MW+LLAREV R+RG+ISRS+EW V VDLF  R
Sbjct:   10 LKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDLFFYR 205          
BLAST of 40S ribosomal protein SA vs. Ensembl Fly
Match: sta (gene:FBgn0003517 transcript:FBtr0339593)

HSP 1 Score: 255.758 bits (652), Expect = 6.154e-83
Identity = 116/196 (59.18%), Postives = 149/196 (76.02%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIAR 891
              ++D+   L A+ H GS N NFQMEQYV+ R   G +++ + K +EK+ LAA AIVA++NP DI V+SS+   QRAVLKFA+YT    +AGRFTPG FTNQIQ AFR+PRLL+V+DP  DHQ ++E+S+VN+PVIAF NTDS ++ +DI IPCNN+   SIG MW+LLAREV R+RG+ISRS+EW V VDLF  R
Sbjct:   10 LKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDLFFYR 205          
BLAST of 40S ribosomal protein SA vs. Ensembl Zebrafish
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:394027])

HSP 1 Score: 259.61 bits (662), Expect = 8.381e-84
Identity = 117/200 (58.50%), Postives = 147/200 (73.50%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEE 903
              + DV   L A  H G  N +FQMEQYV+ R   G ++I + K +EK+ LAA AIVA+ENP D+CV+SS+ + QRAVLKFA  TG+   AGRFTPGTFTNQIQ AFR+PRLLIV+DP ADHQ + E+S+VN+P IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYVYKRKSDGVYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASATGSTTFAGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGPHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE 209          
BLAST of 40S ribosomal protein SA vs. Ensembl Zebrafish
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:394027])

HSP 1 Score: 259.61 bits (662), Expect = 8.381e-84
Identity = 117/200 (58.50%), Postives = 147/200 (73.50%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEE 903
              + DV   L A  H G  N +FQMEQYV+ R   G ++I + K +EK+ LAA AIVA+ENP D+CV+SS+ + QRAVLKFA  TG+   AGRFTPGTFTNQIQ AFR+PRLLIV+DP ADHQ + E+S+VN+P IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYVYKRKSDGVYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASATGSTTFAGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGPHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE 209          
BLAST of 40S ribosomal protein SA vs. Ensembl Zebrafish
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:394027])

HSP 1 Score: 90.5077 bits (223), Expect = 5.244e-22
Identity = 42/79 (53.16%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  310 DNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKF 546
            + DV   L A  H G  N +FQMEQYV+ R   G ++I + K +EK+ LAA AIVA+ENP D+CV+SS+ + QRAVLKF
Sbjct:   12 EEDVLKFLAAGTHLGGTNLDFQMEQYVYKRKSDGVYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKF 90          
BLAST of 40S ribosomal protein SA vs. Ensembl Xenopus
Match: ociad2 (OCIA domain containing 2 [Source:Xenbase;Acc:XB-GENE-966006])

HSP 1 Score: 261.536 bits (667), Expect = 1.400e-84
Identity = 122/239 (51.05%), Postives = 163/239 (68.20%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNEHVEEISHGVVAQPIAQ----QLDDW 1008
              + DV   L A  H G  N +FQMEQY++ R   G ++I + + +EK+ LAA AIVA+ENP D+CV+SS+ + QRAVLKFA  +GA  +AGRFTPGTFTNQIQ AFR+PRLL+V+DP ADHQ + E+S+VN+P IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE    KE++        +E   G    P+A+    ++ DW
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASASGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE--IEKEEQAAAEKATTKEEYQGEWTAPVAEFPQAEVADW 246          
BLAST of 40S ribosomal protein SA vs. Ensembl Xenopus
Match: ociad2 (OCIA domain containing 2 [Source:Xenbase;Acc:XB-GENE-966006])

HSP 1 Score: 261.536 bits (667), Expect = 3.061e-84
Identity = 122/239 (51.05%), Postives = 163/239 (68.20%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNEHVEEISHGVVAQPIAQ----QLDDW 1008
              + DV   L A  H G  N +FQMEQY++ R   G ++I + + +EK+ LAA AIVA+ENP D+CV+SS+ + QRAVLKFA  +GA  +AGRFTPGTFTNQIQ AFR+PRLL+V+DP ADHQ + E+S+VN+P IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE    KE++        +E   G    P+A+    ++ DW
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASASGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE--IEKEEQAAAEKATTKEEYQGEWTAPVAEFPQAEVADW 246          
BLAST of 40S ribosomal protein SA vs. Ensembl Mouse
Match: Rpsa (ribosomal protein SA [Source:MGI Symbol;Acc:MGI:105381])

HSP 1 Score: 257.299 bits (656), Expect = 4.377e-83
Identity = 115/200 (57.50%), Postives = 147/200 (73.50%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEE 903
              + DV   L A  H G  N +FQMEQY++ R   G ++I + + +EK+ LAA AIVA+ENP D+ V+SS+ + QRAVLKFA  TGA  +AGRFTPGTFTNQIQ AFR+PRLL+V+DP ADHQ + E+S+VNLP IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE 209          
BLAST of 40S ribosomal protein SA vs. Ensembl Mouse
Match: Rpsa (ribosomal protein SA [Source:MGI Symbol;Acc:MGI:105381])

