Cilia-and flagella-associated protein 100

Overview
NameCilia-and flagella-associated protein 100
Smed IDSMED30028659
Length (bp)1897
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cilia-and flagella-associated protein 100 (SMED30028659) t-SNE clustered cells

Violin plots show distribution of expression levels for Cilia-and flagella-associated protein 100 (SMED30028659) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cilia-and flagella-associated protein 100 (SMED30028659) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cilia-and flagella-associated protein 100 (SMED30028659) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028659

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028659SMESG000033127.1 SmedASXL_013714SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30028659SMESG000033127.1 dd_Smed_v4_6518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30028659SMESG000033127.1 dd_Smed_v4_6518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30028659SMESG000033127.1 dd_Smed_v4_6518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30028659SMESG000033127.1 dd_Smed_v4_6518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30028659SMESG000033127.1 dd_Smed_v4_6518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30028659SMESG000033127.1 dd_Smed_v6_6518_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30028659SMESG000033127.1 dd_Smed_v6_6518_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028659SMESG000033127.1 dd_Smed_v4_6518_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30028659SMESG000033127.1 dd_Smed_v4_6518_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Human
Match: CFAP100 (cilia and flagella associated protein 100 [Source:HGNC Symbol;Acc:HGNC:26842])

HSP 1 Score: 257.684 bits (657), Expect = 9.049e-77
Identity = 211/564 (37.41%), Postives = 338/564 (59.93%), Query Frame = 3
Query:  267 SKNPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEK-TYGIDSRIKFRQAAL---LKIPDDDES----ATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEE------------AIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYSSDDS-------------------EMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCV-SDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            S NPF    +VD F LRD+ER   L ER++Q+ ++VH+K TY   S++  +  +L   L++ D  E     A  +     ++   + ++ TK++  E E +S YI +KR+MFLLQY+L VKR E+++LE +A+ EE +LE AE+ LE+DAA+FD+F++END ++V AM+ AE E+K ++ K+ E++ L TQ++ IKSEI+++E+ LK YK+YK FL +L P+    E+E      ++AK   +  +E             I   A +      Q ++K     + + L  S    S+ QQ  +  + S  DS                   E  LYF + Q +L++F ELEE NLSLIQ  QETE++L+EL    + T+++M R+ + L + +T +  SI  EE+   ELE+K ++F   + K + QD+ LE L+ KV +VYR+C  + +EA + T++MLT IE+QL+ L E ++ +P  K+E A++AK+KERRI+++EEK + Q++  EE+  +A  R +A  KK+ GR LV RS PP  + +  + +   ++EEEE+ +FFT
Sbjct:   50 SANPFHLSGDVDFFLLRDQERNKALSERQQQKTMRVHQKMTYS--SKVSAKHTSLRRQLQLEDKQEDLEARAEAEHQRAFRDYTTWKLTLTKEKNVEPENMSGYIKQKRQMFLLQYALDVKRREIQRLETLATKEEARLERAEKSLEKDAALFDEFVRENDCSSVQAMRAAEKETKAKIEKILEIRDLTTQIVNIKSEISRFEDTLKHYKVYKDFLYKLSPKEWLEEQEKKHSFLKKAKEVSEASKESSVNSTPGDKGPGIKGKASSMWAKEGQGTKKPWRFLQTMRLGRSPSYLSSPQQGSQPSESSGGDSRGSNSPIPPTQEDTDSDGEEPQLYFTEPQQLLDVFRELEEQNLSLIQNSQETEKTLEELSHTLKHTQIRMDREVNQLKQWVTTMMMSITKEEDTAAELELKARVFHFGEYKGDQQDKLLESLNCKVLDVYRHCTGTQQEANLGTVQMLTIIEHQLDELLENLEHVPQVKIEQAERAKEKERRIRLREEKLQMQKILQEEHLQRARARAQAEIKKKRGRTLVCRSRPPAHRIKQQSEHTLMDKEEEELLFFFT 611          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Human
Match: CFAP100 (cilia and flagella associated protein 100 [Source:HGNC Symbol;Acc:HGNC:26842])

HSP 1 Score: 253.062 bits (645), Expect = 5.514e-75
Identity = 211/565 (37.35%), Postives = 338/565 (59.82%), Query Frame = 3
Query:  267 SKNPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEK-TYGIDSRIKFRQAAL---LKIPDDDES----ATQDQSLVVKEDPEFVISATK-DRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEE------------AIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYSSDDS-------------------EMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCV-SDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            S NPF    +VD F LRD+ER   L ER++Q+ ++VH+K TY   S++  +  +L   L++ D  E     A  +     ++   + ++ TK ++  E E +S YI +KR+MFLLQY+L VKR E+++LE +A+ EE +LE AE+ LE+DAA+FD+F++END ++V AM+ AE E+K ++ K+ E++ L TQ++ IKSEI+++E+ LK YK+YK FL +L P+    E+E      ++AK   +  +E             I   A +      Q ++K     + + L  S    S+ QQ  +  + S  DS                   E  LYF + Q +L++F ELEE NLSLIQ  QETE++L+EL    + T+++M R+ + L + +T +  SI  EE+   ELE+K ++F   + K + QD+ LE L+ KV +VYR+C  + +EA + T++MLT IE+QL+ L E ++ +P  K+E A++AK+KERRI+++EEK + Q++  EE+  +A  R +A  KK+ GR LV RS PP  + +  + +   ++EEEE+ +FFT
Sbjct:   50 SANPFHLSGDVDFFLLRDQERNKALSERQQQKTMRVHQKMTYS--SKVSAKHTSLRRQLQLEDKQEDLEARAEAEHQRAFRDYTTWKLTLTKAEKNVEPENMSGYIKQKRQMFLLQYALDVKRREIQRLETLATKEEARLERAEKSLEKDAALFDEFVRENDCSSVQAMRAAEKETKAKIEKILEIRDLTTQIVNIKSEISRFEDTLKHYKVYKDFLYKLSPKEWLEEQEKKHSFLKKAKEVSEASKESSVNSTPGDKGPGIKGKASSMWAKEGQGTKKPWRFLQTMRLGRSPSYLSSPQQGSQPSESSGGDSRGSNSPIPPTQEDTDSDGEEPQLYFTEPQQLLDVFRELEEQNLSLIQNSQETEKTLEELSHTLKHTQIRMDREVNQLKQWVTTMMMSITKEEDTAAELELKARVFHFGEYKGDQQDKLLESLNCKVLDVYRHCTGTQQEANLGTVQMLTIIEHQLDELLENLEHVPQVKIEQAERAKEKERRIRLREEKLQMQKILQEEHLQRARARAQAEIKKKRGRTLVCRSRPPAHRIKQQSEHTLMDKEEEELLFFFT 612          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Human
Match: CCDC38 (coiled-coil domain containing 38 [Source:HGNC Symbol;Acc:HGNC:26843])

HSP 1 Score: 166.007 bits (419), Expect = 1.316e-43
Identity = 154/461 (33.41%), Postives = 268/461 (58.13%), Query Frame = 3
Query:  534 KETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFE----REGASKARRE-------AKRKIKQE-EEAIARIARTNXXXXXXXXXXXXXXXKPIDLI----------LSKVETSADQQELKLEDYSSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREA-KMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEK-KEQQRLHHEENKLKA-LERVRAAPKKQFGRRLVGRSEPPQFQKED-PALNDQRNREEEEMAYFFT 1838
            K T+ E+I  +R+ FLL+Y+L  KR  ++K E+  +  E++L+ AE+ L++DA  F++FL+END+ +VDA+K+A  E+  ++   +E+K  + ++  +KSEI K E  L+EY  Y  FL ++ P++ + +    R  ASK++         AK  +    +E I   +   +  S  +S+ R    KP   +          L++   S D  E  L+D    D E  LYFK+ +++L +  ELEE NL+L Q  Q+ +E+L+E+ + ++  + K   + + L++Q   L+ +   EEEK  EL++K KLF+  +  ++ Q+  ++ L +K+ +VY+ C+ D E   ++ ++ L  +E++L  L + I+ +P E VE  ++ K KE R + ++EK KE+QR  H++ +LKA LE+  A PKK+ GRRLV  S+PP   K+  P +N+ + + +EE  YFFT
Sbjct:  106 KRTVHEFINDQRDRFLLEYALSTKRNTIKKFEKDIAMRERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAELKKASMEVQAVKSEIAKTEFLLREYMKYGFFLLQMSPKHWQIQQALKRAQASKSKANIILPKILAKLSLHSSNKEGILEESGRTAVLSEDASQGRDSQGKPSRSLTRTPEKKKSNLAESFGSEDSLEFLLDDEMDVDLEPALYFKEPEELLQVLRELEEQNLTLFQYSQDVDENLEEVNKREKVIQDKTNSNIEFLLEQEKMLKANCVREEEKAAELQLKSKLFSFGEFNSDAQEILIDSLSKKITQVYKVCIGDAEDDGLNPIQKLVKVESRLVELCDLIESIPKENVEAIERMKQKEWRQKFRDEKMKEKQR--HQQERLKAALEKAVAQPKKKLGRRLVFHSKPPSGNKQQLPLVNETKTKSQEE-EYFFT 563          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Zebrafish
Match: cfap100 (cilia and flagella associated protein 100 [Source:ZFIN;Acc:ZDB-GENE-060929-352])

HSP 1 Score: 244.202 bits (622), Expect = 2.126e-72
Identity = 183/457 (40.04%), Postives = 285/457 (62.36%), Query Frame = 3
Query:  507 SATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEA--IARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYS---------SDDSEMD--LYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            +  KD   ++ ++ EYI KKRE+FLL+YSL VKR E++ LE++A+ EE+KL  AE++LE+D  +F++FLKENDKN+V+A+KVAE E+K ++ KV+E+K + ++++ I+S+I+KYE+ LKEYK YK FL  L P+  + E+   SK    + R   +E +     +I ++  + +     KR   +       S+   ++ +Q +K    S         S D E D  +YFKD Q++LN+ TELEE NLSLIQ  +ETEE+L+E +Q  +     M+ ++  L  QI  + ++I  E E+  ELE+K K F+    K EDQD+  + L +KV+EVY  CV + EA +STL+ML  IE +L  L E  +++P +++  A++AK+KERR+++++EK   QR   EE + KALER R   KK   ++L+ RS+PP  +      N+  +RE EE  YFF+
Sbjct:   95 ACIKDPNTDRGSMHEYIAKKRELFLLEYSLEVKRGEIQLLEQMAAEEEEKLSRAEKFLEDDTILFEEFLKENDKNSVEAIKVAEQETKVKLEKVAEIKKITSKMVAIRSDISKYEDILKEYKNYKEFLLMLSPQEWQEEQRSKSK---HSTRPTNKESDGKQTEKIKKSREKKTVPPDSKRGERQTARGFSSSQEARTSSRQSVKSSPQSNKIFAPGTDSSDCEEDPQIYFKDPQELLNLMTELEEQNLSLIQNTRETEEALEEFRQNAEVIHKNMETESKQLKAQIDIMTETIQRERERTAELELKAKHFSFGQCKPEDQDKTFDTLSRKVEEVYHCCVGETEANLSTLQMLMAIEEKLGELLENAEKIPKDQMSTAERAKEKERRMRLRDEKAYLQRKQQEERQKKALERSRLDVKKPSVKKLMPRSQPPVRKLHSNKNNETTDRENEEFLYFFS 548          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Zebrafish
Match: cfap100 (cilia and flagella associated protein 100 [Source:ZFIN;Acc:ZDB-GENE-060929-352])