HSP 1 Score: 257.299 bits (656), Expect = 4.377e-83
Identity = 115/200 (57.50%), Postives = 147/200 (73.50%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEE 903
              + DV   L A  H G  N +FQMEQY++ R   G ++I + + +EK+ LAA AIVA+ENP D+ V+SS+ + QRAVLKFA  TGA  +AGRFTPGTFTNQIQ AFR+PRLL+V+DP ADHQ + E+S+VNLP IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE 209          
BLAST of 40S ribosomal protein SA vs. Ensembl Mouse
Match: Rpsa (ribosomal protein SA [Source:MGI Symbol;Acc:MGI:105381])

HSP 1 Score: 136.346 bits (342), Expect = 4.627e-39
Identity = 60/83 (72.29%), Postives = 70/83 (84.34%), Query Frame = 1
Query:  529 RAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRG 777
            RAVLKFA  TGA  +AGRFTPGTFTNQIQ AFR+PRLL+V+DP ADHQ + E+S+VNLP IA CNTDS ++ VDI IPCNN+G
Sbjct:    1 RAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKG 83          
BLAST of 40S ribosomal protein SA vs. Ensembl Mouse
Match: Rpsa (ribosomal protein SA [Source:MGI Symbol;Acc:MGI:105381])

HSP 1 Score: 73.559 bits (179), Expect = 2.280e-15
Identity = 33/75 (44.00%), Postives = 48/75 (64.00%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQ 528
              + DV   L A  H G  N +FQMEQY++ R   G ++I + + +EK+ LAA AIVA+ENP D+ V+SS+ + Q
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQ 84          
BLAST of 40S ribosomal protein SA vs. UniProt/SwissProt
Match: sp|Q6P8D1|RSSA_XENTR (40S ribosomal protein SA OS=Xenopus tropicalis OX=8364 GN=rpsa PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 8.573e-84
Identity = 122/239 (51.05%), Postives = 163/239 (68.20%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNEHVEEISHGVVAQPIAQ----QLDDW 1008
              + DV   L A  H G  N +FQMEQY++ R   G ++I + + +EK+ LAA AIVA+ENP D+CV+SS+ + QRAVLKFA  +GA  +AGRFTPGTFTNQIQ AFR+PRLL+V+DP ADHQ + E+S+VN+P IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE    KE++        +E   G    P+A+    ++ DW
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASASGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE--IEKEEQAAAEKATTKEEYQGEWTAPVAEFPQAEVADW 246          
BLAST of 40S ribosomal protein SA vs. UniProt/SwissProt
Match: sp|Q3ZM03|RSSA_XENLA (40S ribosomal protein SA OS=Xenopus laevis OX=8355 GN=rpsa PE=1 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.041e-83
Identity = 122/239 (51.05%), Postives = 163/239 (68.20%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNEHVEEISHGVVAQPIAQ----QLDDW 1008
              + DV   L A  H G  N +FQMEQY++ R   G ++I + + +EK+ LAA AIVA+ENP D+CV+SS+ + QRAVLKFA  +GA  +AGRFTPGTFTNQIQ AFR+PRLL+V+DP ADHQ + E+S+VN+P IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE    KE++        +E   G    P+A+    ++ DW
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASASGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPITEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE--IEKEEQAAAEKATTKEEFQGEWTAPVAEFPQAEVADW 246          
BLAST of 40S ribosomal protein SA vs. UniProt/SwissProt
Match: sp|A6NA00|RSSA_ORNPR (40S ribosomal protein SA OS=Ornithodoros parkeri OX=140564 PE=2 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 2.159e-83
Identity = 117/210 (55.71%), Postives = 152/210 (72.38%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVI 933
              D+DV   L A  H G+A  +FQM+QY   R   G ++I + K +EK+ LAA AIVA+ENP ++C +SS+   QRAVLKFA +TGA  +AGRFTPGTFTNQIQ AFR+PRLL+V DP  DHQ V E+S+VN+PVIAFCNTD+ ++ VD+ IPCNN+ + SIG MW++L REV R+RGSI R I WD  VDLF  R  EE  + ++ +V+
Sbjct:   10 LKDDDVRRFLTAKTHIGTAQLDFQMQQYCFKRRSDGVYLIDLKKTWEKLLLAARAIVAIENPAEVCAISSRPYGQRAVLKFASFTGATPIAGRFTPGTFTNQIQAAFREPRLLVVCDPREDHQPVTEASYVNIPVIAFCNTDACLRYVDVAIPCNNKAQHSIGLMWWMLTREVLRMRGSIIREIPWDTMVDLFFYRDPEEAEKEEQTQVV 219          
BLAST of 40S ribosomal protein SA vs. UniProt/SwissProt
Match: sp|Q803F6|RSSA_DANRE (40S ribosomal protein SA OS=Danio rerio OX=7955 GN=rpsa PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 6.327e-83
Identity = 117/200 (58.50%), Postives = 147/200 (73.50%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEE 903
              + DV   L A  H G  N +FQMEQYV+ R   G ++I + K +EK+ LAA AIVA+ENP D+CV+SS+ + QRAVLKFA  TG+   AGRFTPGTFTNQIQ AFR+PRLLIV+DP ADHQ + E+S+VN+P IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYVYKRKSDGVYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASATGSTTFAGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGPHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE 209          
BLAST of 40S ribosomal protein SA vs. UniProt/SwissProt
Match: sp|Q90YS4|RSSA_ICTPU (40S ribosomal protein SA OS=Ictalurus punctatus OX=7998 GN=rpsa PE=2 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 9.359e-83
Identity = 128/239 (53.56%), Postives = 162/239 (67.78%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEE---ELQNKEDEVIQMNEHVEEISHGVVAQPIAQ-QLDDW 1008
              + DV   L A  H G  N +FQMEQYV+ R   G ++I + K +EK+ LAA AIVA+ENP D+CV+SS+ + QRA LKFA  TGA   AGRFTPGTFTNQIQ AFR+PRLLIV+DP ADHQ + E+S+VN+P IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE   E Q   ++ +   E   E S  V    IAQ ++ DW
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYVYKRKSDGIYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRACLKFASGTGATTFAGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGPHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKAVGKEEFQGEWSAPVAD--IAQLEVPDW 246          
BLAST of 40S ribosomal protein SA vs. TrEMBL
Match: E7D1C2 (Putative ribosomal protein SA (Fragment) OS=Latrodectus hesperus OX=256737 PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.301e-85
Identity = 132/243 (54.32%), Postives = 170/243 (69.96%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNEHVEEISH------GVVAQPIAQQLDDWQA 1014
              D DV   L +S H G+ N +FQMEQYV  R   G ++I + K +EK+ LAA AIVA+ENP DICV+SS+   QRAVLKFA  TGA  +AGRFTPGTFTNQIQ AFR+PRLL+V+DP  DHQ + E+S+VN+PVIAFCNTDS ++ VDI IPCNN+G  SIG MW++LAREV R+RG+ISR ++WDV VDL+  R  E+  + +E   +Q    V+E +       G  A  +A ++ DW A
Sbjct:   10 LKDEDVTKFLASSTHIGNENLDFQMEQYVFKRRSDGIYLINLKKTWEKLLLAARAIVAIENPADICVISSRPFGQRAVLKFASATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRIDHQPLTEASYVNIPVIAFCNTDSPLRYVDIAIPCNNKGAHSIGLMWWMLAREVLRMRGTISRELKWDVMVDLYFYRDPEDA-EKEEQAAVQSERPVKEAADIQSEPWGGEATTVAAEVSDWSA 251          
BLAST of 40S ribosomal protein SA vs. TrEMBL
Match: A0A023FYL2 (40S ribosomal protein SA OS=Amblyomma parvum OX=251391 PE=2 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 5.762e-85
Identity = 126/245 (51.43%), Postives = 168/245 (68.57%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNEHVEEISHGVVAQ-------PIAQQLDDWQAT 1017
              ++DV   L A  H G++N +FQM++Y   R   G H+I + K +EK+ LAA AIVA+ENP ++C +SS+   QRAVLKFA +TGA  +AGRFTPGTFTNQIQ AFR+PRLL+V DP ADHQ V E+S+VNLPVIAFCNTD+ ++ VDI IPCNN+ + SIG MW++L REV R+RGSI R I W++ VDLF  R  EE  + ++ + +     V+E++     Q       P A ++ DW AT
Sbjct:   10 LKEDDVRRMLTAKTHLGTSNLDFQMKEYCFKRRPDGIHLINLKKTWEKLLLAARAIVAIENPAEVCAISSRPYGQRAVLKFASFTGATPIAGRFTPGTFTNQIQAAFREPRLLVVCDPRADHQPVTEASYVNLPVIAFCNTDATLRYVDIAIPCNNKSQHSIGLMWWMLTREVLRMRGSILRDIPWEIMVDLFFYRDPEETEKEEQAQQVAPERAVKEVAEYTTEQWGGGDVAPAAAEVTDWSAT 254          
BLAST of 40S ribosomal protein SA vs. TrEMBL
Match: T1JJ42 (40S ribosomal protein SA OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 2.882e-84
Identity = 123/196 (62.76%), Postives = 150/196 (76.53%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIAR 891
              ++DV+  L    H G+ N +FQM QYV  R   G H++ + K +EK+ LAA AIVA+ENP DICV+SS+   QRAVLKFA YTG+  +AGRFTPGTFTNQIQ AFR+PRLL+V+DP  DHQ V E+S+VN+PVIAFCNTDS ++ VDI IPCNN+G  SIG MW+LLAREV R+RGSISR I+WDV VDLF  R
Sbjct:   10 LKEDDVSRLLACGTHIGTQNVDFQMLQYVFKRKADGIHILNLRKTWEKLLLAARAIVAIENPADICVISSRPYGQRAVLKFASYTGSTPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRQDHQPVTEASYVNIPVIAFCNTDSPLRYVDIAIPCNNKGAHSIGLMWWLLAREVLRLRGSISREIKWDVMVDLFFYR 205          
BLAST of 40S ribosomal protein SA vs. TrEMBL
Match: A0A023FKD0 (Putative 40s ribosomal protein sa p40/laminin receptor 1 (Fragment) OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.150e-83
Identity = 127/246 (51.63%), Postives = 168/246 (68.29%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNEHVEEISH--------GVVAQPIAQQLDDWQAT 1017
              ++DV   L A  H G+ N +FQM++Y   R   G H+I + K +EK+ LAA AIVA+ENP ++C +SS+   QRAVLKFA +TGA  +AGRFTPGTFTNQIQ AFR+PRLL+V DP ADHQ V E+S+VNLPVIAFCNTD+ ++ VDI IPCNN+ + SIG MW++L REV R+RGSI R I W++ VDLF  R  EE  + ++ + +     V+E++         G VA   A ++ DW AT
Sbjct:   10 LKEDDVRRMLTAKTHLGTNNLDFQMKEYCFKRRPDGIHLINLKKTWEKLLLAARAIVAIENPAEVCAISSRPYGQRAVLKFASFTGATPIAGRFTPGTFTNQIQAAFREPRLLVVCDPRADHQPVTEASYVNLPVIAFCNTDATLRYVDIAIPCNNKSQHSIGLMWWMLTREVLRMRGSILRDIPWEIMVDLFFYRDPEETEKEEQAQQVAPERAVKEVAEYTTEQWGGGDVATATA-EVTDWSAT 254          
BLAST of 40S ribosomal protein SA vs. TrEMBL
Match: V5HHH1 (40S ribosomal protein SA OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 1.468e-83
Identity = 127/246 (51.63%), Postives = 165/246 (67.07%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVI------QMNEHVEEISHGVVAQPIAQQLDDWQATDN 1023
              D+DV   L A  H G+ N +FQM+QY   R   G H+I + K +EK+ LAA AIVA+ENP ++C +SS+   QRAVLKFA +TGA  +AGRFTPGTFTNQIQ AFR+PRLL++ DP ADHQ V E+S+VNLPVIAFCNTD+ ++ VDI IPCNN+G+ SIG MW++L REV R+RGSI R I W++ VDLF  R  EE  + ++ +V+      +  E   E   G         + DW AT +
Sbjct:   10 LKDDDVRRFLTAKTHMGTTNLDFQMQQYCFKRRSDGVHLIDLKKTWEKLLLAARAIVAIENPAEVCAISSRPHGQRAVLKFASFTGATPIAGRFTPGTFTNQIQAAFREPRLLVICDPRADHQPVTEASYVNLPVIAFCNTDASLRYVDIAIPCNNKGQHSIGLMWWMLTREVLRMRGSIIRDIPWEIMVDLFFYRDPEETEKEEQAQVVPERAVKETAEFPSEQWGGADVASAQPDVTDWSATPD 255          
BLAST of 40S ribosomal protein SA vs. Ensembl Cavefish
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:103024485])