HSP 1 Score: 242.662 bits (618), Expect = 8.055e-72
Identity = 182/457 (39.82%), Postives = 286/457 (62.58%), Query Frame = 3
Query:  507 SATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEA--IARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYS---------SDDSEMD--LYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            +  KD   ++ ++ EYI KKRE+FLL+YSL VKR E++ LE++A+ EE+KL  AE++LE+D  +F++FLKENDKN+V+A+KVAE E+K ++ KV+E+K + ++++ I+S+I+KYE+ LKEYK YK FL  L P+  + E+   SK    + R   +E +     +I ++  + +     KR   +       S+   ++ +Q +K    S         S D E D  +YFKD Q++LN+ TELEE NLSLIQ  +ETEE+L+E +Q  +     M+ ++  L  QI  + ++I  E E+  ELE+K K F+    K EDQD+  + L +KV+EVY  CV + EA +STL+ML  IE +L  L E  +++P +++  A++AK+KERR+++++EK   QR   EE + KALER R   KK   ++L+ RS+PP  +      N+  +RE EE+ +FF+
Sbjct:   95 ACIKDPNTDRGSMHEYIAKKRELFLLEYSLEVKRGEIQLLEQMAAEEEEKLSRAEKFLEDDTILFEEFLKENDKNSVEAIKVAEQETKVKLEKVAEIKKITSKMVAIRSDISKYEDILKEYKNYKEFLLMLSPQEWQEEQRSKSK---HSTRPTNKESDGKQTEKIKKSREKKTVPPDSKRGERQTARGFSSSQEARTSSRQSVKSSPQSNKIFAPGTDSSDCEEDPQIYFKDPQELLNLMTELEEQNLSLIQNTRETEEALEEFRQNAEVIHKNMETESKQLKAQIDIMTETIQRERERTAELELKAKHFSFGQCKPEDQDKTFDTLSRKVEEVYHCCVGETEANLSTLQMLMAIEEKLGELLENAEKIPKDQMSTAERAKEKERRMRLRDEKAYLQRKQQEERQKKALERSRLDVKKPSVKKLMPRSQPPVRKLHSNKNNETTDRENEEILHFFS 548          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Xenopus
Match: ENSXETT00000019754.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:122532363:122540467:-1 gene:ENSXETG00000007169.1 transcript:ENSXETT00000019754.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 275.404 bits (703), Expect = 3.414e-85
Identity = 203/450 (45.11%), Postives = 294/450 (65.33%), Query Frame = 3
Query:  498 FVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKR---KIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYSSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
             +I +  D  A++E+L EYI KKREMFLL+YSL VKR+E++KLE +A+AEE KLE AEQYLEEDA  FD+FLK+ND+N+V+A+K+A+ E+K +M KV+++KS    +M  KS+I+K EE L+EY MYK FL +L P+  R ERE  +  R++       +++E++A +                           LSKV  S D  + KL        E +LYF D Q +L+IF+ELEE NLSLIQ  QETEESL+E+KQ    T+ KM+++T  L   I  L+ SI  EEE+  ELE+K ++FA    K+EDQ++ L  L +KV+EVYR C+ +  +  + L+ML  IE+QLE L + I+ +P +++E+A+KAK+KERR++++EEK +QQ+ H EE   KALER +A PKK  GR+L+ RS+PP  +       D+ ++E+EE   FF+
Sbjct:   37 ILIFSVLDGLAQRESLHEYINKKREMFLLEYSLIVKRDEIQKLETMAAAEEMKLEKAEQYLEEDAVRFDEFLKQNDRNSVEALKLADKETKAKMEKVAQIKSQTALMMNTKSDISKCEEILREYLMYKEFLYKLSPKEWREERERKNLERKKPPATPLPVEKEKQAGS---------------------------LSKVSMSPDMIKSKL-----SGGEAELYFNDPQQLLDIFSELEEQNLSLIQNSQETEESLEEIKQNIAITQDKMEKETRQLKDHIDHLKASIVKEEERAAELELKSRVFAFGQYKSEDQEKMLAALGEKVEEVYRACIGENRSNYNVLQMLMAIEHQLEELLDNIEMIPQKRLEIAEKAKEKERRLRLREEKIKQQKQHQEERLRKALERAQADPKKTTGRKLMSRSDPPAPKLRIDKDQDKIDKEKEEALLFFS 454          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Mouse
Match: Cfap100 (cilia and flagella associated protein 100 [Source:MGI Symbol;Acc:MGI:2141635])

HSP 1 Score: 226.868 bits (577), Expect = 2.403e-65
Identity = 205/564 (36.35%), Postives = 339/564 (60.11%), Query Frame = 3
Query:  264 KSKNPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEK-TYGIDSRIKFRQAAL---LKIPDDDE----SATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENI---RFEREGASKARREAKRKIKQEEEAI-----ARIARTNXXXXXXXXXXXXXXXKPIDLI--LSKVETSADQ--QELKLEDYSSDDSEMDLYFKDHQD------------------MLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVS-DREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            +S NPF    ++D F LR++E+   + ERE+++ L+VH+K TY   S++  +  +L   L++ D+ E    +A   +    +E+ ++ ++ T++R+ E ETL++Y+ K+R MFLLQY+L +KR E+++LE +A+ EE +LE AE++LE+DA++FD+FL+END+N+V AM++AE E+K +  K+ E++ L  Q+  IKSEI+K+E+ LK YK+YK FL +L P+     + E+  A K  +E+    +    AI        +++ +    +       + K   L+  LS    S  Q  Q  +L  +S  DS +       QD                  +L++FT+LEE NLSLIQ  QE EE+LDEL    + T+++M ++ ++L + I  +  SI+ EEE   ELE+K ++F   + + + QD  LE L+ KV EVYR CV   +EA + T++MLT +E QL+ L E ++++P  K+E A+KAK++ERR++++EEK   Q+   EE   +A  R +A  KK+ GR+L+ RS PP  + ++       N+++EEM +FFT
Sbjct:   52 RSSNPFHISRDMDYFLLREQEQNQAIAEREQKKILRVHQKMTYA--SKVSAKHTSLRRELQLEDEMEQQLLNAEAKEMNCFRENNDWKLAMTRERKREPETLNDYMEKRRSMFLLQYALAMKRNEIQRLEMLATREENRLERAEKFLEKDASLFDEFLRENDRNSVQAMRMAEKETKIKTEKIVEIRELTAQITSIKSEISKFEDTLKHYKIYKEFLYKLSPKEWLDEQQEKHLAFKRAKESSELTRNNSTAILFGDKGSGSKSKTAFLWKEVPGLKKVTKTGRLVKALSSSIQSLPQVGQLTQLSPHSELDSRLSSTMFPSQDDTDSDGEELALYFTEPQQLLDVFTKLEEENLSLIQNTQEMEETLDELNVTLKNTQIRMDKEVNLLKQWIASMMISISKEEESAAELELKARVFHFGEYQGDQQDTMLESLNHKVLEVYRKCVGMQQEANLGTVQMLTVVERQLDELLENLERVPQVKIEQAEKAKERERRMRLREEKAMMQKQLQEERLQRARARAQAKIKKKRGRKLISRSHPPVIKVKEVREQTLINKDKEEMLFFFT 613          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Mouse
Match: Cfap100 (cilia and flagella associated protein 100 [Source:MGI Symbol;Acc:MGI:2141635])

HSP 1 Score: 200.675 bits (509), Expect = 4.220e-57
Identity = 173/457 (37.86%), Postives = 274/457 (59.96%), Query Frame = 3
Query:  561 KKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENI---RFEREGASKARREAKRKIKQEEEAI-----ARIARTNXXXXXXXXXXXXXXXKPIDLI--LSKVETSADQ--QELKLEDYSSDDSEMDLYFKDHQD------------------MLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVS-DREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            K+R MFLLQY+L +KR E+++LE +A+ EE +LE AE++LE+DA++FD+FL+END+N+V AM++AE E+K +  K+ E++ L  Q+  IKSEI+K+E+ LK YK+YK FL +L P+     + E+  A K  +E+    +    AI        +++ +    +       + K   L+  LS    S  Q  Q  +L  +S  DS +       QD                  +L++FT+LEE NLSLIQ  QE EE+LDEL    + T+++M ++ ++L + I  +  SI+ EEE   ELE+K ++F   + + + QD  LE L+ KV EVYR CV   +EA + T++MLT +E QL+ L E ++++P  K+E A+KAK++ERR++++EEK   Q+   EE   +A  R +A  KK+ GR+L+ RS PP  + ++       N+++EEM +FFT
Sbjct:    3 KRRSMFLLQYALAMKRNEIQRLEMLATREENRLERAEKFLEKDASLFDEFLRENDRNSVQAMRMAEKETKIKTEKIVEIRELTAQITSIKSEISKFEDTLKHYKIYKEFLYKLSPKEWLDEQQEKHLAFKRAKESSELTRNNSTAILFGDKGSGSKSKTAFLWKEVPGLKKVTKTGRLVKALSSSIQSLPQVGQLTQLSPHSELDSRLSSTMFPSQDDTDSDGEELALYFTEPQQLLDVFTKLEEENLSLIQNTQEMEETLDELNVTLKNTQIRMDKEVNLLKQWIASMMISISKEEESAAELELKARVFHFGEYQGDQQDTMLESLNHKVLEVYRKCVGMQQEANLGTVQMLTVVERQLDELLENLERVPQVKIEQAEKAKERERRMRLREEKAMMQKQLQEERLQRARARAQAKIKKKRGRKLISRSHPPVIKVKEVREQTLINKDKEEMLFFFT 459          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Mouse
Match: Ccdc38 (coiled-coil domain containing 38 [Source:MGI Symbol;Acc:MGI:2444738])

HSP 1 Score: 172.94 bits (437), Expect = 3.876e-46
Identity = 168/526 (31.94%), Postives = 293/526 (55.70%), Query Frame = 3
Query:  366 LKVHEKTYGIDSRIKFRQ--AALLKIPDDDESATQDQSLVVKEDPEFVISATK--DRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFE----REGASKARREAKR-------------------KIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYSSDDSEMDL----YFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDRE-AKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEK-KEQQRLHHEENKLKA-LERVRAAPKKQFGRRLVGRSEPPQFQKEDPAL-NDQRNREEEEMAYFFT 1838
            +K+++KT    SR+K R     L    D   S+ +   L    DP  ++  T+  DR   K T+ E+I  +R+ FLL+Y++  K++ +++ E + + +E +L+ AE+ L++DA  F++FL+END+ +VDA+K+A  E+  ++   SE+K  + ++  IKS+I K E  LKEY  Y  FL +L P+  + +    R  +SK+     +                   K+   EE  +R  R +              +K       +   S D  E  LED   +  E DL    YFK+ +++L +FTELEE NL+L+Q  Q+ +E+L+++ + ++  + K+  +   L++    L  +   EEEK  ELE++ +LF+  +  ++ Q++ ++ L +K+++VYR C+ D E   ++ ++ L  +E++L  L + I+ +P E VE  ++ K KERR +++EEK KE+QR  H+E +LKA LER  A PKK+ GRRL+ RS+P    K++  L +D R++ ++E  YFF+
Sbjct:   54 MKIYQKT-TFSSRMKSRSHLGQLAFFADAGSSSYERLGL----DPTLILRLTEGADR---KRTVHEFINDQRDRFLLEYTVSTKKKTIKRFERLIAIKENQLKKAEKKLQDDALSFEEFLRENDQRSVDALKMAAQETINKLQMTSELKKASMEVQSIKSDIAKTEFLLKEYMKYGFFLLKLSPKQWQIQQSQKRAQSSKSNHILPKILEKFSINTAKGDNSIDSDKMSVSEEWSSR--RGSQGGRHGKHTLGQDSRKSSGFTRPESMASEDSLEYFLED---ELVEFDLLPEIYFKEPEELLQVFTELEEQNLTLVQYSQDVDENLEDVNKREKFIQDKINNNISFLLEHKHMLRMNCEREEEKAAELELRSRLFSFGEFNSDAQEKLIDSLSKKINQVYRVCIGDAEVGSLNAVQKLVKVESRLVELSDLIESIPREHVEAIERLKQKERRQKLREEKMKEKQR--HQEERLKAALERAVAQPKKKLGRRLIYRSKPQSADKQELLLVSDTRSKSQDE-EYFFS 563          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Mouse
Match: Ccdc38 (coiled-coil domain containing 38 [Source:MGI Symbol;Acc:MGI:2444738])