HSP 1 Score: 256.144 bits (653), Expect = 1.643e-82
Identity = 125/240 (52.08%), Postives = 162/240 (67.50%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEE---ELQNKEDEVIQMNEHVEEISHGVV--AQPIAQQLDDW 1008
              + DV   L A  H G  N ++QME Y + R   G ++I + K +EK+ LAA AIVA+ENP D+CV+SS+ + QRAVLKFA  TGA   AGRFTPGTFTNQIQ AFR+PRLLIV+DP ADHQ + E+S+VN+P IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE   E Q   ++ +  +E   E +  V   AQP   ++ DW
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDYQMEHYAYKRKSDGIYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASATGATTFAGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIGIPCNNKGPHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKAVSKDEFQGEWTAPVADFAQP---EVADW 246          
BLAST of 40S ribosomal protein SA vs. Ensembl Cavefish
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:103024485])

HSP 1 Score: 256.144 bits (653), Expect = 1.643e-82
Identity = 125/240 (52.08%), Postives = 162/240 (67.50%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEE---ELQNKEDEVIQMNEHVEEISHGVV--AQPIAQQLDDW 1008
              + DV   L A  H G  N ++QME Y + R   G ++I + K +EK+ LAA AIVA+ENP D+CV+SS+ + QRAVLKFA  TGA   AGRFTPGTFTNQIQ AFR+PRLLIV+DP ADHQ + E+S+VN+P IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE   E Q   ++ +  +E   E +  V   AQP   ++ DW
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDYQMEHYAYKRKSDGIYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASATGATTFAGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIGIPCNNKGPHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKAVSKDEFQGEWTAPVADFAQP---EVADW 246          
BLAST of 40S ribosomal protein SA vs. Ensembl Sea Lamprey
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:394027])

HSP 1 Score: 120.939 bits (302), Expect = 1.134e-31
Identity = 80/243 (32.92%), Postives = 118/243 (48.56%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQ-RAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPV-IAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNEHVEEISHGVVAQPI----AQQLDDWQA 1014
              + DV   L A+ H G+ N +FQMEQYV+ R   G  ++ + K +EK+ LAA AIVA+ENP D+CV+SS+   Q R  +K   Y+        F+         + F Q  L IV  P+            N P+ I+  +      ++ + +PC   G  SIG MW++LAREV R+RG+I R   WD+  DL+  R  EE  + ++    +      E      AQP       ++ DW A
Sbjct:   10 MREEDVLKFLAANSHLGTTNCDFQMEQYVYKRKNDGIFILNLKKTWEKLLLAARAIVAIENPADVCVISSRPYGQLRLSIKLI-YSWKTVELKSFSIIKTIKSYVRLFCQAELRIVWSPL------------NCPLSISTVSCIPCAPDLPLSVPCYCTGAHSIGLMWWMLAREVLRLRGTIGREHPWDIMPDLYFYRDPEEIEKEEQAAAEKAAVKEPEYQGEWAAQPTEAPPPPEVADWAA 239          
BLAST of 40S ribosomal protein SA vs. Ensembl Yeast
Match: RPS0A (Ribosomal 40S subunit protein S0A; required for maturation of 18S rRNA along with Rps0Bp; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal; homologous to human ribosomal protein SA and bacterial S2; RPS0A has a paralog, RPS0B, that arose from the whole genome duplication; [Source:SGD;Acc:S000003446])

HSP 1 Score: 206.453 bits (524), Expect = 6.548e-65
Identity = 97/197 (49.24%), Postives = 134/197 (68.02%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGS-ISRSIEWDVKVDLFIAR 891
                D  + L A+ H G+ N     E YV +    G HVI + K +EK+ LAA  I A+ NP+D+  +SS+   QRAVLKFA +TGA  +AGRFTPG+FTN I ++F++PRL+IV+DP +D QA+ E+S+VN+PVIA  + DS  + VD+ IPCNNRG+ SIG +WYLLAREV R+RG+ + R+  W +  DL+  R
Sbjct:    9 LTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYFYR 205          
BLAST of 40S ribosomal protein SA vs. Ensembl Yeast
Match: RPS0B (Protein component of the small (40S) ribosomal subunit; RPS0B has a paralog, RPS0A, that arose from the whole genome duplication; required for maturation of 18S rRNA along with Rps0Ap; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal; homologous to human ribosomal protein SA and bacterial S2 [Source:SGD;Acc:S000004038])

HSP 1 Score: 205.682 bits (522), Expect = 1.182e-64
Identity = 97/198 (48.99%), Postives = 134/198 (67.68%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGS-ISRSIEWDVKVDLFIARS 894
                D  + L A+ H G+ N     E YV +    G HVI + K +EK+ LAA  I A+ NP+D+  +SS+   QRAVLKFA +TGA  +AGRFTPG+FTN I ++F++PRL+IV+DP  D QA+ E+S+VN+PVIA  + DS  + VD+ IPCNNRG+ SIG +WYLLAREV R+RG+ + R+  W +  DL+  R+
Sbjct:    9 LTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRLDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYFYRN 206          
BLAST of 40S ribosomal protein SA vs. Ensembl Yeast
Match: MRP4 (Mitochondrial ribosomal protein of the small subunit [Source:SGD;Acc:S000000996])

HSP 1 Score: 57.7658 bits (138), Expect = 1.151e-9
Identity = 49/199 (24.62%), Postives = 87/199 (43.72%), Query Frame = 1
Query:  319 VAMALKASVHEGSANKNFQ--MEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAV-ENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQ------------------KAFR--------QPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNR 828
            V   + A VH G +   ++   + Y++     G H+I +++    +  AA  +  V E+   I  + ++   +R + + A+ T  + V+ R+ PGT TN  +                  +A          +P LL+V +P  +  A+LE+    +P IA  +TDS    V   IP N+    S+ F+  +LAR   R
Sbjct:  185 VESLMSAGVHLGQSTSLWRSSTQSYIYGE-YKGIHIIDLNQTLSYLKRAAKVVEGVSESGGIILFLGTRQGQKRGLEEAAKKTHGYYVSTRWIPGTLTNSTEISGIWEKQEIDSNDNPTERALSPNETSKQVKPDLLVVLNPTENRNALLEAIKSRVPTIAIIDTDSEPSLVTYPIPGNDDSLRSVNFLLGVLARAGQR 382          
BLAST of 40S ribosomal protein SA vs. Ensembl Nematostella
Match: EDO48040 (40S ribosomal protein SA [Source:UniProtKB/Swiss-Prot;Acc:A7RKS5])