HSP 1 Score: 89.7373 bits (221), Expect = 2.369e-18
Identity = 85/289 (29.41%), Postives = 153/289 (52.94%), Query Frame = 3
Query:  534 KETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFE----REGASKARREAKR-------------------KIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYSSDDSEMDL----YFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLM 1319
            K T+ E+I  +R+ FLL+Y++  K++ +++ E + + +E +L+ AE+ L++DA  F++FL+END+ +VDA+K+A  E+  ++   SE+K  + ++  IKS+I K E  LKEY  Y  FL +L P+  + +    R  +SK+     +                   K+   EE  +R  R +              +K       +   S D  E  LED   +  E DL    YFK+ +++L +FTELEE NL+L+Q  Q+ +E+L+++ + ++  + K+  +   L+
Sbjct:    6 KRTVHEFINDQRDRFLLEYTVSTKKKTIKRFERLIAIKENQLKKAEKKLQDDALSFEEFLRENDQRSVDALKMAAQETINKLQMTSELKKASMEVQSIKSDIAKTEFLLKEYMKYGFFLLKLSPKQWQIQQSQKRAQSSKSNHILPKILEKFSINTAKGDNSIDSDKMSVSEEWSSR--RGSQGGRHGKHTLGQDSRKSSGFTRPESMASEDSLEYFLED---ELVEFDLLPEIYFKEPEELLQVFTELEEQNLTLVQYSQDVDENLEDVNKREKFIQDKINNNISFLL 289          

HSP 2 Score: 88.5817 bits (218), Expect = 5.742e-18
Identity = 56/141 (39.72%), Postives = 95/141 (67.38%), Query Frame = 3
Query: 1428 QDEFLERLHQKVDEVYRNCVSDRE-AKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEK-KEQQRLHHEENKLKA-LERVRAAPKKQFGRRLVGRSEPPQFQKEDPAL-NDQRNREEEEMAYFFT 1838
            +++ ++ L +K+++VYR C+ D E   ++ ++ L  +E++L  L + I+ +P E VE  ++ K KERR +++EEK KE+QR  H+E +LKA LER  A PKK+ GRRL+ RS+P    K++  L +D R++ ++E  YFF+
Sbjct:  387 EEKLIDSLSKKINQVYRVCIGDAEVGSLNAVQKLVKVESRLVELSDLIESIPREHVEAIERLKQKERRQKLREEKMKEKQR--HQEERLKAALERAVAQPKKKLGRRLIYRSKPQSADKQELLLVSDTRSKSQDE-EYFFS 524          
BLAST of Cilia-and flagella-associated protein 100 vs. UniProt/SwissProt
Match: sp|Q494V2|CP100_HUMAN (Cilia- and flagella-associated protein 100 OS=Homo sapiens OX=9606 GN=CFAP100 PE=1 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 4.346e-76
Identity = 211/564 (37.41%), Postives = 338/564 (59.93%), Query Frame = 3
Query:  267 SKNPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEK-TYGIDSRIKFRQAAL---LKIPDDDES----ATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEE------------AIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYSSDDS-------------------EMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCV-SDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            S NPF    +VD F LRD+ER   L ER++Q+ ++VH+K TY   S++  +  +L   L++ D  E     A  +     ++   + ++ TK++  E E +S YI +KR+MFLLQY+L VKR E+++LE +A+ EE +LE AE+ LE+DAA+FD+F++END ++V AM+ AE E+K ++ K+ E++ L TQ++ IKSEI+++E+ LK YK+YK FL +L P+    E+E      ++AK   +  +E             I   A +      Q ++K     + + L  S    S+ QQ  +  + S  DS                   E  LYF + Q +L++F ELEE NLSLIQ  QETE++L+EL    + T+++M R+ + L + +T +  SI  EE+   ELE+K ++F   + K + QD+ LE L+ KV +VYR+C  + +EA + T++MLT IE+QL+ L E ++ +P  K+E A++AK+KERRI+++EEK + Q++  EE+  +A  R +A  KK+ GR LV RS PP  + +  + +   ++EEEE+ +FFT
Sbjct:   50 SANPFHLSGDVDFFLLRDQERNKALSERQQQKTMRVHQKMTYS--SKVSAKHTSLRRQLQLEDKQEDLEARAEAEHQRAFRDYTTWKLTLTKEKNVEPENMSGYIKQKRQMFLLQYALDVKRREIQRLETLATKEEARLERAEKSLEKDAALFDEFVRENDCSSVQAMRAAEKETKAKIEKILEIRDLTTQIVNIKSEISRFEDTLKHYKVYKDFLYKLSPKEWLEEQEKKHSFLKKAKEVSEASKESSVNSTPGDKGPGIKGKASSMWAKEGQGTKKPWRFLQTMRLGRSPSYLSSPQQGSQPSESSGGDSRGSNSPIPPTQEDTDSDGEEPQLYFTEPQQLLDVFRELEEQNLSLIQNSQETEKTLEELSHTLKHTQIRMDREVNQLKQWVTTMMMSITKEEDTAAELELKARVFHFGEYKGDQQDKLLESLNCKVLDVYRHCTGTQQEANLGTVQMLTIIEHQLDELLENLEHVPQVKIEQAERAKEKERRIRLREEKLQMQKILQEEHLQRARARAQAEIKKKRGRTLVCRSRPPAHRIKQQSEHTLMDKEEEELLFFFT 611          
BLAST of Cilia-and flagella-associated protein 100 vs. UniProt/SwissProt
Match: sp|Q80VN0|CP100_MOUSE (Cilia- and flagella-associated protein 100 OS=Mus musculus OX=10090 GN=Cfap100 PE=2 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 1.681e-64
Identity = 205/564 (36.35%), Postives = 339/564 (60.11%), Query Frame = 3
Query:  264 KSKNPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEK-TYGIDSRIKFRQAAL---LKIPDDDE----SATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENI---RFEREGASKARREAKRKIKQEEEAI-----ARIARTNXXXXXXXXXXXXXXXKPIDLI--LSKVETSADQ--QELKLEDYSSDDSEMDLYFKDHQD------------------MLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVS-DREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            +S NPF    ++D F LR++E+   + ERE+++ L+VH+K TY   S++  +  +L   L++ D+ E    +A   +    +E+ ++ ++ T++R+ E ETL++Y+ K+R MFLLQY+L +KR E+++LE +A+ EE +LE AE++LE+DA++FD+FL+END+N+V AM++AE E+K +  K+ E++ L  Q+  IKSEI+K+E+ LK YK+YK FL +L P+     + E+  A K  +E+    +    AI        +++ +    +       + K   L+  LS    S  Q  Q  +L  +S  DS +       QD                  +L++FT+LEE NLSLIQ  QE EE+LDEL    + T+++M ++ ++L + I  +  SI+ EEE   ELE+K ++F   + + + QD  LE L+ KV EVYR CV   +EA + T++MLT +E QL+ L E ++++P  K+E A+KAK++ERR++++EEK   Q+   EE   +A  R +A  KK+ GR+L+ RS PP  + ++       N+++EEM +FFT
Sbjct:   52 RSSNPFHISRDMDYFLLREQEQNQAIAEREQKKILRVHQKMTYA--SKVSAKHTSLRRELQLEDEMEQQLLNAEAKEMNCFRENNDWKLAMTRERKREPETLNDYMEKRRSMFLLQYALAMKRNEIQRLEMLATREENRLERAEKFLEKDASLFDEFLRENDRNSVQAMRMAEKETKIKTEKIVEIRELTAQITSIKSEISKFEDTLKHYKIYKEFLYKLSPKEWLDEQQEKHLAFKRAKESSELTRNNSTAILFGDKGSGSKSKTAFLWKEVPGLKKVTKTGRLVKALSSSIQSLPQVGQLTQLSPHSELDSRLSSTMFPSQDDTDSDGEELALYFTEPQQLLDVFTKLEEENLSLIQNTQEMEETLDELNVTLKNTQIRMDKEVNLLKQWIASMMISISKEEESAAELELKARVFHFGEYQGDQQDTMLESLNHKVLEVYRKCVGMQQEANLGTVQMLTVVERQLDELLENLERVPQVKIEQAEKAKERERRMRLREEKAMMQKQLQEERLQRARARAQAKIKKKRGRKLISRSHPPVIKVKEVREQTLINKDKEEMLFFFT 613          
BLAST of Cilia-and flagella-associated protein 100 vs. UniProt/SwissProt
Match: sp|A8I4E9|CP100_CHLRE (Cilia- and flagella-associated protein 100 OS=Chlamydomonas reinhardtii OX=3055 GN=FAP100 PE=1 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 4.007e-46
Identity = 177/491 (36.05%), Postives = 256/491 (52.14%), Query Frame = 3
Query:  510 ATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGAS-------------------KARREAKRKIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYSSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEF-------------------------LERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT*NLI 1850
             T DR+ EKE ++++I KKRE+FLLQ SL  KR E++KLEE A   E+ L+ +EQ LEEDA  FD FLKEND+   +A+K AE E+K +  KV E+K LNT    ++SE+NKYEEQL++ + YK FLD + P    FE++ A                    K RREA    K   E+    ART  Q+       +  +       L ++    + Q   L D+  D  + ++YF++   +L ++ +LEESNL  IQ  QETEE+L+EL+Q  + T+ +M  +   L  Q++ L+ SI    EK +          L D   E++  F                         L+ L  KV EVY  C  D +A +STL+MLT IE +LE      + M  + V+ A+KA++K+RR   ++EK   Q   HE    +ALER  A   K+ G+ L+ RS PPQ +K   A  D RN EE E+  +   ++I
Sbjct:  104 GTLDRRKEKENMADFIAKKREIFLLQMSLDTKRAEIKKLEERARQREEALKKSEQMLEEDALRFDAFLKENDEKVQEAIKKAEAEAKAKQDKVLEIKRLNTATAALRSELNKYEEQLEDCRRYKEFLDSITPPEW-FEQQAAKLQRRKDALVAEWQSQCEALKQRREAALAAKTAAESDYANARTQQQAERAERAIKESVA-----ALKEIMKEKEPQPPNL-DFEMDPEDEEMYFQEPGQLLAVYKQLEESNLFYIQNAQETEEALEELRQKLRDTKTRMDAEAQGLQGQVSTLQASIVAAREKAKR---------LKDRTLENEGAFTLSMGSSNAPTSSVTGSSGPGGPVNLKELGDKVREVYVRCGFDADASISTLQMLTNIEMKLEEYLNLAEGMTPDYVDGAEKAREKDRRKVARDEKLSTQHREHEARMARALERAAAPVFKKTGKPLMFRSAPPQRKKVVQA--DDRNDEEAELEAYLAQDMI 576          
BLAST of Cilia-and flagella-associated protein 100 vs. UniProt/SwissProt
Match: sp|Q8CDN8|CCD38_MOUSE (Coiled-coil domain-containing protein 38 OS=Mus musculus OX=10090 GN=Ccdc38 PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 2.711e-45
Identity = 168/526 (31.94%), Postives = 293/526 (55.70%), Query Frame = 3
Query:  366 LKVHEKTYGIDSRIKFRQ--AALLKIPDDDESATQDQSLVVKEDPEFVISATK--DRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFE----REGASKARREAKR-------------------KIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYSSDDSEMDL----YFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDRE-AKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEK-KEQQRLHHEENKLKA-LERVRAAPKKQFGRRLVGRSEPPQFQKEDPAL-NDQRNREEEEMAYFFT 1838
            +K+++KT    SR+K R     L    D   S+ +   L    DP  ++  T+  DR   K T+ E+I  +R+ FLL+Y++  K++ +++ E + + +E +L+ AE+ L++DA  F++FL+END+ +VDA+K+A  E+  ++   SE+K  + ++  IKS+I K E  LKEY  Y  FL +L P+  + +    R  +SK+     +                   K+   EE  +R  R +              +K       +   S D  E  LED   +  E DL    YFK+ +++L +FTELEE NL+L+Q  Q+ +E+L+++ + ++  + K+  +   L++    L  +   EEEK  ELE++ +LF+  +  ++ Q++ ++ L +K+++VYR C+ D E   ++ ++ L  +E++L  L + I+ +P E VE  ++ K KERR +++EEK KE+QR  H+E +LKA LER  A PKK+ GRRL+ RS+P    K++  L +D R++ ++E  YFF+
Sbjct:   54 MKIYQKT-TFSSRMKSRSHLGQLAFFADAGSSSYERLGL----DPTLILRLTEGADR---KRTVHEFINDQRDRFLLEYTVSTKKKTIKRFERLIAIKENQLKKAEKKLQDDALSFEEFLRENDQRSVDALKMAAQETINKLQMTSELKKASMEVQSIKSDIAKTEFLLKEYMKYGFFLLKLSPKQWQIQQSQKRAQSSKSNHILPKILEKFSINTAKGDNSIDSDKMSVSEEWSSR--RGSQGGRHGKHTLGQDSRKSSGFTRPESMASEDSLEYFLED---ELVEFDLLPEIYFKEPEELLQVFTELEEQNLTLVQYSQDVDENLEDVNKREKFIQDKINNNISFLLEHKHMLRMNCEREEEKAAELELRSRLFSFGEFNSDAQEKLIDSLSKKINQVYRVCIGDAEVGSLNAVQKLVKVESRLVELSDLIESIPREHVEAIERLKQKERRQKLREEKMKEKQR--HQEERLKAALERAVAQPKKKLGRRLIYRSKPQSADKQELLLVSDTRSKSQDE-EYFFS 563          
BLAST of Cilia-and flagella-associated protein 100 vs. UniProt/SwissProt
Match: sp|Q95JL6|CCD38_MACFA (Coiled-coil domain-containing protein 38 OS=Macaca fascicularis OX=9541 GN=CCDC38 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 5.294e-45
Identity = 152/459 (33.12%), Postives = 266/459 (57.95%), Query Frame = 3
Query:  534 KETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFE----REGASKARRE-------AKRKI-KQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDLI----------LSKVETSADQQELKLEDYSSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREA-KMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKED-PALNDQRNREEEEMAYFFT 1838
            K T+ E+I  +R+ FLL+Y+L  KR  ++K E+  +  E++L+ AE+ L++DA  F++FL+END+ +VDA+K+A  E+  ++   +E+K  + ++  +KSEI K E  LKEY  Y  FL +L P++ + +    R  ASK++         A+  +   ++E I       +  S  +SR+R    KP  ++          L++   S D  E  L+D    D E  LYFK+ +++L +  ELEE NL+L Q  Q+ +E+L+E+ + ++  + K   + + L++Q   L+ +   EEEK  EL+++ +LF+  +  ++ Q+  ++ L +K+ EVY+ C+ D E   ++ ++ L  +E++L  L + I+ +P E VE  ++ K KERR + ++EK  +++ H EE    ALE+  A PKK+ GRRLV  S+PP   K+  P +N+ + + +EE  YFFT
Sbjct:  106 KRTVHEFINDQRDRFLLEYALSTKRNTIKKFEKDIAMRERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKLAAQETINKLQMTAELKKASMEVQAVKSEIAKTEFLLKEYMKYGFFLLQLSPKHWQIQQALKRAQASKSKANIILPKILARLSLHSSKKEGILEEFGGTAILSEDASRERDSQGKPSRILTRTSEKIKSNLTESFGSEDSLEFLLDDEMDFDLEPALYFKEPEELLQVLRELEEQNLTLFQYSQDVDENLEEVNKREKVIQDKTNSNIEFLLEQEEMLKANCVREEEKAAELQLRSRLFSFGEFNSDAQEILIDSLSKKITEVYKVCIGDAEDDGLNPIQKLVKVESRLVELCDLIESIPRENVEAIERMKQKERRQKFRDEKMREKQRHQEERLKAALEKAVAQPKKKLGRRLVYHSKPPSANKQQLPLVNETKTKAQEE-EYFFT 563          
BLAST of Cilia-and flagella-associated protein 100 vs. TrEMBL
Match: A0A2T7NTV6 (DUF4200 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15102 PE=4 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 2.154e-126
Identity = 284/538 (52.79%), Postives = 387/538 (71.93%), Query Frame = 3
Query:  273 NPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEKTYGIDSRIKFRQAALLKI-PDDDESATQ-DQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDLILSK-VETSADQQELKL------EDY--------SSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFF 1835
            NPF+   + DIF LRD+ER+ K +E +RQ  L VHEKT   ++RI +R +A+++  P DDE+  + D ++ VK+DP+F I+ T+DR  EKE+LSEYI KKREMFL+QYSLGVKR+EMRKLEEIA AEE+KLELAEQ+LEEDAAMFD+FLKENDKN+V+A+K+AE E+K +M KV+E+K +N Q+M IKSEI+KYEE LKEY+ Y+ FL+ L P  IR E+E   K  RE K   K E E   ++ ++ S    Q +      KK + +  +K +  SA   + K+      ED         S  D EM+LYF+D Q +L+IF+ELEE NLSLIQ  QETEE+L+E+K   + T+ +M ++T +L  QI KLEK+I  EE+K  +L++K K+F   + K EDQ++ L++L+QKV+EVYR+C+ D EA +STL+MLT IEN+LE LFE I+ MP +KVE A+KAK+KERR++M+EEK E QRLH EE   +ALER +A PKK+ G++LV RSEPPQ +K++    DQ +REEEE+AY+F
Sbjct:   65 NPFRMPPDSDIFVLRDKERQNKRKETQRQHKLHVHEKT-TYNTRINYRNSAMIQPKPSDDEAEQESDNAVAVKDDPQFTIAVTRDRHVEKESLSEYIAKKREMFLVQYSLGVKRDEMRKLEEIAQAEERKLELAEQFLEEDAAMFDEFLKENDKNSVEAIKIAEAEAKLKMEKVNEIKKINVQIMSIKSEISKYEEMLKEYQQYRRFLEALTPPEIRQEKEQQRKMMREIK---KTEREKSNQLKKSPSDLDRQGTGDLKGGKKKLPVPKAKTISGSASSSKTKVAGAHQAEDALSPSTLSDSDSDEEMELYFQDPQQLLDIFSELEEQNLSLIQNSQETEEALEEMKHTMKMTKDRMTKETKILKDQIEKLEKAIKAEEDKAADLKIKAKMFNYGEFKEEDQEKSLQQLNQKVEEVYRSCIGDNEANISTLQMLTNIENRLEELFEIIETMPQDKVEAAEKAKEKERRLKMREEKIELQRLHQEERVKRALERAKAEPKKKTGKKLVFRSEPPQLKKKEDEGADQASREEEELAYYF 598          
BLAST of Cilia-and flagella-associated protein 100 vs. TrEMBL
Match: A0A433TQI2 (DUF4200 domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_008449 PE=4 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 4.303e-122
Identity = 281/571 (49.21%), Postives = 399/571 (69.88%), Query Frame = 3
Query:  204 ENSNRKSTKVSEKNNLK-----------ELQKSKNPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEKT-YGIDSRIKFRQAALLKIPDDDESATQ--DQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQ-----------EEEAIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYSSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKT-EDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            E+++R S +V+  N+ K           ++    NPF+   + DIF LRD+ER+ K +ER RQR+L+VHEKT Y   SR+ FR AA++   + +    +  D+++ VK+DP+F I+ T+DR  EKE+L+EYI KKREMFL+QYSLGVKR+EMRKLEEIA AEEKKLELAEQYLEEDAAMFD+FLKENDKN+V+A+K+AE E+K +M KV+E+K +N Q++ IKSEI+K+E+ LKEY++Y+SFL+ LIP  I+ ER+   + R+E KR  K+            ++AI+  +R     S+    +   +  P  L +          E   +   SD+ E++LYF D+Q +L+IF+ELEE NLSLIQ  QETEE+L+E+K   + T++KM+++T  L  QI KL+  I  EE K  +L++K KLF   + K  +DQ++ L  L++KV++VYRNC+ D EA +STL+MLT IEN+LE LFE I+ MP++KVE A++AK+KERR++M+EEK EQ RLH EE   +ALER +A PKK+ G++LV RSEPPQ +K++    DQ +REEEE+AY+F+
Sbjct:   29 EDASRNSGRVTFPNSAKSGGSATSMLTDDIVPKGNPFQMPPDSDIFLLRDKERQKKKQERIRQRNLRVHEKTTYA--SRVNFRTAAMIHPAESESEEEEESDKAVAVKDDPQFTIAVTRDRHVEKESLAEYIAKKREMFLVQYSLGVKRDEMRKLEEIAQAEEKKLELAEQYLEEDAAMFDEFLKENDKNSVEAIKIAEQEAKLKMEKVNEIKKINAQMVGIKSEISKHEDTLKEYQLYRSFLESLIPVEIQEERKKEKQKRKEEKRLDKEMSGRMSGSTVSSDKAISSASR-EKSPSNAKKLRGKSMGSPSALKIKGAGEDGKALETSADADDSDE-ELELYFTDYQQLLDIFSELEEQNLSLIQNSQETEEALEEMKHNIKQTKIKMEKETKTLKDQIDKLQAQIHKEEAKAADLKIKAKLFNYGEFKADDDQEQHLAELNKKVEDVYRNCIGDNEANISTLQMLTNIENRLEELFETIETMPADKVEAAERAKEKERRLKMREEKMEQLRLHQEERVRRALERAQAEPKKKTGKKLVFRSEPPQLKKKEDEGADQASREEEELAYYFS 595          
BLAST of Cilia-and flagella-associated protein 100 vs. TrEMBL
Match: A7RX27 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g182914 PE=4 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 4.585e-122
Identity = 277/538 (51.49%), Postives = 376/538 (69.89%), Query Frame = 3
Query:  273 NPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEK-TYGIDSRIKFRQAALLKIPD-------DDESATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEAIARIART---NXXXXXXXXXXXXXXXKPIDLILSKVETS-ADQQELKLEDYSSD----DSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            NPF    + DIF LRD+ER++K +ER +QR+LKVHEK TY   SR+  + AA+ +I +       D+E   +D ++ VK+DP F ++ T+DR  EKE L+++I KKREMFL+QYSLGVKR+EMRKLEEIA AEEKKLELAEQYLEEDAAMFD+FLKENDKN+V+ +KVAE E+K ++ KV+E+K +N  +M IKSEI+K E+ LKEY +YK FLD L P+  R   E   KAR E KR+ KQ+E+A A   R    N+      +        P     SK + S AD + L    Y +D    D E +L+F D Q +L+IF ELEE NLSLIQ  QETEE+L+E+KQ  + T+ +M  +T++L  QI  L  +I  E+E+  ELEMK K+F+  + K EDQ++ L  L++KV+EVYRNC+ D EA +STL+MLT IEN+LE LFE I+ MP E+VE+A+KAK+KERR++ +EEK EQQRLH E+   +ALER +A PK++ G+ L+ RSEPPQ +K+    + ++++EEEE+ YFFT
Sbjct:   56 NPFTIPSDNDIFTLRDKERQWKQQERVKQRNLKVHEKSTYT--SRVNAKTAAMRRIGEASDDEDIDEEKKDKDGAIAVKDDPGFTLAITRDRHVEKENLADFIAKKREMFLVQYSLGVKRDEMRKLEEIAQAEEKKLELAEQYLEEDAAMFDEFLKENDKNSVETIKVAEAETKLKLEKVAEIKKINGHMMAIKSEISKNEDLLKEYLLYKQFLDSLTPQEWR---ESKRKAREE-KRQAKQKEKASAPKKRGTFKNNFDIIGLNACEDYSGSPSQG--SKRQKSDADGESLASSTYDTDEEFSDEEPELFFGDPQQLLDIFAELEEQNLSLIQNSQETEEALEEMKQTIKQTQDRMNHETEILKGQIDFLNDAIKREQERAAELEMKSKMFSYGEFKAEDQEKMLAALNKKVEEVYRNCIGDNEANISTLQMLTNIENRLEELFEQIEIMPPERVEMAEKAKEKERRLRQREEKMEQQRLHQEDRVRRALERAQAEPKRKTGKPLMFRSEPPQTRKKQQDADKKQDKEEEELKYFFT 585          
BLAST of Cilia-and flagella-associated protein 100 vs. TrEMBL
Match: A0A210PDY3 (Coiled-coil domain-containing protein 37 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11443 PE=4 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 1.843e-120
Identity = 272/528 (51.52%), Postives = 379/528 (71.78%), Query Frame = 3
Query:  273 NPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEKTYGIDSRIKFRQAALLKIPDDDE---SATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEE-EAIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELK---LEDYSSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFF 1835
            NPFK   + DIF LRD+ER+ K +ER RQR L VHEKT    S++ FR A++++  D DE       D+++ VK+DP++ I  T+DR  EKE+L+EYI KKREMFL+QYSLGVKR+EM+KLEE+A  EEKKLELAEQYLEEDAAMFD+FLKEND N+ +A++ AENE+K ++ KV+EVK +NTQ+M IKSEI+KYE+ LKEY++Y+ FLD L P+  R  R+     +R+ +RK KQ E E   ++ + +  +  ++ +K       +  I S  +   DQ+ +     +     D ++DL+F D   +L+IF ELEE NLSLIQ  QETEE+L+E+K   + T+LKM+++T +L  QI KL   I  EE + E+L++K K+F+  + K EDQ++ L+ L++KV+EVYR+C+ D EA +STL+MLT IEN+LE LFE I+ MP +KVE A+KAK+KERR++++EEK EQQR+H EE   KALER +A PKKQ GR+LV RSEPP+ +K++   +DQ +REEEE+AYFF
Sbjct:   58 NPFKMAPDSDIFVLRDKERQRKKQERLRQRGLHVHEKT-TYSSKVNFRTASMIRPADSDEEKEGEDGDKTVSVKDDPQYTIRVTRDRHVEKESLAEYIAKKREMFLVQYSLGVKRDEMKKLEEMAQKEEKKLELAEQYLEEDAAMFDEFLKENDANSAEAVREAENETKAKLEKVAEVKKINTQMMTIKSEISKYEDTLKEYQLYRKFLDSLTPQETREVRD----LKRQKRRKEKQREFEKNMQVMKKSGAALDKTKKKLPPKSDTVSKIGSATK-KPDQESVMSAMFDSDDDSDEDLDLFFSDPHQLLDIFAELEEQNLSLIQNSQETEEALEEMKHNIKLTKLKMEKETQILKDQIDKLNTQIYKEEARAEDLKIKAKMFSYGEFKAEDQEKMLQALNKKVEEVYRSCIGDNEANISTLQMLTNIENRLEELFEQIETMPQDKVEAAEKAKEKERRLKLREEKIEQQRIHQEERVRKALERAKAEPKKQTGRKLVFRSEPPRHKKKEDERDDQASREEEELAYFF 579          
BLAST of Cilia-and flagella-associated protein 100 vs. TrEMBL
Match: A0A2G8JMN4 (Putative coiled-coil domain-containing protein OS=Stichopus japonicus OX=307972 GN=BSL78_26142 PE=4 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 1.022e-114
Identity = 287/580 (49.48%), Postives = 387/580 (66.72%), Query Frame = 3
Query:  162 KLDSCSQSAKSTVSENSNRKSTKVSEKNNLKELQKSK---NPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEK-TYGIDSRIKFRQAAL---LKIPDDD---ESATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDL-----------ILSKVETSADQQELKLEDYSSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            K +   QS K T   ++   ST  +    L E ++S    NPF    + DIF LRD+ER+ K  ER +QR L+VHEK TY   SR+   +AAL   L+  DDD   E    D++L VK+DP F ++ T+DR  EKE+L++YI KKREMFL+QYSLGVKR+EMRKLEEIA AEEKKLELAE YLEEDAAMFD+FLKENDKN+V+A+K+AE E+K ++ KV+++K +N Q+M IKSEI+K E+ LKEY++YK FLD L P   + E+    +A R   RK     + I   A +   SS          +KP  +           +  K E SA++      DY SD+  + L+F + Q +L+IF ELEE NLSLIQ  QETEE+L+E+KQ  Q T  KM R+T++L +QI  L  +I  EEEK ++LE K K+F+  + K EDQ+  L+ L+ KV+EVY+NC+ D EA +STL+MLT IE++LE LFE+I+ MP EKVE A+KAK+KERR++++EEK E QR+H EE   +ALER +A PKK+ GR+LV RSEPPQ +K+      + N+EEEEMA+FF+
Sbjct:   21 KSNQSRQSGKVTFPHSAKTSSTSTA----LVEFEESSPNHNPFTVPADNDIFMLRDKERQRKKAERIKQRDLRVHEKSTYT--SRVNAMRAALRKPLQEIDDDVDMEEEMDDKTLAVKDDPTFTLAVTRDRHVEKESLTDYIAKKREMFLVQYSLGVKRDEMRKLEEIAQAEEKKLELAELYLEEDAAMFDEFLKENDKNSVEAIKIAEAETKAKLEKVADIKKINAQIMHIKSEISKNEDLLKEYQLYKKFLDSLTPPEWKEEQ----RAERNKNRKQNTNGQRIPS-ATSKKGSSRSRGTLSKASQKPSQVRLKVGSDGKRSVAGKDEESAEKVSETDSDYDSDEEPV-LFFTEPQQLLDIFQELEEQNLSLIQNSQETEEALEEVKQNIQITNEKMDRETNILKQQINILTAAIDREEEKAKDLEHKSKMFSFGEFKAEDQEAMLDMLNAKVEEVYKNCIGDNEANISTLQMLTNIESKLEELFESIETMPPEKVEAAEKAKEKERRMRLREEKLEAQRIHQEERVKRALERAQADPKKKTGRKLVYRSEPPQTKKKVDKSKQRANKEEEEMAFFFS 588          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Cavefish
Match: cfap100 (cilia and flagella associated protein 100 [Source:NCBI gene;Acc:103023090])