HSP 1 Score: 249.98 bits (637), Expect = 1.345e-80
Identity = 113/196 (57.65%), Postives = 148/196 (75.51%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIAR 891
              + DV   L A VH G+ N +FQME YV+ R   G ++I + K +EK+ LAA  IV +ENP D+CV+S++   QRA+LK+A +TGA  +AGRFTPGTFTNQIQ AFR+PRLLIV DP  DHQ V E+S+VN+PVIAFCNTDS +++VD+ IPCNN+G  SIG M++LLAREV R+RGSISR++ W++  DL+  R
Sbjct:   10 LKEEDVVKFLAAGVHLGANNCDFQMEDYVYKRKSDGVNIINVKKTWEKLLLAARIIVTIENPADVCVISARPYGQRAILKYASHTGATPIAGRFTPGTFTNQIQAAFREPRLLIVCDPRIDHQPVTEASYVNIPVIAFCNTDSPLRHVDVAIPCNNKGIHSIGLMFWLLAREVLRMRGSISRALPWEIMPDLYFYR 205          
BLAST of 40S ribosomal protein SA vs. Ensembl Medaka
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:101165063])

HSP 1 Score: 258.84 bits (660), Expect = 8.527e-84
Identity = 126/239 (52.72%), Postives = 161/239 (67.36%), Query Frame = 1
Query:  304 FNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNEHVEEISHGVVAQPIAQ----QLDDW 1008
              + DV   L A  H G  N +FQMEQYV+ R   G ++I + K +EK+ LAA AIVA+ENP D+CV+SS+ + QRAVLKFA  TGA    GRFTPGTFTNQIQ AFR+PRLLIV+DP ADHQ + E+S+VN+P IA CNTDS ++ VDI IPCNN+G  S+G MW++LAREV R+RG+ISR   W+V  DL+  R  EE    KE++       V+E   G    P A+    ++ DW
Sbjct:   10 MKEEDVLKFLAAGTHLGGTNLDFQMEQYVYKRKSDGVYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASATGATTFHGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDISIPCNNKGHHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEE--IEKEEQAAAEKAVVKEEFQGEWTAPAAEFTQPEVADW 246          
BLAST of 40S ribosomal protein SA vs. Planmine SMEST
Match: SMESG000016079.1 (SMESG000016079.1)

HSP 1 Score: 507.294 bits (1305), Expect = 0.000e+0
Identity = 246/246 (100.00%), Postives = 246/246 (100.00%), Query Frame = 1
Query:  292 MSRFFNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNEHVEEISHGVVAQPIAQQLDDWQATDNWA 1029
            MSRFFNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNEHVEEISHGVVAQPIAQQLDDWQATDNWA
Sbjct:    1 MSRFFNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNEHVEEISHGVVAQPIAQQLDDWQATDNWA 246          
BLAST of 40S ribosomal protein SA vs. Planmine SMEST
Match: SMESG000071180.1 (SMESG000071180.1)

HSP 1 Score: 365.925 bits (938), Expect = 1.185e-126
Identity = 177/252 (70.24%), Postives = 209/252 (82.94%), Query Frame = 1
Query:  289 MMSRFFNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQ-----MNEHVEEISHGVVAQPIAQQLDDWQATDNWA 1029
            MMS FFN+ND  M +KA VH G+ NKNFQM+QYV DRN +GNH++++DKI EK+ LAA AIVAVENPKD+CV+SS+ SSQR VLKF RYTGA  +AGRFTPGTFTNQIQKAFR+PRLLIVSDPIADHQAV+ESSFVN+PVIAFCNTDSIIK VDIVIPCNN+GE SIG MWYLLAREV R++G ISRSI+W+VKVDLFI R+ EE+ + ++DE +      +N   +E   G + QP +QQLDDWQ TDNWA
Sbjct:    1 MMS-FFNENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEMNVINSGNDETGFGPIGQP-SQQLDDWQNTDNWA 250          
BLAST of 40S ribosomal protein SA vs. Planmine SMEST
Match: SMESG000008583.1 (SMESG000008583.1)

HSP 1 Score: 169.088 bits (427), Expect = 2.930e-48
Identity = 99/200 (49.50%), Postives = 121/200 (60.50%), Query Frame = 1
Query:  469 IVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQMNE----HVEEISHGVVAQPIAQQL----------DDWQATDNW 1026
            +VAVENPKD+CV+SS   SQR VLKF RYT       +F   TFTNQ+Q  FR+PRLLIVSD I DHQAV+ESSFVN+PVIAFCNTD +IK  DIVIPCNN+GE  IG  WYLL REV     +     E  ++  L    S  ++   K+D+V    +    HV E +   V  P+ +Q           DD+ ATD W
Sbjct:    1 MVAVENPKDVCVMSSYPPSQRVVLKFGRYTED---NNKFCSETFTNQMQNGFREPRLLIVSDLITDHQAVIESSFVNIPVIAFCNTDGVIKYFDIVIPCNNKGEQLIGLTWYLLDREVPFTLSNSKNRDEILMESKLNKNLSCMQKRVAKDDQVESTLKLWFTHVRE-NDACVDGPLMRQRAAELATRMGKDDFVATDGW 196          
BLAST of 40S ribosomal protein SA vs. Planmine SMEST
Match: SMESG000025584.1 (SMESG000025584.1)