HSP 1 Score: 233.802 bits (595), Expect = 1.806e-68
Identity = 212/558 (37.99%), Postives = 334/558 (59.86%), Query Frame = 3
Query:  243 NNLKELQKSKNPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEK-TYGIDSRIKFRQAALLK-----IPDDDESATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAK-------------RKIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPI--DLILSKVETSADQQELKLEDYSSDDS-----EMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
             NL E++   NPFK  ++ +IF LR+ E+  + +E  ++  L V EK TY    R++ +Q  L K     + D++E  +   S +++  P   +   KDR  EKE++ E+I+KKREMF LQ++L VKREE+ KLEE+A+ EEKKL  AE+ L++DA +FD FLKENDKN V+A+K+AE E+K ++ K++E+K LN +++ IKS+I+KYE+ L+EYK+YK FL  L P  + ++ +   K RR  K             R+++  E    +      +     S   S    P+      S+    +  Q  K+   S  DS     E +LYF + Q +L++ +ELEE NLSLIQ  QETEE L E +   + T   M+ +   L +QI  + ++I  E+E+  ELE+K +LF   +  T D+D+ L  L +KV+ VYR+C+   E  +STL+MLT IE +L  L E ++ +P++++ +A+KAK++ERR+++++EK   Q+   EE   KA+ER +A  K+  G++L+ RS PP  + +D   +D  ++E+EE  YFFT
Sbjct:   11 GNLDEIKSEPNPFKMPEDNNIFLLRNAEKTPRKQEYRKELSLPVQEKMTY--TGRMRAKQTELRKKLRDGLEDEEEGKSSSASQLIQYPPACKVIMIKDRNIEKESVREFISKKREMFYLQHALVVKREEIEKLEEVATHEEKKLVRAERMLKDDAMLFDSFLKENDKNTVEAIKIAEQETKAKLEKMAEIKRLNAKMVAIKSDISKYEDTLQEYKLYKGFLFELSP--LEWQEKQREKNRRSPKPSSTPPTTTDKREREVRSRETERGKKTPQTDRRRENRSSVGSRELPPLREGRAPSRYSMKSTPQSGKISPASETDSSEYEEEPELYFTEPQQLLDLLSELEEQNLSLIQNAQETEEGLVEFRNTVEQTRKNMEHEALQLKQQIDIMTETIQKEKERTAELELKVRLFNFGNENT-DEDDTLNALSRKVEAVYRSCIGSTEDSLSTLQMLTTIEGRLGELLEKVEMIPADRLAIAEKAKERERRLRLRDEKIYLQKQQQEERMKKAMERAQAQIKRTSGKKLMPRSLPPVRKLKDDQHDDVTDKEKEEHLYFFT 563          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Cavefish
Match: cfap100 (cilia and flagella associated protein 100 [Source:NCBI gene;Acc:103023090])

HSP 1 Score: 221.476 bits (563), Expect = 3.624e-64
Identity = 199/517 (38.49%), Postives = 310/517 (59.96%), Query Frame = 3
Query:  366 LKVHEK-TYGIDSRIKFRQAALLK-----IPDDDESATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAK-------------RKIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPI--DLILSKVETSADQQELKLEDYSSDDS-----EMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            L V EK TY    R++ +Q  L K     + D++E  +   S +++  P   +   KDR  EKE++ E+I+KKREMF LQ++L VKREE+ KLEE+A+ EEKKL  AE+ L++DA +FD FLKENDKN V+A+K+AE E+K ++ K++E+K LN +++ IKS+I+KYE+ L+EYK+YK FL  L P  + ++ +   K RR  K             R+++  E    +      +     S   S    P+      S+    +  Q  K+   S  DS     E +LYF + Q +L++ +ELEE NLSLIQ  QETEE L E +   + T   M+ +   L +QI  + ++I  E+E+  ELE+K +LF   +  T D+D+ L  L +KV+ VYR+C+   E  +STL+MLT IE +L  L E ++ +P++++ +A+KAK++ERR+++++EK   Q+   EE   KA+ER +A  K+  G++L+ RS PP  + +D   +D  ++E+EE  YFFT
Sbjct:   28 LPVQEKMTYT--GRMRAKQTELRKKLRDGLEDEEEGKSSSASQLIQYPPACKVIMIKDRNIEKESVREFISKKREMFYLQHALVVKREEIEKLEEVATHEEKKLVRAERMLKDDAMLFDSFLKENDKNTVEAIKIAEQETKAKLEKMAEIKRLNAKMVAIKSDISKYEDTLQEYKLYKGFLFELSP--LEWQEKQREKNRRSPKPSSTPPTTTDKREREVRSRETERGKKTPQTDRRRENRSSVGSRELPPLREGRAPSRYSMKSTPQSGKISPASETDSSEYEEEPELYFTEPQQLLDLLSELEEQNLSLIQNAQETEEGLVEFRNTVEQTRKNMEHEALQLKQQIDIMTETIQKEKERTAELELKVRLFNFGNENT-DEDDTLNALSRKVEAVYRSCIGSTEDSLSTLQMLTTIEGRLGELLEKVEMIPADRLAIAEKAKERERRLRLRDEKIYLQKQQQEERMKKAMERAQAQIKRTSGKKLMPRSLPPVRKLKDDQHDDVTDKEKEEHLYFFT 539          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Cavefish
Match: cfap100 (cilia and flagella associated protein 100 [Source:NCBI gene;Acc:103023090])

HSP 1 Score: 219.935 bits (559), Expect = 7.041e-64
Identity = 193/505 (38.22%), Postives = 304/505 (60.20%), Query Frame = 3
Query:  399 SRIKFRQAALLK-----IPDDDESATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAK-------------RKIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPI--DLILSKVETSADQQELKLEDYSSDDS-----EMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
             R++ +Q  L K     + D++E  +   S +++  P   +   KDR  EKE++ E+I+KKREMF LQ++L VKREE+ KLEE+A+ EEKKL  AE+ L++DA +FD FLKENDKN V+A+K+AE E+K ++ K++E+K LN +++ IKS+I+KYE+ L+EYK+YK FL  L P  + ++ +   K RR  K             R+++  E    +      +     S   S    P+      S+    +  Q  K+   S  DS     E +LYF + Q +L++ +ELEE NLSLIQ  QETEE L E +   + T   M+ +   L +QI  + ++I  E+E+  ELE+K +LF   +  T D+D+ L  L +KV+ VYR+C+   E  +STL+MLT IE +L  L E ++ +P++++ +A+KAK++ERR+++++EK   Q+   EE   KA+ER +A  K+  G++L+ RS PP  + +D   +D  ++E+EE  YFFT
Sbjct:    5 GRMRAKQTELRKKLRDGLEDEEEGKSSSASQLIQYPPACKVIMIKDRNIEKESVREFISKKREMFYLQHALVVKREEIEKLEEVATHEEKKLVRAERMLKDDAMLFDSFLKENDKNTVEAIKIAEQETKAKLEKMAEIKRLNAKMVAIKSDISKYEDTLQEYKLYKGFLFELSP--LEWQEKQREKNRRSPKPSSTPPTTTDKREREVRSRETERGKKTPQTDRRRENRSSVGSRELPPLREGRAPSRYSMKSTPQSGKISPASETDSSEYEEEPELYFTEPQQLLDLLSELEEQNLSLIQNAQETEEGLVEFRNTVEQTRKNMEHEALQLKQQIDIMTETIQKEKERTAELELKVRLFNFGNENT-DEDDTLNALSRKVEAVYRSCIGSTEDSLSTLQMLTTIEGRLGELLEKVEMIPADRLAIAEKAKERERRLRLRDEKIYLQKQQQEERMKKAMERAQAQIKRTSGKKLMPRSLPPVRKLKDDQHDDVTDKEKEEHLYFFT 506          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006074.1 (pep scaffold:Pmarinus_7.0:GL479902:1411:13917:-1 gene:ENSPMAG00000005483.1 transcript:ENSPMAT00000006074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.844 bits (403), Expect = 1.209e-43
Identity = 119/301 (39.53%), Postives = 173/301 (57.48%), Query Frame = 3
Query:  480 VKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKV--AENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQ--EEEAIARIARTNX----------XXXXXXXXXXXXXXKPIDLILSKVE----------------------TSADQQELKLEDYSSDDS--EMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQ 1268
            + +DP + ++ T+DRQ EKE LSE++++KREMFL+QY L VKREEMR LE+  + EE+ LE AE++LE+DAAMFD+FLK+ND++AV+A++V  AE E K RM +V+E+K L  Q++  KSEI + E+ L+EY++YK FL+ L P           + RRE K  I+   E+   A++A TNS          +    +        K  D  +   E                      +  D         +SDDS  E +L     Q++L++FTELEE NLSLIQ  Q+ E+SL+E +Q
Sbjct:   90 LGKDPAWTLALTRDRQVEKEGLSEFVSRKREMFLVQYGLSVKREEMRALEQQGAREERALEQAERFLEDDAAMFDEFLKQNDRSAVEAIRVLAAEMEMKARMEQVAEIKKLTAQIVSAKSEIARQEDLLQEYRLYKRFLEGLAPPEWH-------QRRRERKIYIQNVCEDNGTAKVALTNSIPGQPRQQTKKGGMGNKNAEEWSGKGQDQAMGSNEDKLGRGKARKTRRQRGYVEPENSKGDGGSSNASQDNSDDSEGEFELPLSSPQELLDLFTELEEQNLSLIQNSQDMEQSLEEARQ 383          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006080.1 (pep scaffold:Pmarinus_7.0:GL479902:1438:6227:-1 gene:ENSPMAG00000005483.1 transcript:ENSPMAT00000006080.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.124 bits (357), Expect = 1.315e-38
Identity = 111/270 (41.11%), Postives = 162/270 (60.00%), Query Frame = 3
Query:  519 DRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKV--AENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPEN---------------IRFEREGAS---KARREAKRKIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYSSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQ 1268
            DRQ EKE LSE++++KREMFL+QY L VKREEMR LE+  + EE+ LE AE++LE+DAAMFD+FLK+ND++AV+A++V  AE E K RM +V+E+K L  Q++  KSEI + E+ L+EY++YK FL+ L P                 ++F +   S   K  R   RK K  E +      +N+   +    +      P  L  S    S  +   +L+  S+  + M    +  Q++L++FTELEE NLSLIQ  Q+ E+SL+E +Q
Sbjct:    1 DRQVEKEGLSEFVSRKREMFLVQYGLSVKREEMRALEQQGAREERALEQAERFLEDDAAMFDEFLKQNDRSAVEAIRVLAAEMEMKARMEQVAEIKKLTAQIVSAKSEIARQEDLLQEYRLYKRFLEGLAPPEWHQRRPSKYNHISICLQFSQAMGSNEDKLGRGKARKTK-PENSKGDGGSSNASQDNSDDSEGVSEASP-SLAKSMSSNSVLENRHELDCSSAGRAIM----RSPQELLDLFTELEEQNLSLIQNSQDMEQSLEEARQ 264          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006069.1 (pep scaffold:Pmarinus_7.0:GL479902:1411:13917:-1 gene:ENSPMAG00000005483.1 transcript:ENSPMAT00000006069.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.117 bits (344), Expect = 1.602e-35
Identity = 78/144 (54.17%), Postives = 113/144 (78.47%), Query Frame = 3
Query:  480 VKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKV--AENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIP 905
            + +DP + ++ T+DRQ EKE LSE++++KREMFL+QY L VKREEMR LE+  + EE+ LE AE++LE+DAAMFD+FLK+ND++AV+A++V  AE E K RM +V+E+K L  Q++  KSEI + E+ L+EY++YK FL+ L P
Sbjct:   90 LGKDPAWTLALTRDRQVEKEGLSEFVSRKREMFLVQYGLSVKREEMRALEQQGAREERALEQAERFLEDDAAMFDEFLKQNDRSAVEAIRVLAAEMEMKARMEQVAEIKKLTAQIVSAKSEIARQEDLLQEYRLYKRFLEGLAP 233          

HSP 2 Score: 50.447 bits (119), Expect = 6.564e-7
Identity = 26/49 (53.06%), Postives = 36/49 (73.47%), Query Frame = 3
Query: 1128 SSDDSE--MDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQ 1268
            +SDDSE   +L     Q++L++FTELEE NLSLIQ  Q+ E+SL+E +Q
Sbjct:  338 NSDDSEGEFELPLSSPQELLDLFTELEEQNLSLIQNSQDMEQSLEEARQ 386          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Nematostella
Match: EDO43894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX27])

HSP 1 Score: 383.645 bits (984), Expect = 6.341e-126
Identity = 277/538 (51.49%), Postives = 376/538 (69.89%), Query Frame = 3
Query:  273 NPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEK-TYGIDSRIKFRQAALLKIPD-------DDESATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEAIARIART---NXXXXXXXXXXXXXXXKPIDLILSKVETS-ADQQELKLEDYSSD----DSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            NPF    + DIF LRD+ER++K +ER +QR+LKVHEK TY   SR+  + AA+ +I +       D+E   +D ++ VK+DP F ++ T+DR  EKE L+++I KKREMFL+QYSLGVKR+EMRKLEEIA AEEKKLELAEQYLEEDAAMFD+FLKENDKN+V+ +KVAE E+K ++ KV+E+K +N  +M IKSEI+K E+ LKEY +YK FLD L P+  R   E   KAR E KR+ KQ+E+A A   R    N+      +        P     SK + S AD + L    Y +D    D E +L+F D Q +L+IF ELEE NLSLIQ  QETEE+L+E+KQ  + T+ +M  +T++L  QI  L  +I  E+E+  ELEMK K+F+  + K EDQ++ L  L++KV+EVYRNC+ D EA +STL+MLT IEN+LE LFE I+ MP E+VE+A+KAK+KERR++ +EEK EQQRLH E+   +ALER +A PK++ G+ L+ RSEPPQ +K+    + ++++EEEE+ YFFT
Sbjct:   56 NPFTIPSDNDIFTLRDKERQWKQQERVKQRNLKVHEKSTYT--SRVNAKTAAMRRIGEASDDEDIDEEKKDKDGAIAVKDDPGFTLAITRDRHVEKENLADFIAKKREMFLVQYSLGVKRDEMRKLEEIAQAEEKKLELAEQYLEEDAAMFDEFLKENDKNSVETIKVAEAETKLKLEKVAEIKKINGHMMAIKSEISKNEDLLKEYLLYKQFLDSLTPQEWR---ESKRKAREE-KRQAKQKEKASAPKKRGTFKNNFDIIGLNACEDYSGSPSQG--SKRQKSDADGESLASSTYDTDEEFSDEEPELFFGDPQQLLDIFAELEEQNLSLIQNSQETEEALEEMKQTIKQTQDRMNHETEILKGQIDFLNDAIKREQERAAELEMKSKMFSYGEFKAEDQEKMLAALNKKVEEVYRNCIGDNEANISTLQMLTNIENRLEELFEQIEIMPPERVEMAEKAKEKERRLRQREEKMEQQRLHQEDRVRRALERAQAEPKRKTGKPLMFRSEPPQTRKKQQDADKKQDKEEEELKYFFT 585          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Medaka
Match: ENSORLT00000035195.1 (cilia and flagella associated protein 100 [Source:NCBI gene;Acc:101158036])

HSP 1 Score: 138.658 bits (348), Expect = 1.501e-34
Identity = 132/415 (31.81%), Postives = 222/415 (53.49%), Query Frame = 3
Query:  549 EYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQ---ELKLEDYSSDDS-----EMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEP-PQ 1766
            E+++ +R+  +L+ SL  KR E+ K++     EEK+L   E+ +E     F++FLKEN++ +V+A  + E E K +  K +E+K L  ++  IK EI  +EE L +YK YK FL RL P   + E++  +   +E   K  +E + +                        +   L +  + +D++      L D S+ DS     + +LYF D Q +L++  EL E NLSLIQ     EE L+EL+   +AT  ++  D   +  QI ++++ +  E  +  +L+ K +L   + + TE++D  L+ L +KV +V+R+CV DR   +ST E +  IEN +  L E ++ +P E +E  +K K+ E+R + +EEK  +Q+   EE   + LER  +  KK+ GR+L+ R  P PQ
Sbjct:  111 EFLSMERQKAVLELSLIAKRSEILKMDRTVVKEEKQLRELEKNIERQNQRFEEFLKENERKSVEARTLFEQEDKSKQEKNAEIKKLTAEIGIIKREIFGFEETLMDYKRYKEFLHRLSPPEWQEEQKLKALKAKEPSDKDGEENQEVT-----------------------LQNDLERKASGSDREASSSAHLSDPSTKDSSDYEDDPELYFTDPQQLLDLMAELTEQNLSLIQDSVRVEEKLEELQHSIEATRREIDEDERQIKVQIDEVKQRMDRERARAAKLQQKVQLH--TSLSTEERDAMLDALSEKVAKVHRSCVDDRMTNLSTFEKVANIENCMLSLLEGLESIPGETLESMRKIKESEKRTRQREEKLREQKEKQEERMKRYLERSFSDSKKKSGRKLMPRCMPVPQ 500          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Medaka
Match: ENSORLT00000038744.1 (cilia and flagella associated protein 100 [Source:NCBI gene;Acc:101158036])