HSP 1 Score: 133.65 bits (335), Expect = 1.561e-37
Identity = 72/119 (60.50%), Postives = 88/119 (73.95%), Query Frame = 1
Query:  325 MALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVL 681
            M +K  +H G+ NKNFQM QYV DRN + NH+++  KI +K+ LAA AI+AVENP D+CVVSS++SSQR +LKF RYTGA  +A R T  TFTN IQK FR+P LLIVSD I DH   L
Sbjct:    1 MMIKTFIHIGANNKNFQMNQYVFDRNKARNHILKFYKICDKLQLAAKAIIAVENPDDVCVVSSRSSSQRGILKFGRYTGANPIASRSTTRTFTNHIQKTFREPGLLIVSDQITDHSEAL 119          
BLAST of 40S ribosomal protein SA vs. Planmine SMEST
Match: SMESG000061981.1 (SMESG000061981.1)

HSP 1 Score: 115.546 bits (288), Expect = 4.417e-31
Identity = 58/110 (52.73%), Postives = 73/110 (66.36%), Query Frame = 1
Query:  325 MALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSD 654
            M ++A VH    N   QM+Q+V DRN + NH++++D+I E + +AA AIV VENPKD+CV SS   SQR VLKF RYT A    GRF   TFTNQIQ  FR+ RL  V+ 
Sbjct:    1 MMIRAGVHMSVNNNYLQMDQFVFDRNKARNHILKLDEICEILQIAARAIVVVENPKDVCVTSSYPPSQRGVLKFGRYTRA---NGRFCLKTFTNQIQNEFRESRLFSVTQ 107          
The following BLAST results are available for this feature:
BLAST of 40S ribosomal protein SA vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RPSA5.829e-8357.50ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:... [more]
RPSA5.911e-8357.50ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:... [more]
RPSA2.558e-8056.10ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:... [more]
RPSA4.237e-3456.19ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps-03.343e-6846.4040S ribosomal protein SA [Source:UniProtKB/Swiss-... [more]
rps-03.343e-6846.4040S ribosomal protein SA [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sta6.154e-8359.18gene:FBgn0003517 transcript:FBtr0070290[more]
sta6.154e-8359.18gene:FBgn0003517 transcript:FBtr0070289[more]
sta6.154e-8359.18gene:FBgn0003517 transcript:FBtr0339594[more]
sta6.154e-8359.18gene:FBgn0003517 transcript:FBtr0339593[more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpsa8.381e-8458.50ribosomal protein SA [Source:NCBI gene;Acc:394027][more]
rpsa8.381e-8458.50ribosomal protein SA [Source:NCBI gene;Acc:394027][more]
rpsa5.244e-2253.16ribosomal protein SA [Source:NCBI gene;Acc:394027][more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ociad21.400e-8451.05OCIA domain containing 2 [Source:Xenbase;Acc:XB-GE... [more]
ociad23.061e-8451.05OCIA domain containing 2 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rpsa4.377e-8357.50ribosomal protein SA [Source:MGI Symbol;Acc:MGI:10... [more]
Rpsa4.377e-8357.50ribosomal protein SA [Source:MGI Symbol;Acc:MGI:10... [more]
Rpsa4.627e-3972.29ribosomal protein SA [Source:MGI Symbol;Acc:MGI:10... [more]
Rpsa2.280e-1544.00ribosomal protein SA [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of 40S ribosomal protein SA vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P8D1|RSSA_XENTR8.573e-8451.0540S ribosomal protein SA OS=Xenopus tropicalis OX=... [more]
sp|Q3ZM03|RSSA_XENLA1.041e-8351.0540S ribosomal protein SA OS=Xenopus laevis OX=8355... [more]
sp|A6NA00|RSSA_ORNPR2.159e-8355.7140S ribosomal protein SA OS=Ornithodoros parkeri O... [more]
sp|Q803F6|RSSA_DANRE6.327e-8358.5040S ribosomal protein SA OS=Danio rerio OX=7955 GN... [more]
sp|Q90YS4|RSSA_ICTPU9.359e-8353.5640S ribosomal protein SA OS=Ictalurus punctatus OX... [more]
back to top
BLAST of 40S ribosomal protein SA vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E7D1C21.301e-8554.32Putative ribosomal protein SA (Fragment) OS=Latrod... [more]
A0A023FYL25.762e-8551.4340S ribosomal protein SA OS=Amblyomma parvum OX=25... [more]
T1JJ422.882e-8462.7640S ribosomal protein SA OS=Strigamia maritima OX=... [more]
A0A023FKD01.150e-8351.63Putative 40s ribosomal protein sa p40/laminin rece... [more]