HSP 1 Score: 138.658 bits (348), Expect = 1.838e-34
Identity = 132/415 (31.81%), Postives = 222/415 (53.49%), Query Frame = 3
Query:  549 EYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQ---ELKLEDYSSDDS-----EMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEP-PQ 1766
            E+++ +R+  +L+ SL  KR E+ K++     EEK+L   E+ +E     F++FLKEN++ +V+A  + E E K +  K +E+K L  ++  IK EI  +EE L +YK YK FL RL P   + E++  +   +E   K  +E + +                        +   L +  + +D++      L D S+ DS     + +LYF D Q +L++  EL E NLSLIQ     EE L+EL+   +AT  ++  D   +  QI ++++ +  E  +  +L+ K +L   + + TE++D  L+ L +KV +V+R+CV DR   +ST E +  IEN +  L E ++ +P E +E  +K K+ E+R + +EEK  +Q+   EE   + LER  +  KK+ GR+L+ R  P PQ
Sbjct:  134 EFLSMERQKAVLELSLIAKRSEILKMDRTVVKEEKQLRELEKNIERQNQRFEEFLKENERKSVEARTLFEQEDKSKQEKNAEIKKLTAEIGIIKREIFGFEETLMDYKRYKEFLHRLSPPEWQEEQKLKALKAKEPSDKDGEENQEVT-----------------------LQNDLERKASGSDREASSSAHLSDPSTKDSSDYEDDPELYFTDPQQLLDLMAELTEQNLSLIQDSVRVEEKLEELQHSIEATRREIDEDERQIKVQIDEVKQRMDRERARAAKLQQKVQLH--TSLSTEERDAMLDALSEKVAKVHRSCVDDRMTNLSTFEKVANIENCMLSLLEGLESIPGETLESMRKIKESEKRTRQREEKLREQKEKQEERMKRYLERSFSDSKKKSGRKLMPRCMPVPQ 523          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Medaka
Match: ENSORLT00000011808.2 (cilia and flagella associated protein 100 [Source:NCBI gene;Acc:101158036])

HSP 1 Score: 136.346 bits (342), Expect = 4.674e-34
Identity = 119/361 (32.96%), Postives = 188/361 (52.08%), Query Frame = 3
Query:  699 FDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYS----SDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEP-PQ 1766
            F++FLKEN++ +V+A  + E E K +  K +E+K L  ++  IK EI  +EE L +YK YK FL RL P                      QEE+ +  +                  K+P D      +   + QE+ L++      SDD E  LYF D Q +L++  EL E NLSLIQ     EE L+EL+   +AT  ++  D   +  QI ++++ +  E  +  +L+ K +L   + + TE++D  L+ L +KV +V+R+CV DR   +ST E +  IEN +  L E ++ +P E +E  +K K+ E+R + +EEK  +Q+   EE   + LER  +  KK+ GR+L+ R  P PQ
Sbjct:  121 FEEFLKENERKSVEARTLFEQEDKSKQEKNAEIKKLTAEIGIIKREIFGFEETLMDYKRYKEFLHRLSPPEW-------------------QEEQKLKAL----------------KAKEPSD------KDGEENQEVTLQNGKFGKESDDPE--LYFTDPQQLLDLMAELTEQNLSLIQDSVRVEEKLEELQHSIEATRREIDEDERQIKVQIDEVKQRMDRERARAAKLQQKVQLH--TSLSTEERDAMLDALSEKVAKVHRSCVDDRMTNLSTFEKVANIENCMLSLLEGLESIPGETLESMRKIKESEKRTRQREEKLREQKEKQEERMKRYLERSFSDSKKKSGRKLMPRCMPVPQ 436          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Medaka
Match: ENSORLT00000033867.1 (coiled-coil domain-containing protein 38 [Source:NCBI gene;Acc:110016384])

HSP 1 Score: 63.5438 bits (153), Expect = 3.204e-10
Identity = 42/115 (36.52%), Postives = 65/115 (56.52%), Query Frame = 3
Query: 1419 TEDQDEFLERLHQKVDEVYRNCVSDREAKM-STLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEP 1760
            T DQD  LE L +KV EV+ +C +D E    STLE L  IEN + +L E ++++P ++++     K+ E+R + +EEK  Q+    EE   +  E     PK+  GR+L+ R  P
Sbjct:  290 TVDQDVLLETLRKKVSEVH-SCFADEELTTNSTLEKLAFIENHMTMLLEKLEKIPKDEIKTLWHIKENEKRSRWREEKLRQETEKREEKIRRRAELAMTEPKRITGRKLMPRHMP 403          
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Medaka
Match: ENSORLT00000038701.1 (coiled-coil domain-containing protein 38 [Source:NCBI gene;Acc:110016384])

HSP 1 Score: 53.5286 bits (127), Expect = 4.444e-7
Identity = 37/103 (35.92%), Postives = 58/103 (56.31%), Query Frame = 3
Query: 1419 TEDQDEFLERLHQKVDEVYRNCVSDREAKM-STLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKK 1724
            T DQD  LE L +KV EV+ +C +D E    STLE L  IEN + +L E ++++P ++++     K+ E+R + +EEK  Q+    EE   +  E     PK+
Sbjct:  290 TVDQDVLLETLRKKVSEVH-SCFADEELTTNSTLEKLAFIENHMTMLLEKLEKIPKDEIKTLWHIKENEKRSRWREEKLRQETEKREEKIRRRAELAMTEPKR 391          
BLAST of Cilia-and flagella-associated protein 100 vs. Planmine SMEST
Match: SMESG000033127.1 (SMESG000033127.1)

HSP 1 Score: 971.844 bits (2511), Expect = 0.000e+0
Identity = 573/579 (98.96%), Postives = 576/579 (99.48%), Query Frame = 3
Query:  102 MEKDRRELSLTINQEDEISEKLDSCSQSAKSTVSENSNRKSTKVSEKNNLKELQKSKNPFKFRDNVDIFAXXXXXXXXXXXXXXXXXHLKVHEKTYGIDSRIKFRQAALLKIPDDDESATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRXXXXXXXXXXXXXXXXXXXXXXDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEAIARIARTNXXXXXXXXXXXXXXXKPIDLILSKVETSADQQELKLEDYSSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            MEKDRREL+LTI QEDEISEKLDSCSQSAKSTVSENSNRKSTKVSEKNNLKELQKSKNPFKFRD+VDIFALRDEERKFKLEERERQRHLKVHEKTYGIDSRIKFRQAALLKIPDDDESATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRKLEEIA AEEKKLELAEQYLEEDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEAIARIARTNSQSSSQSSRKRSIIKKPIDLILSKVET+ADQQELKLEDYSSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITKLEKSIALEEEKIEELEMKKKLFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQ QKEDPALNDQRNREEEEMAYFFT
Sbjct:    1 MEKDRRELALTIKQEDEISEKLDSCSQSAKSTVSENSNRKSTKVSEKNNLKELQKSKNPFKFRDDVDIFALRDEERKFKLEERERQRHLKVHEKTYGIDSRIKFRQAALLKIPDDDESATQDQSLVVKEDPEFVISATKDRQAEKETLSEYITKKREMFLLQYSLGVKREEMRKLEEIALAEEKKLELAEQYLEEDAAMFDDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYEEQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEAIARIARTNSQSSSQSSRKRSIIKKPIDLILSKVETTADQQELKLEDYSSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITKLEKSIALEEEKIEELEMKKKLFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQLQKEDPALNDQRNREEEEMAYFFT 579          
BLAST of Cilia-and flagella-associated protein 100 vs. Planmine SMEST
Match: SMESG000023075.1 (SMESG000023075.1)

HSP 1 Score: 78.1814 bits (191), Expect = 8.553e-15
Identity = 69/250 (27.60%), Postives = 125/250 (50.00%), Query Frame = 3
Query: 1131 SDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXXXXXXXXXXXXXXXXXXX-------------XXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREA-KMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            +D +  DLYF + QD++N+ +ELE +NLSLI+  QE EE  D++KQ  +  +  M      + K I+     I   E+ I  ++               KKLF L D+K    DE ++ LH+++  +Y +     ++ K +T+EML  +E  ++ L+  +       V  A+K  D+ +R   +  +K+  +  H+    KA+      P+ ++GR+++ RSEP +       ++    R ++E A+FF 
Sbjct:  415 NDLNSNDLYFNEPQDLVNVLSELEANNLSLIENVQEQEEMCDQMKQRIENIKKDMNHQISTINKLISAERSKINHLEDSIYCIKETEEFLETFNDLERYKKLFFLDDLKLTTPDEVMDYLHEQISVLYHSVFEKVDSTKSNTIEMLKNLEILIDSLYVELQSHDRSVVLKAKKLVDERKREAARLRQKQHCQDAHQLKIQKAMANALMPPRYRYGRKVIFRSEPFKHVLRVAKIDSGIIRNQQEQAFFFN 664          
BLAST of Cilia-and flagella-associated protein 100 vs. Planmine SMEST
Match: SMESG000023182.1 (SMESG000023182.1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.284e-12
Identity = 79/296 (26.69%), Postives = 145/296 (48.99%), Query Frame = 3
Query: 1068 LILS---KVETSADQQELKLEDYSS-----------------DDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELK----QIKQATELKM--------KRDTDV--LMKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREA-KMSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERR----IQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            LILS    V   +D +EL + +YSS                 D +E +L+ +  QD++++ + LE +NLSLI+  QE EE  + L+    +IKQ  E +         K +T +  L+  I  +++         E  + +K  F   +++    D+ ++ LH+K+  +Y +     ++ K +T+EML  IE+ +  L+  +       ++ +++  D+ +R    I+ ++  KE + L  E    KA+ + R  P+ +FGR++V RS PP+       ++    REEEE  +FFT
Sbjct:  355 LILSGFANVNNYSDVEELIVPEYSSFQQFESVESIEKVFDENDLNETNLFLESPQDLVDLLSHLESNNLSLIENVQEQEEMCEHLRGKIRKIKQDMESQNFIINGHVKKEETKLGDLLDNIACIDEIDRFILNFDELEKYRKI-FNFGNLEFTTIDQMIDYLHEKISNLYHSVFEKVDSTKSNTVEMLRRIESLINSLYIELQSYDRSTIQKSKRLVDERKREAARIRQRQLSKEAEALKIE----KAMIKARMPPRYKFGRKVVYRSNPPKPICHVKEIDWDAVREEEEHLFFFT 645          
BLAST of Cilia-and flagella-associated protein 100 vs. Planmine SMEST
Match: SMESG000070000.1 (SMESG000070000.1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.948e-9
Identity = 65/244 (26.64%), Postives = 115/244 (47.13%), Query Frame = 3
Query: 1152 LYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKRDTDVLMKQITXX-------------XXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAK-MSTLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKDKERRIQMKEEKKEQQRLHHEENKLK-ALERVRAAPKKQFGRRLVGRSEPPQFQKEDPALNDQRNREEEEMAYFFT 1838
            +YF D  +++N+ +ELE +NL LI+  QE EE  + L +     + K+++  + +   I                 ++I +   K   +   K++F L D+K    DE +  L  KV ++Y   +   +   +  +EM+T IE+ ++ L   +       +  A+KA D E++I     K ++  L  E  K+K  +E     P+ ++GR++V RSEP +      A N    R  EE  +FFT
Sbjct:  419 VYFSDPLELINVISELEINNLCLIENVQEQEELCESLIKKTHKIKSKIEKHINFIESLINSGREDLNNINEKINFIENINVNLNKHFNINRYKEIFYLEDLKITTLDELIGYLFNKVSKLYSTVIQKVDTNEIDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVD-EKKILAARLKHKEMMLDKEIIKMKKTMEEANKPPRYRYGRKVVYRSEPEKPNLIVAATNTDTLR-HEEYNFFFT 660          
BLAST of Cilia-and flagella-associated protein 100 vs. Planmine SMEST
Match: SMESG000023179.1 (SMESG000023179.1)

HSP 1 Score: 59.3066 bits (142), Expect = 6.326e-9
Identity = 81/273 (29.67%), Postives = 136/273 (49.82%), Query Frame = 3
Query: 1086 ETSADQQELKLEDYSSDDSEMDLYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDEL----KQIKQATELKMKRDTDVL---------MKQITXXXXXXXXXXXXXXXXXXXXXXFALSDVKTEDQDEFLERLHQKVDEVYRNCVSDREAKM--STLEMLTGIENQLELLFEAIDQMPSEKVEVAQKAKD----KERRIQMKEEKKEQ--QRLHHEENKLKALERVRAAPKKQFGRRLVGRSEP--PQFQKEDPALNDQRNREEEEMAYFF 1835
            +T  D + L+L+  S+DD   D+ F+D QD++N+F  LE +NL+LI+  QE EE  D L    K+IK    +K+K   D++         +++              + +LE  + +F L D+     DE L  L Q+V ++Y     DR   +  + +E+L  IE+ ++ L+  +      ++ +A+K+ D    K  R++ KE +KE   +R H        +E+ +  PK +FGR+LV RS P   +  KE   L   R  EE +  +FF
Sbjct:  407 DTFKDNETLELD--SNDD---DILFEDPQDLVNVFNNLEMNNLNLIENVQEQEEICDNLVNRLKKIKFEMAIKVKEIDDLIKRENHNVDGLEESIVFIMKTEDFTRSLNKLERYRSIFYLEDLDLTTVDELLGYLLQQVLDLYF-IFFDRGNSIVKNIIEILCRIESYVDKLYVKMQMYSKNQIIMAKKSVDDRKFKASRLKQKELEKEMRLKRFH------DVIEKSKLPPKHRFGRKLVYRSPPFDKKMSKEKGNLESIRKLEENQ--FFF 665          
The following BLAST results are available for this feature:
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CFAP1009.049e-7737.41cilia and flagella associated protein 100 [Source:... [more]
CFAP1005.514e-7537.35cilia and flagella associated protein 100 [Source:... [more]
CCDC381.316e-4333.41coiled-coil domain containing 38 [Source:HGNC Symb... [more]
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfap1002.126e-7240.04cilia and flagella associated protein 100 [Source:... [more]
cfap1008.055e-7239.82cilia and flagella associated protein 100 [Source:... [more]
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000019754.13.414e-8545.11pep primary_assembly:Xenopus_tropicalis_v9.1:4:122... [more]
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cfap1002.403e-6536.35cilia and flagella associated protein 100 [Source:... [more]
Cfap1004.220e-5737.86cilia and flagella associated protein 100 [Source:... [more]
Ccdc383.876e-4631.94coiled-coil domain containing 38 [Source:MGI Symbo... [more]
Ccdc382.369e-1829.41coiled-coil domain containing 38 [Source:MGI Symbo... [more]
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q494V2|CP100_HUMAN4.346e-7637.41Cilia- and flagella-associated protein 100 OS=Homo... [more]
sp|Q80VN0|CP100_MOUSE1.681e-6436.35Cilia- and flagella-associated protein 100 OS=Mus ... [more]
sp|A8I4E9|CP100_CHLRE4.007e-4636.05Cilia- and flagella-associated protein 100 OS=Chla... [more]
sp|Q8CDN8|CCD38_MOUSE2.711e-4531.94Coiled-coil domain-containing protein 38 OS=Mus mu... [more]
sp|Q95JL6|CCD38_MACFA5.294e-4533.12Coiled-coil domain-containing protein 38 OS=Macaca... [more]
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NTV62.154e-12652.79DUF4200 domain-containing protein OS=Pomacea canal... [more]
A0A433TQI24.303e-12249.21DUF4200 domain-containing protein OS=Elysia chloro... [more]
A7RX274.585e-12251.49Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A210PDY31.843e-12051.52Coiled-coil domain-containing protein 37 OS=Mizuho... [more]
A0A2G8JMN41.022e-11449.48Putative coiled-coil domain-containing protein OS=... [more]
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfap1001.806e-6837.99cilia and flagella associated protein 100 [Source:... [more]
cfap1003.624e-6438.49cilia and flagella associated protein 100 [Source:... [more]
cfap1007.041e-6438.22cilia and flagella associated protein 100 [Source:... [more]
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000006074.11.209e-4339.53pep scaffold:Pmarinus_7.0:GL479902:1411:13917:-1 g... [more]
ENSPMAT00000006080.11.315e-3841.11pep scaffold:Pmarinus_7.0:GL479902:1438:6227:-1 ge... [more]
ENSPMAT00000006069.11.602e-3554.17pep scaffold:Pmarinus_7.0:GL479902:1411:13917:-1 g... [more]
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO438946.341e-12651.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000035195.11.501e-3431.81cilia and flagella associated protein 100 [Source:... [more]
ENSORLT00000038744.11.838e-3431.81cilia and flagella associated protein 100 [Source:... [more]
ENSORLT00000011808.24.674e-3432.96cilia and flagella associated protein 100 [Source:... [more]
ENSORLT00000033867.13.204e-1036.52coiled-coil domain-containing protein 38 [Source:N... [more]
ENSORLT00000038701.14.444e-735.92coiled-coil domain-containing protein 38 [Source:N... [more]
back to top
BLAST of Cilia-and flagella-associated protein 100 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033127.10.000e+098.96SMESG000033127.1[more]
SMESG000023075.18.553e-1527.60SMESG000023075.1[more]
SMESG000023182.12.284e-1226.69SMESG000023182.1[more]
SMESG000070000.12.948e-926.64SMESG000070000.1[more]
SMESG000023179.16.326e-929.67SMESG000023179.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028659 ID=SMED30028659|Name=Cilia-and flagella-associated protein 100|organism=Schmidtea mediterranea sexual|type=transcript|length=1897bp
TTAAAACACTTGAATTTAAATATAATAGTTTTTTTAAATAAACTTTTTAA
GATATAATAATTATACGAAAAGTTTTTTTAGGGAATTATTAATTATTTTA
TATGGAAAAAGATAGAAGGGAACTCTCACTGACAATAAATCAGGAAGACG
AAATCTCAGAAAAGTTAGACAGTTGTTCTCAATCAGCTAAATCTACGGTT
TCTGAGAACTCAAATCGTAAATCAACAAAAGTATCTGAGAAAAATAACTT
AAAAGAACTACAGAAGTCTAAAAATCCATTTAAATTTAGAGATAATGTTG
ACATATTTGCTCTGCGTGACGAAGAAAGAAAATTTAAACTAGAAGAACGC
GAAAGACAGCGCCATTTAAAAGTTCACGAAAAAACTTATGGAATTGATTC
CAGGATAAAATTTAGGCAAGCTGCGTTGCTGAAAATACCAGACGACGATG
AATCAGCAACACAAGATCAAAGTTTAGTTGTCAAAGAAGATCCGGAATTC
GTTATTTCTGCCACCAAAGATCGTCAAGCTGAGAAAGAAACATTATCAGA
ATATATCACAAAGAAAAGAGAAATGTTTTTACTCCAATATTCTCTTGGTG
TTAAGCGAGAAGAAATGCGAAAGCTTGAAGAAATAGCTTCGGCGGAAGAA
AAGAAATTGGAATTAGCTGAGCAGTATTTGGAAGAAGACGCGGCAATGTT
TGACGACTTTCTGAAAGAAAACGACAAGAACGCCGTTGATGCGATGAAAG
TTGCTGAAAATGAAAGCAAAGAGAGAATGGCTAAAGTCAGCGAAGTTAAA
AGTTTAAATACGCAATTAATGCAAATAAAATCCGAAATCAACAAATATGA
AGAACAATTAAAAGAATATAAGATGTATAAAAGTTTTTTAGATAGATTGA
TACCTGAGAACATAAGATTTGAGAGGGAAGGGGCGTCAAAAGCTAGAAGG
GAAGCTAAAAGAAAAATCAAACAAGAAGAGGAAGCCATTGCTCGTATTGC
GAGGACAAACAGCCAGAGCAGTAGCCAGTCCAGTCGGAAACGTTCAATAA
TCAAAAAACCAATTGATTTAATCCTGTCAAAAGTTGAAACTTCTGCTGAC
CAACAAGAACTAAAATTAGAAGACTATAGTAGCGATGATTCGGAAATGGA
TTTGTATTTTAAAGATCATCAGGATATGCTTAATATATTTACGGAACTGG
AAGAGTCCAATCTTAGTCTAATTCAAACCTGTCAAGAGACCGAAGAATCT
CTGGATGAGCTTAAACAAATTAAACAAGCTACAGAATTAAAGATGAAAAG
AGACACTGATGTTTTGATGAAACAAATTACAAAATTAGAAAAATCTATTG
CATTAGAGGAAGAAAAAATTGAAGAACTAGAAATGAAGAAAAAACTTTTT
GCACTGAGTGATGTAAAAACTGAAGATCAAGACGAATTTCTTGAAAGATT
ACATCAAAAAGTTGACGAAGTTTACCGAAACTGCGTTTCTGACAGAGAAG
CAAAAATGAGCACACTTGAAATGTTGACTGGCATAGAAAATCAATTAGAA
TTACTTTTTGAAGCTATAGATCAAATGCCATCTGAAAAGGTTGAAGTAGC
TCAAAAAGCAAAGGATAAAGAAAGGAGAATACAAATGAAAGAAGAAAAGA
AAGAACAACAAAGACTGCATCACGAAGAGAACAAATTAAAAGCGCTTGAA
CGTGTTAGAGCGGCACCAAAGAAGCAGTTTGGAAGACGACTGGTTGGTCG
TTCTGAACCTCCTCAATTTCAAAAAGAAGATCCAGCATTAAATGATCAAA
GAAATAGAGAAGAAGAGGAGATGGCATACTTTTTTACGTAGAACTTAATT
TGTGTTGTTCTTTTAAATTAATTTAGTTATTTATTGTTGAAAAAAAA
back to top

protein sequence of SMED30028659-orf-1

>SMED30028659-orf-1 ID=SMED30028659-orf-1|Name=SMED30028659-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=580bp
MEKDRRELSLTINQEDEISEKLDSCSQSAKSTVSENSNRKSTKVSEKNNL
KELQKSKNPFKFRDNVDIFALRDEERKFKLEERERQRHLKVHEKTYGIDS
RIKFRQAALLKIPDDDESATQDQSLVVKEDPEFVISATKDRQAEKETLSE
YITKKREMFLLQYSLGVKREEMRKLEEIASAEEKKLELAEQYLEEDAAMF
DDFLKENDKNAVDAMKVAENESKERMAKVSEVKSLNTQLMQIKSEINKYE
EQLKEYKMYKSFLDRLIPENIRFEREGASKARREAKRKIKQEEEAIARIA
RTNSQSSSQSSRKRSIIKKPIDLILSKVETSADQQELKLEDYSSDDSEMD
LYFKDHQDMLNIFTELEESNLSLIQTCQETEESLDELKQIKQATELKMKR
DTDVLMKQITKLEKSIALEEEKIEELEMKKKLFALSDVKTEDQDEFLERL
HQKVDEVYRNCVSDREAKMSTLEMLTGIENQLELLFEAIDQMPSEKVEVA
QKAKDKERRIQMKEEKKEQQRLHHEENKLKALERVRAAPKKQFGRRLVGR
SEPPQFQKEDPALNDQRNREEEEMAYFFT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR025252DUF4200
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 496..535
NoneNo IPR availableCOILSCoilCoilcoord: 377..397
NoneNo IPR availableCOILSCoilCoilcoord: 409..429
NoneNo IPR availableCOILSCoilCoilcoord: 172..192
NoneNo IPR availableCOILSCoilCoilcoord: 325..345
NoneNo IPR availableCOILSCoilCoilcoord: 275..302
NoneNo IPR availableCOILSCoilCoilcoord: 232..259
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 562..579
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 514..579
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 514..540
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 24..39
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 21..51
NoneNo IPR availablePANTHERPTHR21683:SF3CILIA AND FLAGELLA ASSOCIATED PROTEIN 100coord: 51..578
NoneNo IPR availablePANTHERPTHR21683UNCHARACTERIZEDcoord: 51..578
IPR025252Domain of unknown function DUF4200PFAMPF13863DUF4200coord: 151..268
e-value: 1.7E-33
score: 115.6