V5HHH11.468e-8351.6340S ribosomal protein SA OS=Ixodes ricinus OX=3461... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpsa1.643e-8252.08ribosomal protein SA [Source:NCBI gene;Acc:1030244... [more]
rpsa1.643e-8252.08ribosomal protein SA [Source:NCBI gene;Acc:1030244... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpsa1.134e-3132.92ribosomal protein SA [Source:NCBI gene;Acc:394027][more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RPS0A6.548e-6549.24Ribosomal 40S subunit protein S0A; required for ma... [more]
RPS0B1.182e-6448.99Protein component of the small (40S) ribosomal sub... [more]
MRP41.151e-924.62Mitochondrial ribosomal protein of the small subun... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO480401.345e-8057.6540S ribosomal protein SA [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpsa8.527e-8452.72ribosomal protein SA [Source:NCBI gene;Acc:1011650... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016079.10.000e+0100.00SMESG000016079.1[more]
SMESG000071180.11.185e-12670.24SMESG000071180.1[more]
SMESG000008583.12.930e-4849.50SMESG000008583.1[more]
SMESG000025584.11.561e-3760.50SMESG000025584.1[more]
SMESG000061981.14.417e-3152.73SMESG000061981.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028665 ID=SMED30028665|Name=40S ribosomal protein SA|organism=Schmidtea mediterranea sexual|type=transcript|length=1228bp
ATCGACCATTGACCATTCCACTCTACAATGATCGGAAACCGACAAATCCG
GCAGGATATGTGTTCTAACTATGAATAGGGTCAATAACATAAACAATCAT
AATGAGAAAATTGATTTACCACTAATAATCTAATAATTCTAGTATCCGGA
GAATTTGCTGAGACAAATCAATTAATCTGATCGGAAAGTTTATAACAATG
GAATTTACGTTACATTCGGATGAAGCAACAATAAAATCAGGAATGTTCTC
GGAGGGAGAAGGATCGAGAAAATTGGTCGCTACGAATAATGATGAGTAGG
TTTTTTAATGACAATGACGTCGCAATGGCCCTAAAAGCATCAGTTCACGA
AGGATCGGCTAACAAAAATTTTCAAATGGAACAATATGTTCATGATAGAA
ATGTTTCTGGTAATCACGTTATCAGAATTGACAAAATCTTTGAAAAAATT
TATTTGGCTGCATCTGCTATTGTTGCTGTTGAAAATCCAAAAGACATTTG
TGTTGTTTCTTCAAAAGCTTCTTCACAAAGAGCTGTTTTGAAATTCGCCA
GATACACTGGAGCATTTGCAGTAGCTGGACGTTTTACTCCTGGAACCTTC
ACCAATCAAATCCAGAAAGCATTCAGGCAACCAAGACTTTTAATTGTCAG
TGATCCAATTGCCGATCATCAAGCTGTATTGGAAAGTAGTTTTGTTAACC
TTCCAGTTATTGCATTTTGCAATACTGACAGCATTATCAAGAACGTTGAT
ATTGTCATTCCCTGCAATAACAGAGGAGAATTGTCTATTGGATTCATGTG
GTACTTGTTGGCCAGAGAAGTAAACAGAATTCGTGGATCTATCAGCAGAT
CAATTGAATGGGATGTTAAAGTTGATCTTTTTATTGCAAGAAGCGCAGAA
GAAGAATTACAAAATAAAGAAGACGAAGTTATTCAAATGAACGAACATGT
TGAAGAAATTAGCCATGGAGTTGTCGCTCAACCAATTGCCCAGCAATTGG
ACGATTGGCAAGCAACTGATAACTGGGCTTAAAATCGACTCAATATAATC
TGGATCTATGACTTTGCTATTTTTTATCCGCTTTTTTTATTTGTATTAAG
TTGCTATTTTTTACGTTATCAAAAATGTTTTAGTAAATATTGTTAGATTT
TCTACATTAATTAAATCTTTTTCAAAAGTTATTTGTTATTTTATTATAAA
ACTAATGTTTTTAGAATCTGAAGCTGGT
back to top

protein sequence of SMED30028665-orf-1

>SMED30028665-orf-1 ID=SMED30028665-orf-1|Name=SMED30028665-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
MMSRFFNDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKI
FEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFT
PGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSII
KNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIA
RSAEEELQNKEDEVIQMNEHVEEISHGVVAQPIAQQLDDWQATDNWA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000028ribosomal small subunit assembly
GO:0006412translation
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0022627cytosolic small ribosomal subunit
GO:0005622intracellular
GO:0005840ribosome
GO:0005634nucleus
GO:0005737cytoplasm
GO:0015935small ribosomal subunit
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000136whole organism
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001865Ribosomal_S2
IPR018130Ribosomal_S2_CS
IPR023591Ribosomal_S2_flav_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome