IQ domain-containing protein H

Overview
NameIQ domain-containing protein H
Smed IDSMED30028653
Uniprot Best hitIQ domain-containing protein H OS=Homo sapiens OX=9606 GN=IQCH PE=2 SV=2 (E=0)
Length (bp)3441
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of IQ domain-containing protein H (SMED30028653) t-SNE clustered cells

Violin plots show distribution of expression levels for IQ domain-containing protein H (SMED30028653) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of IQ domain-containing protein H (SMED30028653) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for IQ domain-containing protein H (SMED30028653) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028653

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028653SMESG000037909.1 SmedASXL_017291SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30028653SMESG000037909.1 dd_Smed_v4_10544_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30028653SMESG000037909.1 dd_Smed_v4_10544_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30028653SMESG000037909.1 dd_Smed_v4_10544_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30028653SMESG000037909.1 dd_Smed_v6_10544_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30028653SMESG000037909.1 dd_Smed_v4_10544_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30028653SMESG000037909.1 dd_Smed_v4_10544_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30028653SMESG000037909.1 dd_Smed_v4_10544_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of IQ domain-containing protein H vs. Ensembl Human
Match: IQCH (IQ motif containing H [Source:HGNC Symbol;Acc:HGNC:25721])

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 406/1138 (35.68%), Postives = 630/1138 (55.36%), Query Frame = 1
Query:   67 ENEAVIGNIVLRVHEDLNRLQEKL---KAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATL---SINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLE--TNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKNVTKAYHTKPKETEDNNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKA------------QFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIENIINNE 3417
            EN   +G+I++++HEDL +L+EKL     +E   ++++  ++  I  T+ GL+   E+ LN +N  V ++S  D S    + S  L    I+Q+     QE         +E   W                                 +   LP +  ++ IK      + KGS +  L  LP    T+ ++    P  + + DA KG+L++IERGLIPP A+ITF                 +N  I P  A         +  DEA                  ++  V   +  +  P  P  +K         PK+     KS++S   R +HD+                              K M V    TP   L KS  D  + F+I DG++ +   DF+ FK H+ L WGGI S++E +EKFL+ Y+IP   + G+ +  L  E+EL  K +  +LLS L +   V  L+  PG+R+ G +    AA+ IQ+ WK Y ARKF+L YR+++WA+GVIAI W+L+   T +K+ L+++R +HL NF++R K L + W ++ +SRR +IH+PS G ++  R  +      QN Q+ RLCD++D NV+VIYI    MN+E++ Y+ K+LSL +AV SGN  D+  L  R+KII PEA+  FP H+MCL++ L YSP+A+ RIKN+I+G  A+IV G++H DD+ + ++L++PI+G+EPE+  L+ +KSG +++F+ ANV + PG   I S  Q+ E  +QLI D+L I++W+FK + + +  G  F DI  +L CY W  KE  RYG E W+KKWAQE A  +I  E+  I+  +   V+ K + T  KF + F S+ G+IEA+P +++VTN+TV+M I+P GKI +  +GDQ+H  +P  + G +VPQ+S+D ++L     +I + CR  D+ GYFSID VTF++ +   Q +WA  ++  YSD  +L  L+++ T              +F P +      M  +S  P+L+ +R+  +++Q+ HSNLSLV + VF Q+CRAHGIG+D++E+QGT+F L +   R  + M+TIG  L+  L +FA++L+I+H+EIS+PNM G  NF+  I +IE+IL +  EN +  E
Sbjct:    6 ENHDPVGSILIQIHEDLYQLKEKLTKFSPEEKGETLDIQSLETAIKRTEVGLRIHIEKYLNVVNQNVLTTSVNDESLYTPQASKWLLPTVIDQKSFIFPQE---------SEGTFWQ----------------------------PQRQHSSSLP-VFPRAKIKVSK---LIKGSNISSLTVLPSSHCTDPYFT---PIPVLQADAHKGILSMIERGLIPPTARITF-----------------QNPPITPRAA-------PLHSFDEAR-----------------KIPTVATFTIPREPPPSPAEVKFF-------PKKQRSKGKSRRS---RGHHDR------------------------------KAMKV---KTPLRAL-KSLWD--YDFLIYDGVIDNTAPDFLAFKEHFSLAWGGIFSLLEHVEKFLRNYAIPEVKIKGNNLVALLPEFELTNKLTRYDLLSVLEDPAHVQMLINLPGQRYKGQDGNSEAAMKIQATWKCYKARKFFLFYRQQKWASGVIAIAWLLYCHKTRLKKILKESRQRHLENFRIRAKHLAANWNRIRTSRRTIIHIPSLGYSQPVREHIADFNTQQNMQLGRLCDILDANVNVIYICSHHMNDELVLYYKKILSLHAAVKSGNLEDRSDLQDRFKIITPEAVNIFPKHHMCLATHLMYSPKAIKRIKNLIRGTEAYIVSGLLHRDDLAVADMLDIPILGSEPELAHLYSTKSGGKRVFDSANVAVPPGIYDIYSQQQMIEQLSQLITDHLQIQRWLFKMDSEFRGNGTAFCDIPSYLKCYKWVLKESSRYGLEDWRKKWAQEPALVKISEELAGILAQHAQPVNEKRFPTWRKFLQTFLSQGGVIEAFPPADNVTNLTVDMLIEPNGKISVLSTGDQLHAESPFISSGTTVPQTSVDPQVLTYLCLQIGKACRMRDVVGYFSIDLVTFIDPSTLEQQVWATGLNLAYSDQLALTQLTLYLTNGHLDCSLSTLEVPRFVPKERKKTKCMSALSM-PMLATSRYAVMTTQLRHSNLSLVFHYVFLQICRAHGIGYDVEERQGTVFILYEHLKRHKLGMLTIGEDLQGVLMTFARHLFIIHQEISAPNMQGETNFKTTIADIETILRVTKENKMRFE 1011          
BLAST of IQ domain-containing protein H vs. Ensembl Human
Match: IQCH (IQ motif containing H [Source:HGNC Symbol;Acc:HGNC:25721])

HSP 1 Score: 323.168 bits (827), Expect = 4.173e-96
Identity = 153/375 (40.80%), Postives = 236/375 (62.93%), Query Frame = 1
Query: 2332 ESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKA------------QFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIENIINNE 3417
            E  +QLI D+L I++W+FK + + +  G  F DI  +L CY W  KE  RYG E W+KKWAQE A  +I  E+  I+  +   V+ K + T  KF + F S+ G+IEA+P +++VTN+TV+M I+P GKI +  +GDQ+H  +P  + G +VPQ+S+D ++L     +I + CR  D+ GYFSID VTF++ +   Q +WA  ++  YSD  +L  L+++ T              +F P +      M  +S  P+L+ +R+  +++Q+ HSNLSLV + VF Q+CRAHGIG+D++E+QGT+F L +   R  + M+TIG  L+  L +FA++L+I+H+EIS+PNM G  NF+  I +IE+IL +  EN +  E
Sbjct:  295 EQLSQLITDHLQIQRWLFKMDSEFRGNGTAFCDIPSYLKCYKWVLKESSRYGLEDWRKKWAQEPALVKISEELAGILAQHAQPVNEKRFPTWRKFLQTFLSQGGVIEAFPPADNVTNLTVDMLIEPNGKISVLSTGDQLHAESPFISSGTTVPQTSVDPQVLTYLCLQIGKACRMRDVVGYFSIDLVTFIDPSTLEQQVWATGLNLAYSDQLALTQLTLYLTNGHLDCSLSTLEVPRFVPKERKKTKCMSALSM-PMLATSRYAVMTTQLRHSNLSLVFHYVFLQICRAHGIGYDVEERQGTVFILYEHLKRHKLGMLTIGEDLQGVLMTFARHLFIIHQEISAPNMQGETNFKTTIADIETILRVTKENKMRFE 668          

HSP 2 Score: 255.373 bits (651), Expect = 7.392e-72
Identity = 121/277 (43.68%), Postives = 183/277 (66.06%), Query Frame = 1
Query: 1222 HKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFP 2052
            + F+I DG++ +   DF+ FK H+ L WGGI S++E +EKFL+ Y+IP   + G+ +  L  E+EL  K +  +LLS L +   V  L+  PG+R+ G +    AA+ IQ+ WK Y ARKF+L YR+++WA+GVIAI W+L+   T +K+ L+++R +HL NF++R K L + W ++ +SRR +IH+PS G ++  R  +      QN Q+ RLCD++D NV+VIYI    MN+E++ Y+ K+LSL +AV SGN  D+  L  R+KII PEA+  FP
Sbjct:   16 YDFLIYDGVIDNTAPDFLAFKEHFSLAWGGIFSLLEHVEKFLRNYAIPEVKIKGNNLVALLPEFELTNKLTRYDLLSVLEDPAHVQMLINLPGQRYKGQDGNSEAAMKIQATWKCYKARKFFLFYRQQKWASGVIAIAWLLYCHKTRLKKILKESRQRHLENFRIRAKHLAANWNRIRTSRRTIIHIPSLGYSQPVREHIADFNTQQNMQLGRLCDILDANVNVIYICSHHMNDELVLYYKKILSLHAAVKSGNLEDRSDLQDRFKIITPEAVNIFP 292          
BLAST of IQ domain-containing protein H vs. Ensembl Human
Match: IQCH (IQ motif containing H [Source:HGNC Symbol;Acc:HGNC:25721])

HSP 1 Score: 256.144 bits (653), Expect = 1.003e-72
Identity = 131/302 (43.38%), Postives = 194/302 (64.24%), Query Frame = 1
Query: 1147 VTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFP 2052
            +TK M V    TP   L KS  D  + F+I DG++ +   DF+ FK H+ L WGGI S++E +EKFL+ Y+IP   + G+ +  L  E+EL  K +  +LLS L +   V  L+  PG+R+ G +    AA+ IQ+ WK Y ARKF+L YR+++WA+GVIAI W+L+   T +K+ L+++R +HL NF++R K L + W ++ +SRR +IH+PS G ++  R  +      QN Q+ RLCD++D NV+VIYI    MN+E++ Y+ K+LSL +AV SGN  D+  L  R+KII PEA+  FP
Sbjct:    1 MTKAMKV---KTPLRAL-KSLWD--YDFLIYDGVIDNTAPDFLAFKEHFSLAWGGIFSLLEHVEKFLRNYAIPEVKIKGNNLVALLPEFELTNKLTRYDLLSVLEDPAHVQMLINLPGQRYKGQDGNSEAAMKIQATWKCYKARKFFLFYRQQKWASGVIAIAWLLYCHKTRLKKILKESRQRHLENFRIRAKHLAANWNRIRTSRRTIIHIPSLGYSQPVREHIADFNTQQNMQLGRLCDILDANVNVIYICSHHMNDELVLYYKKILSLHAAVKSGNLEDRSDLQDRFKIITPEAVNIFP 296          

HSP 2 Score: 249.98 bits (637), Expect = 1.393e-70
Identity = 118/297 (39.73%), Postives = 183/297 (61.62%), Query Frame = 1
Query: 2332 ESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKA------------QFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLK 3183
            E  +QLI D+L I++W+FK + + +  G  F DI  +L CY W  KE  RYG E W+KKWAQE A  +I  E+  I+  +   V+ K + T  KF + F S+ G+IEA+P +++VTN+TV+M I+P GKI +  +GDQ+H  +P  + G +VPQ+S+D ++L     +I + CR  D+ GYFSID VTF++ +   Q +WA  ++  YSD  +L  L+++ T              +F P +      M  +S  P+L+ +R+  +++Q+ HSNLSLV + VF Q+CRAHGIG+D++
Sbjct:  299 EQLSQLITDHLQIQRWLFKMDSEFRGNGTAFCDIPSYLKCYKWVLKESSRYGLEDWRKKWAQEPALVKISEELAGILAQHAQPVNEKRFPTWRKFLQTFLSQGGVIEAFPPADNVTNLTVDMLIEPNGKISVLSTGDQLHAESPFISSGTTVPQTSVDPQVLTYLCLQIGKACRMRDVVGYFSIDLVTFIDPSTLEQQVWATGLNLAYSDQLALTQLTLYLTNGHLDCSLSTLEVPRFVPKERKKTKCMSALSM-PMLATSRYAVMTTQLRHSNLSLVFHYVFLQICRAHGIGYDVE 594          
BLAST of IQ domain-containing protein H vs. Ensembl Human
Match: IQCH (IQ motif containing H [Source:HGNC Symbol;Acc:HGNC:25721])

HSP 1 Score: 183.341 bits (464), Expect = 9.865e-51
Identity = 123/374 (32.89%), Postives = 184/374 (49.20%), Query Frame = 1
Query:  679 LIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKNVTKAYHTKPKETEDNNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLT 1800
            +IERGLIPP A+ITF                 +N  I P  A         +  DEA                  ++  V   +  +  P  P  +K         PK+     KS++S   R +HD+                              K M V    TP   L KS  D  + F+I DG++ +   DF+ FK H+ L WGGI S++E +EKFL+ Y+IP   + G+ +  L  E+EL  K +  +LLS L +   V  L+  PG+R+ G +    AA+ IQ+ WK Y ARKF+L YR+++WA+GVIAI W+L+   T +K+ L+++R +HL NF++R K L + W ++ +SRR +IH+PS G+T
Sbjct:    1 MIERGLIPPTARITF-----------------QNPPITPRAA-------PLHSFDEAR-----------------KIPTVATFTIPREPPPSPAEVKFF-------PKKQRSKGKSRRS---RGHHDR------------------------------KAMKV---KTPLRAL-KSLWD--YDFLIYDGVIDNTAPDFLAFKEHFSLAWGGIFSLLEHVEKFLRNYAIPEVKIKGNNLVALLPEFELTNKLTRYDLLSVLEDPAHVQMLINLPGQRYKGQDGNSEAAMKIQATWKCYKARKFFLFYRQQKWASGVIAIAWLLYCHKTRLKKILKESRQRHLENFRIRAKHLAANWNRIRTSRRTIIHIPSLGIT 287          
BLAST of IQ domain-containing protein H vs. Ensembl Human
Match: IQCH (IQ motif containing H [Source:HGNC Symbol;Acc:HGNC:25721])

HSP 1 Score: 157.147 bits (396), Expect = 3.952e-43
Identity = 71/156 (45.51%), Postives = 108/156 (69.23%), Query Frame = 1
Query: 1585 YLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFP 2052
            +L YR+++WA+GVIAI W+L+   T +K+ L+++R +HL NF++R K L + W ++ +SRR +IH+PS G ++  R  +      QN Q+ RLCD++D NV+VIYI    MN+E++ Y+ K+LSL +AV SGN  D+  L  R+KII PEA+  FP
Sbjct:    2 FLFYRQQKWASGVIAIAWLLYCHKTRLKKILKESRQRHLENFRIRAKHLAANWNRIRTSRRTIIHIPSLGYSQPVREHIADFNTQQNMQLGRLCDILDANVNVIYICSHHMNDELVLYYKKILSLHAAVKSGNLEDRSDLQDRFKIITPEAVNIFP 157          
BLAST of IQ domain-containing protein H vs. Ensembl Zebrafish
Match: iqch (IQ motif containing H [Source:NCBI gene;Acc:567336])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 283/763 (37.09%), Postives = 476/763 (62.39%), Query Frame = 1
Query: 1138 NDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSE------EELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNS-RYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRY-GEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            N  +T+ +    P  P S L    + + + F I DG +     DF ++K+ YCL WG +V  +E L++ L  +++PLA V G+R+A      EL  +         E+LLS L N  +V DL+ +PG+R+ G      AA+ IQ+ W+ Y AR  YL   R +WAA +IA+  +   K+ H+K+ LQ +R++ L NF  R + L + W  + S++R +IH+PS G ++  R  L+    LQN QM RLCD+ D NV+VIY+SPV + E++LQY+++LL L++A++ G+ S  +  ++ R+ I++PEA++ F   N+CL+S+LKYSPR L RIKN+IKG+ A+++ G+ HTDD+ + + L +P++GT+P +  L+ +KSG +++F  A V++ PG+  I ++ +L+E   QL+  ++ +++W+FK + ++  +G  ++D+  HL    WAQ+E  R+  ++W+   +Q++   + L EVP ++     L +   Y T + F + F  + G+IEA+P S+S+T + V++ ++P G + M   GDQ+   + L   G +VPQ+SI  E+L+    ++ + C+Q  I G+ S+D VTF++ N   Q +WA+D+D  YS+  ++  L +  T+         L  ++P   T+     +RF  + +++ H+NL LV+YS FF MC+A GIG+D+K +QGT+F+L DS  R ++ M+TI  +L+ AL +FA+NL I+H+EIS+PNM G  NF+ +IK+IE +LG+ I+N
Sbjct:  267 NRVLTRGLARLSPINPQS-LPVPAVVSKYPFTIVDGQIDPDAADFCRYKKQYCLYWGAMVEALERLQRMLLDFAVPLARVCGERLAACVQSGELNWRDGRGRCTHVEKLLSVLENRDEVWDLMCQPGQRYKGNGGHQAAAVRIQTCWRRYSARTAYLIRLRSKWAAEIIAMSLLKRAKLCHLKKSLQASRLRQLENFHSRAESLATNWKHITSAKRTIIHVPSLGYSQPRRLSLRGYDVLQNTQMGRLCDIRDENVEVIYVSPVRLGEDVLQYYTRLLGLQTAIELGDASATESHSAKRFTILMPEALEDFSTRNLCLASLLKYSPRTLKRIKNLIKGKQAYMISGVTHTDDLAVADELQIPLLGTDPVVTQLYSTKSGGKRIFSSAGVDMPPGKWDIYTLEKLYEGLAQLMAKHMEVQRWLFKIDSEVGGRGTAYVDV-CHLKSRPWAQQEFIRHEPQQWRTSQSQDSVMIKFLEEVPHLLASYARLANTSCYKTWACFLEHFLKEGGVIEAFPPSQSLTCLAVDLLLEPGGDVLMLSCGDQLRGPSGLEVLGCTVPQTSICPEVLHSVCTRVGQACQQRSIMGHISLDLVTFLDPNNLEQQVWAIDLDLGYSNQLAMTQLMLMMTRGTLNCRTSKL--EVPPSETS---VTSRFAVMCTRLLHTNLPLVYYSTFFLMCKAQGIGYDVKARQGTVFALHDSRYRRSLGMLTISENLQGALLTFARNLSIIHQEISAPNMQGASNFKELIKDIEEVLGMTIQN 1022          

HSP 2 Score: 54.299 bits (129), Expect = 1.122e-6
Identity = 43/165 (26.06%), Postives = 85/165 (51.52%), Query Frame = 1
Query:   61 LMENEAVIGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDL---ISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQ 546
            +++N+  +GNI+++V +DL +L++ +     Q +  + DI+ L   I  T+ G+++ AE+ L  +N++V +  +I+   +K+     L   Q   + L          ++ I      SPGE  K    ++ L NP +  N+    + YGIQLP + ++++I  Q
Sbjct:    4 VLKNKDEVGNILVKVQDDLRQLKKNIVQFTVQENGEILDIQALDAAIIRTENGIRRHAEDYLKTINNQVLTLPSIEEP-EKKTAHPKLVTWQPPYEALP----IAHPHRSPI---PGPSPGEKHKTAFIMRLLHNPFHPRNKEIFQQNYGIQLPHLQKRTSIGIQ 160          
BLAST of IQ domain-containing protein H vs. Ensembl Zebrafish
Match: iqch (IQ motif containing H [Source:NCBI gene;Acc:567336])

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 284/779 (36.46%), Postives = 477/779 (61.23%), Query Frame = 1
Query: 1138 NDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSE------EELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNS-RYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRY-GEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPILS----------------VNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            N  +T+ +    P  P S L    + + + F I DG +     DF ++K+ YCL WG +V  +E L++ L  +++PLA V G+R+A      EL  +         E+LLS L N  +V DL+ +PG+R+ G      AA+ IQ+ W+ Y AR  YL   R +WAA +IA+  +   K+ H+K+ LQ +R++ L NF  R + L + W  + S++R +IH+PS G ++  R  L+    LQN QM RLCD+ D NV+VIY+SPV + E++LQY+++LL L++A++ G+ S  +  ++ R+ I++PEA++ F   N+CL+S+LKYSPR L RIKN+IKG+ A+++ G+ HTDD+ + + L +P++GT+P +  L+ +KSG +++F  A V++ PG+  I ++ +L+E   QL+  ++ +++W+FK + ++  +G  ++D+  HL    WAQ+E  R+  ++W+   +QE+   + L EVP ++     L +   Y T + F++ F  + G+IEA+P S+S+T +TV++ ++P G + M   GDQ+   + L   G +VPQ+SI  E+L+    ++ + C+Q  I G+ S+D VTF++ N   Q +WA+D+D  YS+  ++  L +  T+         L    P+V    +                   +RF  + +++ H+NL LV+YS FF MC+A GIG+D+K +QGT+F+L DS  R ++ M+TI  +L+ AL +FA+NL I+H+EIS+PNM G  NF+ +IK+IE +LG+ I++
Sbjct:  267 NRVLTRGLARLSPINPQS-LPVPAVVSKYPFTIVDGQIDPDAADFCRYKKQYCLYWGAMVEALERLQRMLLDFAVPLARVCGERLAACVQSGELNWRDGRGRCTHVEKLLSVLENRDEVWDLMCQPGQRYKGNGGHQAAAVRIQTCWRRYSARTAYLIRLRSKWAAEIIAMSLLKRAKLCHLKKSLQASRLRQLENFHSRAESLATNWKHITSAKRTIIHVPSLGYSQPRRLSLRGFDVLQNTQMGRLCDIRDENVEVIYVSPVRLGEDVLQYYTRLLGLQTAIELGDASATESHSAKRFTILMPEALEDFSTRNLCLASLLKYSPRTLKRIKNLIKGKQAYMISGVTHTDDLAVADELQIPLLGTDPVVTQLYSTKSGGKRIFSSAGVDMPPGKWDIYTLEKLYEGLAQLMAKHMEVQRWLFKIDSEVGGRGTAYVDV-CHLKSRPWAQQEFIRHEPQQWRTSQSQESVMIKFLEEVPHLLASYARLANTSCYKTWACFFEHFLKEGGVIEAFPPSQSLTCLTVDLLLEPGGDVLMLSCGDQLRGPSGLEVLGCTVPQTSICPEVLHSVCTRVGQACQQRSIMGHISLDLVTFLDPNNLEQQVWAIDLDLGYSNQLAMTQLMLMMTRGTLDCRTSKLEVP-PSVREISVKKSSVHHTRRQPKSETSVTSRFAVMCTRLLHTNLPLVYYSTFFLMCKAQGIGYDVKARQGTVFALHDSRYRRSLGMLTISENLQGALLTFARNLSIIHQEISAPNMQGASNFKELIKDIEEVLGMTIQS 1042          

HSP 2 Score: 54.299 bits (129), Expect = 1.108e-6
Identity = 43/165 (26.06%), Postives = 85/165 (51.52%), Query Frame = 1
Query:   61 LMENEAVIGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDL---ISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQ 546
            +++N+  +GNI+++V +DL +L++ +     Q +  + DI+ L   I  T+ G+++ AE+ L  +N++V +  +I+   +K+     L   Q   + L          ++ I      SPGE  K    ++ L NP +  N+    + YGIQLP + ++++I  Q
Sbjct:    4 VLKNKDEVGNILVKVQDDLRQLKKNIVQFTVQENGEILDIQALDAAIIRTENGIRRHAEDYLKTINNQVLTLPSIEEP-EKKTAHPKLVTWQPPYEALP----IAHPHRSPI---PGPSPGEKHKTAFIMRLLHNPFHPRNKEIFQQNYGIQLPHLQKRTSIGIQ 160          
BLAST of IQ domain-containing protein H vs. Ensembl Zebrafish
Match: iqch (IQ motif containing H [Source:NCBI gene;Acc:567336])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 283/779 (36.33%), Postives = 475/779 (60.98%), Query Frame = 1
Query: 1138 NDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSE------EELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNS-RYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRY-GEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPILS----------------VNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            N  +T+ +    P  P S L    + + + F I DG +     DF ++K+ YCL WG +V  +E L++ L  +++PLA V G+R+A      EL  +         E+LLS L N  +V DL+ +PG+R+ G      AA+ IQ+ W+ Y AR  YL   R +WAA +IA+  +   K+ H+K+ LQ +R++ L NF  R + L + W  + S++R +IH+PS G ++  R  L+    LQN QM RLCD+ D NV+VIY+SPV + E++LQY+++LL L++A++ G+ S  +  ++ R+ I++PEA++ F   N+CL+S+LKYSPR L RIKN+IKG+ A+++ G+ HTDD+ + + L +P++GT+P +  L+ +KSG +++F  A V++ PG+  I ++ +L+E   QL+  ++ +++W+FK + ++  +G  ++D+  HL    WAQ+E  R+  ++W+   +Q++   + L EVP ++     L +   Y T + F + F  + G+IEA+P S+S+T + V++ ++P G + M   GDQ+   + L   G +VPQ+SI  E+L+    ++ + C+Q  I G+ S+D VTF++ N   Q +WA+D+D  YS+  ++  L +  T+         L    P+V    +                   +RF  + +++ H+NL LV+YS FF MC+A GIG+D+K +QGT+F+L DS  R ++ M+TI  +L+ AL +FA+NL I+H+EIS+PNM G  NF+ +IK+IE +LG+ I+N
Sbjct:  267 NRVLTRGLARLSPINPQS-LPVPAVVSKYPFTIVDGQIDPDAADFCRYKKQYCLYWGAMVEALERLQRMLLDFAVPLARVCGERLAACVQSGELNWRDGRGRCTHVEKLLSVLENRDEVWDLMCQPGQRYKGNGGHQAAAVRIQTCWRRYSARTAYLIRLRSKWAAEIIAMSLLKRAKLCHLKKSLQASRLRQLENFHSRAESLATNWKHITSAKRTIIHVPSLGYSQPRRLSLRGYDVLQNTQMGRLCDIRDENVEVIYVSPVRLGEDVLQYYTRLLGLQTAIELGDASATESHSAKRFTILMPEALEDFSTRNLCLASLLKYSPRTLKRIKNLIKGKQAYMISGVTHTDDLAVADELQIPLLGTDPVVTQLYSTKSGGKRIFSSAGVDMPPGKWDIYTLEKLYEGLAQLMAKHMEVQRWLFKIDSEVGGRGTAYVDV-CHLKSRPWAQQEFIRHEPQQWRTSQSQDSVMIKFLEEVPHLLASYARLANTSCYKTWACFLEHFLKEGGVIEAFPPSQSLTCLAVDLLLEPGGDVLMLSCGDQLRGPSGLEVLGCTVPQTSICPEVLHSVCTRVGQACQQRSIMGHISLDLVTFLDPNNLEQQVWAIDLDLGYSNQLAMTQLMLMMTRGTLNCRTSKLEVP-PSVREISVKKSSVHHTRRQPKSETSVTSRFAVMCTRLLHTNLPLVYYSTFFLMCKAQGIGYDVKARQGTVFALHDSRYRRSLGMLTISENLQGALLTFARNLSIIHQEISAPNMQGASNFKELIKDIEEVLGMTIQN 1042          

HSP 2 Score: 54.299 bits (129), Expect = 1.053e-6
Identity = 43/165 (26.06%), Postives = 85/165 (51.52%), Query Frame = 1
Query:   61 LMENEAVIGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDL---ISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQ 546
            +++N+  +GNI+++V +DL +L++ +     Q +  + DI+ L   I  T+ G+++ AE+ L  +N++V +  +I+   +K+     L   Q   + L          ++ I      SPGE  K    ++ L NP +  N+    + YGIQLP + ++++I  Q
Sbjct:    4 VLKNKDEVGNILVKVQDDLRQLKKNIVQFTVQENGEILDIQALDAAIIRTENGIRRHAEDYLKTINNQVLTLPSIEEP-EKKTAHPKLVTWQPPYEALP----IAHPHRSPI---PGPSPGEKHKTAFIMRLLHNPFHPRNKEIFQQNYGIQLPHLQKRTSIGIQ 160          
BLAST of IQ domain-containing protein H vs. Ensembl Zebrafish
Match: iqch (IQ motif containing H [Source:NCBI gene;Acc:567336])

HSP 1 Score: 116.316 bits (290), Expect = 3.462e-29
Identity = 57/173 (32.95%), Postives = 101/173 (58.38%), Query Frame = 1
Query: 2410 QGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVE-NNEENQL 2922
            +G  ++D+  HL    WAQ+E  R+  ++W+   +Q++   + L EVP ++     L +   Y T + F + F  + G+IEA+P S+S+T + V++ ++P G + M   GDQ+   + L   G +VPQ+SI  E+L+    ++ + C+Q  I G+ S+D VTF++ NN E Q+
Sbjct:    3 RGTAYVDV-CHLKSRPWAQQEFIRHEPQQWRTSQSQDSVMIKFLEEVPHLLASYARLANTSCYKTWACFLEHFLKEGGVIEAFPPSQSLTCLAVDLLLEPGGDVLMLSCGDQLRGPSGLEVLGCTVPQTSICPEVLHSVCTRVGQACQQRSIMGHISLDLVTFLDPNNLEQQV 174          
BLAST of IQ domain-containing protein H vs. Ensembl Xenopus
Match: pter (phosphotriesterase related [Source:Xenbase;Acc:XB-GENE-1007035])

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 409/1125 (36.36%), Postives = 633/1125 (56.27%), Query Frame = 1
Query:   82 IGNIVLRVHEDLNRLQEKLK---AKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSI--NQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKNVTKAYHTKPKETEDNNKSKKSILLRNNHDKP--TNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMP----------TVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            +G ++++V +DL  L+ KL      E    +++ D++  I  T+ GL+K  E+ L++++    +  T+   G K + +  L    NQ   +   E+      R     T ++ SPG+  K  +  + + NP +  +R   N+  GI LPLI  +      N D I +GS V  L  LP  +N+   +  P  + E D +KG+L+L +RGLIP  A++T  PP I   ++ + S  ++    + A     GYS +           N +          + +  +     DK +P +  +  N      T P+  E + +  ++ L  +  D P  +   S+ +    K      I T R    T      P       L+   + T H  ++++G++     DF+ FK+ YCL WG  VS +E+L+K L+ Y++P A VNG+++  + ++ EL + P+   LL  L N   V  ++ +PG+R+ G      AA+ IQS W++Y  RK YL YRR++WAAGVIAI W+LH++ + VK+ LQ++R + L NF  R K L S W  + + RR +IH+PS G TE  R+    L  LQN Q+ RLCD+ D NVDVIYISPV ++EE LQY+ +LL L+ AV SGN  D   L+ R   + PEA+K FPNH+MCLS++LKYSP+ L RI+++  GR A+IV G+ H DD+ + ++L++P++ TEPE+  L+ +KSG +++F  A +  +PG   I +  Q  ES  Q+IIDNL + +W+FK + +    GI F DI  +L  Y W   E++RYG + WK+KWAQE A   I +E+P ++E +    + K Y T  KF     S  G+IEA+P +ES+T +TV++ I P G+IQM   GDQ+H  + L   G SVPQ S+  +IL +   +I E C+   + GY S+D +TF++     Q IWA D++  YSD  ++  L ++ T      +   L   +             +T  I S  R   LSS++ H+NLSLV+YSVFFQMCRAHGIG+D++EKQGT+F L+++  R  + M++I   ++ AL +FA+NL+I+H+EIS+PNM G  NF+ ++KEIE ILG+  EN
Sbjct:   11 VGRLLVQVQDDLEHLKRKLTNTGLGEDGEGVDIQDLETAIQRTEVGLRKHTEDYLHYIS---CNPMTLLQDGNKDKYTPHLLKWGNQAGDQNPSELP---NTRGRSWGTISHFSPGQQHKLFLNNRIMCNPESAAHRELLNQSLGISLPLISTRQKTSMSN-DKITRGSTVSNLSVLP-ASNRRDASLAPPPLNEKDMQKGILSLQQRGLIPSVAQLTLVPPAIVPRSLQLHSTRIQKATSMQAKGRKPGYSHS--------RVTNQWPFISVYMCVCLFIPTI-VFDIDKELPMVEESTHN----EETDPEAKEGDYQLFQTELPDDGMDTPYPSRLHSVSS----KIARASVITTIRKPACTN-----PTAEDPGALTALALPTGHSLILRNGLINTDDLDFLAFKQRYCLCWGSFVSFLESLQKLLQDYAVPTAIVNGEKLKAVVLDQELGITPAVSRLLFVLENKSWVQKIMNQPGQRYKGKEGRMAAAVRIQSSWRSYQDRKAYLTYRRQKWAAGVIAITWLLHVQRSRVKKLLQESRAQQLQNFHSRAKHLASNWNHIRTCRRSIIHIPSLGYTESQRAHTHDLHILQNLQIGRLCDIADPNVDVIYISPVELDEETLQYYRRLLGLRPAVLSGNQQDACELHDRIIFLTPEAVKDFPNHHMCLSTLLKYSPKTLQRIRHLTHGREAYIVGGVPHVDDLAVADMLDIPLLATEPELAHLYSTKSGSKRIFFSAGLATAPGTYDIYTQQQFLESLAQMIIDNLLVSRWLFKVDNEFGGNGIAFCDIAKYLPSYAWVVSERQRYGPDIWKQKWAQEKALLLITQELPQVLENHAQPTNRKRYPTWVKFLDALVSCGGVIEAFPPAESITCLTVDLLISPDGEIQMVSCGDQLHSHSNLQCVGSSVPQCSVPPDILTDVCKRIGEACKACGLLGYLSVDLLTFIDPQSLEQQIWATDLNVCYSDQLAMTQLLLYLTNGTLDCNSSCLNVPLAPKKVERFRPRAQNTENIPSTCRVAVLSSRLMHTNLSLVYYSVFFQMCRAHGIGYDVREKQGTVFVLLENQKRHRLGMLSIAEDVQGALMTFARNLFIIHQEISAPNMQGDTNFKEIVKEIEEILGVTEEN 1105          
BLAST of IQ domain-containing protein H vs. Ensembl Xenopus
Match: pter (phosphotriesterase related [Source:Xenbase;Acc:XB-GENE-1007035])

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 406/1125 (36.09%), Postives = 627/1125 (55.73%), Query Frame = 1
Query:   82 IGNIVLRVHEDLNRLQEKLK---AKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSI--NQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKNVTKAYHTKPKETEDNNKSKKSILLRNNHDKP--TNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMP----------TVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            +G ++++V +DL  L+ KL      E    +++ D++  I  T+ GL+K  E+ L++++    +  T+   G K + +  L    NQ   +   E+      R     T ++ SPG+  K  +  + + NP +  +R   N+  GI LPLI  +      N D I +GS V  L  LP  +N+   +  P  + E D +KG+L+L +RGLIP  A++T  PP I   ++ + S  +                                       QK+  ++     + DK +P +  +  N      T P+  E + +  ++ L  +  D P  +   S+ +    K      I T R    T      P       L+   + T H  ++++G++     DF+ FK+ YCL WG  VS +E+L+K L+ Y++P A VNG+++  + ++ EL + P+   LL  L N   V  ++ +PG+R+ G      AA+ IQS W++Y  RK YL YRR++WAAGVIAI W+LH++ + VK+ LQ++R + L NF  R K L S W  + + RR +IH+PS G TE  R+    L  LQN Q+ RLCD+ D NVDVIYISPV ++EE LQY+ +LL L+ AV SGN  D   L+ R   + PEA+K FPNH+MCLS++LKYSP+ L RI+++  GR A+IV G+ H DD+ + ++L++P++ TEPE+  L+ +KSG +++F  A +  +PG   I +  Q  ES  Q+IIDNL + +W+FK + +    GI F DI  +L  Y W   E++RYG + WK+KWAQE A   I +E+P ++E +    + K Y T  KF     S  G+IEA+P +ES+T +TV++ I P G+IQM   GDQ+H  + L   G SVPQ S+  +IL +   +I E C+   + GY S+D +TF++     Q IWA D++  YSD  ++  L ++ T      +   L   +             +T  I S  R   LSS++ H+NLSLV+YSVFFQMCRAHGIG+D++EKQGT+F L+++  R  + M++I   ++ AL +FA+NL+I+H+EIS+PNM G  NF+ ++KEIE ILG+  EN
Sbjct:   11 VGRLLVQVQDDLEHLKRKLTNTGLGEDGEGVDIQDLETAIQRTEVGLRKHTEDYLHYIS---CNPMTLLQDGNKDKYTPHLLKWGNQAGDQNPSELP---NTRGRSWGTISHFSPGQQHKLFLNNRIMCNPESAAHRELLNQSLGISLPLISTRQKTSMSN-DKITRGSTVSNLSVLP-ASNRRDASLAPPPLNEKDMQKGILSLQQRGLIPSVAQLTLVPPAIVPRSLQLHSTRI---------------------------------------QKATSMQ-----AKDKELPMVEESTHN----EETDPEAKEGDYQLFQTELPDDGMDTPYPSRLHSVSS----KIARASVITTIRKPACTN-----PTAEDPGALTALALPTGHSLILRNGLINTDDLDFLAFKQRYCLCWGSFVSFLESLQKLLQDYAVPTAIVNGEKLKAVVLDQELGITPAVSRLLFVLENKSWVQKIMNQPGQRYKGKEGRMAAAVRIQSSWRSYQDRKAYLTYRRQKWAAGVIAITWLLHVQRSRVKKLLQESRAQQLQNFHSRAKHLASNWNHIRTCRRSIIHIPSLGYTESQRAHTHDLHILQNLQIGRLCDIADPNVDVIYISPVELDEETLQYYRRLLGLRPAVLSGNQQDACELHDRIIFLTPEAVKDFPNHHMCLSTLLKYSPKTLQRIRHLTHGREAYIVGGVPHVDDLAVADMLDIPLLATEPELAHLYSTKSGSKRIFFSAGLATAPGTYDIYTQQQFLESLAQMIIDNLLVSRWLFKVDNEFGGNGIAFCDIAKYLPSYAWVVSERQRYGPDIWKQKWAQEKALLLITQELPQVLENHAQPTNRKRYPTWVKFLDALVSCGGVIEAFPPAESITCLTVDLLISPDGEIQMVSCGDQLHSHSNLQCVGSSVPQCSVPPDILTDVCKRIGEACKACGLLGYLSVDLLTFIDPQSLEQQIWATDLNVCYSDQLAMTQLLLYLTNGTLDCNSSCLNVPLAPKKVERFRPRAQNTENIPSTCRVAVLSSRLMHTNLSLVYYSVFFQMCRAHGIGYDVREKQGTVFVLLENQKRHRLGMLSIAEDVQGALMTFARNLFIIHQEISAPNMQGDTNFKEIVKEIEEILGVTEEN 1070          
BLAST of IQ domain-containing protein H vs. Ensembl Mouse
Match: Iqch (IQ motif containing H [Source:MGI Symbol;Acc:MGI:1925500])

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 317/769 (41.22%), Postives = 493/769 (64.11%), Query Frame = 1
Query: 1180 TPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVS---------------TAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN--IINNESRVKE 3432
            TP S+  KS  D  + F + +G +     DF+ FK  + LIWG I S +E +EKFLK Y+I  A + G  +  L  E+EL+ K +  ++L+ L N   +  LL  PG+R+ G + +  AA  IQ+ WK+Y AR  ++ YR+K+WA+GVIA+ W+LH   T +K  ++++R +HL NF++R + L + W+++ +SRR +IH+PS G ++  R  +  L   QN Q+ RLCD++D NV+VIYI   PM +E+  Y+ KLLSL++AV +G   D+  L +R++II PEA+  F  H+MCL++ L YSP+A+ RIKN+I+G  A+IV G++H DD+ + ++LNVPI+G+EPE++ L+ +KSG +++F+ ANV + PG   I +  Q+ E  +QL+ DNL I++W+FK N +    G  F DI  HL CYNW  KE+ R+G E WKKKWAQE+A  +I  E+  I+  ++ LV+ K + T  KF   F ++ G+IEAYP ++SVTN+TV+M I+P G++++   GDQ+H   P  + G ++PQ+S+D ++LN    +I   C++ D+ GYFSID VTF++ +   Q +W   ++  YSD  ++  L+++ T      +  L   ++P  +                AP    +R+  +S+Q+ H NLSL+ Y VF QMC+AHGIG+DL+++QGT+F L +S  R  + M+TIG  L+  L +FA+NL+I+H+EIS+P+M G  NF+  I +IE+ILG+  EN  I   E + KE
Sbjct:  294 TP-SKTRKSPWD--YIFSVYNGCVDRTAPDFLAFKSRFKLIWGSIFSFLEQIEKFLKDYAISEAKIKGKSLVSLLPEFELKNKLTRNDVLAVLENPVHIQMLLNLPGQRYKGQDGKAEAATKIQATWKSYKARSSFISYRQKKWASGVIALAWLLHCHRTRLKRIVKESRQRHLENFRIRAQHLAANWSRIRTSRRTIIHIPSLGYSQYVRKHIFDLDVEQNMQLGRLCDIIDANVNVIYICSHPMTDELKLYYRKLLSLQAAVKTGYYGDRTDLQNRFRIITPEAVNVFTKHHMCLATHLMYSPKAIKRIKNLIRGEEAYIVGGILHRDDLAVADMLNVPILGSEPELVHLYSAKSGSKRIFDNANVPMPPGIYDIYTYQQMIEQLSQLVTDNLGIRRWVFKMNTEFGGNGTAFCDIPSHLQCYNWVLKERNRFGHEDWKKKWAQESALVKISEELAGILAQHVQLVNEKRFPTWRKFLHMFLTQGGVIEAYPPADSVTNLTVDMLIEPDGEVRVLSMGDQLHADGPFISSGTTMPQTSVDPQVLNSLCLQIGNICKEKDVVGYFSIDLVTFIDPSTLEQQVWTTGLNLSYSDQLAMTQLTLYLTNGHL--NCSLSTLEVPRFTEDSERERKRLSIQAELAP--ETSRYAVMSTQLKHDNLSLIFYYVFLQMCKAHGIGYDLEDRQGTVFILYESLKRYKLGMLTIGVDLQGVLMTFARNLFIIHQEISAPDMQGETNFKTTIDDIETILGVTEENKMIFVREKQSKE 1055          

HSP 2 Score: 95.9005 bits (237), Expect = 2.075e-19
Identity = 76/252 (30.16%), Postives = 133/252 (52.78%), Query Frame = 1
Query:   67 ENEAVIGNIVLRVHEDLNRLQEKL---KAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDN--SGQKRRISATLSINQEKLKQLQEIDL--NDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHE-KSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPA 798
            E+   IG+I+++VHEDL++L+EKL    A+ET++++++ +++  I  T+ GL+   ++ L  +N  V  +    +  S    + S    I+Q+      + D     + R + +     + P    K ++  K + +P NK +R      YGI LP I++ K+  K Q    + KGS +  L  LP  +++   +  P  + + DA KG+L++IERGLIPP A+ITF  PPI    +P+ S     +V + A
Sbjct:    6 EDSDPIGSILIQVHEDLHQLKEKLVKFSAEETRSTLDIQNLETAIQRTEMGLKIHIDKYLGVVNQEVLMAPVKKSLESPVTSKWSIPTVIDQKSFIFPMDSDFWRPQKHRGSLLHGLRRAKP----KIQLTTKVMQDPENKHHRAAVTASYGISLPHINQRKAQDKVQR---LIKGSTISNLTVLP-PSHRTDPHFIPIPVLQKDASKGVLSMIERGLIPPTARITFQNPPIKPQALPLHSFDEHRKVPMEA 249          
BLAST of IQ domain-containing protein H vs. Ensembl Mouse
Match: Iqch (IQ motif containing H [Source:MGI Symbol;Acc:MGI:1925500])

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 317/769 (41.22%), Postives = 493/769 (64.11%), Query Frame = 1
Query: 1180 TPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVS---------------TAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN--IINNESRVKE 3432
            TP S+  KS  D  + F + +G +     DF+ FK  + LIWG I S +E +EKFLK Y+I  A + G  +  L  E+EL+ K +  ++L+ L N   +  LL  PG+R+ G + +  AA  IQ+ WK+Y AR  ++ YR+K+WA+GVIA+ W+LH   T +K  ++++R +HL NF++R + L + W+++ +SRR +IH+PS G ++  R  +  L   QN Q+ RLCD++D NV+VIYI   PM +E+  Y+ KLLSL++AV +G   D+  L +R++II PEA+  F  H+MCL++ L YSP+A+ RIKN+I+G  A+IV G++H DD+ + ++LNVPI+G+EPE++ L+ +KSG +++F+ ANV + PG   I +  Q+ E  +QL+ DNL I++W+FK N +    G  F DI  HL CYNW  KE+ R+G E WKKKWAQE+A  +I  E+  I+  ++ LV+ K + T  KF   F ++ G+IEAYP ++SVTN+TV+M I+P G++++   GDQ+H   P  + G ++PQ+S+D ++LN    +I   C++ D+ GYFSID VTF++ +   Q +W   ++  YSD  ++  L+++ T      +  L   ++P  +                AP    +R+  +S+Q+ H NLSL+ Y VF QMC+AHGIG+DL+++QGT+F L +S  R  + M+TIG  L+  L +FA+NL+I+H+EIS+P+M G  NF+  I +IE+ILG+  EN  I   E + KE
Sbjct:  255 TP-SKTRKSPWD--YIFSVYNGCVDRTAPDFLAFKSRFKLIWGSIFSFLEQIEKFLKDYAISEAKIKGKSLVSLLPEFELKNKLTRNDVLAVLENPVHIQMLLNLPGQRYKGQDGKAEAATKIQATWKSYKARSSFISYRQKKWASGVIALAWLLHCHRTRLKRIVKESRQRHLENFRIRAQHLAANWSRIRTSRRTIIHIPSLGYSQYVRKHIFDLDVEQNMQLGRLCDIIDANVNVIYICSHPMTDELKLYYRKLLSLQAAVKTGYYGDRTDLQNRFRIITPEAVNVFTKHHMCLATHLMYSPKAIKRIKNLIRGEEAYIVGGILHRDDLAVADMLNVPILGSEPELVHLYSAKSGSKRIFDNANVPMPPGIYDIYTYQQMIEQLSQLVTDNLGIRRWVFKMNTEFGGNGTAFCDIPSHLQCYNWVLKERNRFGHEDWKKKWAQESALVKISEELAGILAQHVQLVNEKRFPTWRKFLHMFLTQGGVIEAYPPADSVTNLTVDMLIEPDGEVRVLSMGDQLHADGPFISSGTTMPQTSVDPQVLNSLCLQIGNICKEKDVVGYFSIDLVTFIDPSTLEQQVWTTGLNLSYSDQLAMTQLTLYLTNGHL--NCSLSTLEVPRFTEDSERERKRLSIQAELAP--ETSRYAVMSTQLKHDNLSLIFYYVFLQMCKAHGIGYDLEDRQGTVFILYESLKRYKLGMLTIGVDLQGVLMTFARNLFIIHQEISAPDMQGETNFKTTIDDIETILGVTEENKMIFVREKQSKE 1016          

HSP 2 Score: 69.3218 bits (168), Expect = 2.835e-11
Identity = 63/247 (25.51%), Postives = 121/247 (48.99%), Query Frame = 1
Query:   67 ENEAVIGNIVLRVHEDLNRLQEKL---KAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPA 798
            E+   IG+I+++VHEDL++L+EKL    A+ET++++++ +++  I  T+ GL+   ++ L                           +NQE L    +  L         +T  +S P   + ++  +  + +   +  ++  + ++G++      ++  K Q    + KGS +  L  LP  +++   +  P  + + DA KG+L++IERGLIPP A+ITF  PPI    +P+ S     +V + A
Sbjct:    6 EDSDPIGSILIQVHEDLHQLKEKLVKFSAEETRSTLDIQNLETAIQRTEMGLKIHIDKYLG-------------------------VVNQEVLMAPVKKSLESP------VTSKWSIP-TVIDQKSFIFPMDSDFWRPQKHRGSLLHGLR------RAKDKVQR---LIKGSTISNLTVLP-PSHRTDPHFIPIPVLQKDASKGVLSMIERGLIPPTARITFQNPPIKPQALPLHSFDEHRKVPMEA 210          
BLAST of IQ domain-containing protein H vs. Ensembl Mouse
Match: Iqch (IQ motif containing H [Source:MGI Symbol;Acc:MGI:1925500])

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 302/738 (40.92%), Postives = 469/738 (63.55%), Query Frame = 1
Query: 1228 FVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN--IINNESRVKE 3432
            F + +G +     DF+ FK  + LIWG I S +E +EKFLK Y+I  A + G  +  L  E+EL+ K +  ++L+ L N   +  LL  PG+R+ G + +  AA  IQ+ WK+Y AR  ++ YR+K+WA+GVIA+ W+LH   T +K  ++++R +HL NF++R + L + W+++ +SRR +IH+PS G ++  R  +  L   QN Q+ RLCD++D NV+VIYI   PM +E+  Y+ KLLSL++AV +G   D+  L +R++II PEA+  F  H+MCL++ L YSP+A+ RIKN+I+G  A+IV G++H DD+ + ++LNVPI+G+EPE++ L+ +KSG +++F+ ANV + PG   I +  Q+ E  +QL+ DNL I++W+FK N +    G  F DI  HL CYNW  KE+ R+G E WKKKWAQE+A  +I  E+  I+  ++ LV+ K + T  KF   F ++ G+IEAYP ++SVTN+TV+M I+P G++++   GDQ+H   P  + G ++PQ+S+D ++LN    +I   C++ D+ GYFSID VTF++ +   Q +W   ++  YSD  ++  L+++ T                   +   L V RF    S+     LS+        MC+AHGIG+DL+++QGT+F L +S  R  + M+TIG  L+  L +FA+NL+I+H+EIS+P+M G  NF+  I +IE+ILG+  EN  I   E + KE
Sbjct:  307 FSVYNGCVDRTAPDFLAFKSRFKLIWGSIFSFLEQIEKFLKDYAISEAKIKGKSLVSLLPEFELKNKLTRNDVLAVLENPVHIQMLLNLPGQRYKGQDGKAEAATKIQATWKSYKARSSFISYRQKKWASGVIALAWLLHCHRTRLKRIVKESRQRHLENFRIRAQHLAANWSRIRTSRRTIIHIPSLGYSQYVRKHIFDLDVEQNMQLGRLCDIIDANVNVIYICSHPMTDELKLYYRKLLSLQAAVKTGYYGDRTDLQNRFRIITPEAVNVFTKHHMCLATHLMYSPKAIKRIKNLIRGEEAYIVGGILHRDDLAVADMLNVPILGSEPELVHLYSAKSGSKRIFDNANVPMPPGIYDIYTYQQMIEQLSQLVTDNLGIRRWVFKMNTEFGGNGTAFCDIPSHLQCYNWVLKERNRFGHEDWKKKWAQESALVKISEELAGILAQHVQLVNEKRFPTWRKFLHMFLTQGGVIEAYPPADSVTNLTVDMLIEPDGEVRVLSMGDQLHADGPFISSGTTMPQTSVDPQVLNSLCLQIGNICKEKDVVGYFSIDLVTFIDPSTLEQQVWTTGLNLSYSDQLAMTQLTLYLTNGHLN-------------CSLSTLEVPRFT-EDSERERKRLSIQAE----LMCKAHGIGYDLEDRQGTVFILYESLKRYKLGMLTIGVDLQGVLMTFARNLFIIHQEISAPDMQGETNFKTTIDDIETILGVTEENKMIFVREKQSKE 1026          

HSP 2 Score: 95.5153 bits (236), Expect = 2.566e-19
Identity = 76/252 (30.16%), Postives = 133/252 (52.78%), Query Frame = 1
Query:   67 ENEAVIGNIVLRVHEDLNRLQEKL---KAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDN--SGQKRRISATLSINQEKLKQLQEIDL--NDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHE-KSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPA 798
            E+   IG+I+++VHEDL++L+EKL    A+ET++++++ +++  I  T+ GL+   ++ L  +N  V  +    +  S    + S    I+Q+      + D     + R + +     + P    K ++  K + +P NK +R      YGI LP I++ K+  K Q    + KGS +  L  LP  +++   +  P  + + DA KG+L++IERGLIPP A+ITF  PPI    +P+ S     +V + A
Sbjct:    6 EDSDPIGSILIQVHEDLHQLKEKLVKFSAEETRSTLDIQNLETAIQRTEMGLKIHIDKYLGVVNQEVLMAPVKKSLESPVTSKWSIPTVIDQKSFIFPMDSDFWRPQKHRGSLLHGLRRAKP----KIQLTTKVMQDPENKHHRAAVTASYGISLPHINQRKAQDKVQR---LIKGSTISNLTVLP-PSHRTDPHFIPIPVLQKDASKGVLSMIERGLIPPTARITFQNPPIKPQALPLHSFDEHRKVPMEA 249          
BLAST of IQ domain-containing protein H vs. Ensembl Mouse
Match: Iqch (IQ motif containing H [Source:MGI Symbol;Acc:MGI:1925500])

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 295/738 (39.97%), Postives = 459/738 (62.20%), Query Frame = 1
Query: 1228 FVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN--IINNESRVKE 3432
            F + +G +     DF+ FK  + LIWG I S +E +EKFLK Y+I  A + G  +  L  E+EL+ K +  ++L+ L N   +  LL  PG+R+ G + +  AA  IQ+ WK+Y AR  ++ YR+K+WA+GVIA+ W+LH   T +K  ++++R +HL NF++R + L + W+++ +SRR +IH+PS G ++  R  +  L   QN Q+ RLCD++D NV+VIYI   PM +E+  Y+ KLLSL++AV +G   D+  L +R++II PEA+  F  H+MCL++ L YSP+A+ RIKN+I+G  A+IV G++H DD+ + ++LNVPI+G+EPE++ L+ +KSG +++F+ ANV + PG   I +  Q+ E  +QL+ DNL I++W+FK N +    G  F DI  HL CYNW  KE+ R+G E WKKKWAQE+A  +I  E+  I+  ++ LV+ K + T  KF   F ++ G+IEAYP ++SVTN+TV+M I+P G++++   GDQ+H   P  + G ++PQ+S+D ++LN    +I   C++ D+ GYFSID VTF++ +   Q +W   ++  YSD  ++  L+++ T                   +   L V RF    S+     LS               I  +L ++QGT+F L +S  R  + M+TIG  L+  L +FA+NL+I+H+EIS+P+M G  NF+  I +IE+ILG+  EN  I   E + KE
Sbjct:  307 FSVYNGCVDRTAPDFLAFKSRFKLIWGSIFSFLEQIEKFLKDYAISEAKIKGKSLVSLLPEFELKNKLTRNDVLAVLENPVHIQMLLNLPGQRYKGQDGKAEAATKIQATWKSYKARSSFISYRQKKWASGVIALAWLLHCHRTRLKRIVKESRQRHLENFRIRAQHLAANWSRIRTSRRTIIHIPSLGYSQYVRKHIFDLDVEQNMQLGRLCDIIDANVNVIYICSHPMTDELKLYYRKLLSLQAAVKTGYYGDRTDLQNRFRIITPEAVNVFTKHHMCLATHLMYSPKAIKRIKNLIRGEEAYIVGGILHRDDLAVADMLNVPILGSEPELVHLYSAKSGSKRIFDNANVPMPPGIYDIYTYQQMIEQLSQLVTDNLGIRRWVFKMNTEFGGNGTAFCDIPSHLQCYNWVLKERNRFGHEDWKKKWAQESALVKISEELAGILAQHVQLVNEKRFPTWRKFLHMFLTQGGVIEAYPPADSVTNLTVDMLIEPDGEVRVLSMGDQLHADGPFISSGTTMPQTSVDPQVLNSLCLQIGNICKEKDVVGYFSIDLVTFIDPSTLEQQVWTTGLNLSYSDQLAMTQLTLYLTNGHLN-------------CSLSTLEVPRFTE-DSERERKRLS---------------IQAEL-DRQGTVFILYESLKRYKLGMLTIGVDLQGVLMTFARNLFIIHQEISAPDMQGETNFKTTIDDIETILGVTEENKMIFVREKQSKE 1014          

HSP 2 Score: 95.5153 bits (236), Expect = 2.821e-19
Identity = 76/252 (30.16%), Postives = 133/252 (52.78%), Query Frame = 1
Query:   67 ENEAVIGNIVLRVHEDLNRLQEKL---KAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDN--SGQKRRISATLSINQEKLKQLQEIDL--NDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHE-KSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPA 798
            E+   IG+I+++VHEDL++L+EKL    A+ET++++++ +++  I  T+ GL+   ++ L  +N  V  +    +  S    + S    I+Q+      + D     + R + +     + P    K ++  K + +P NK +R      YGI LP I++ K+  K Q    + KGS +  L  LP  +++   +  P  + + DA KG+L++IERGLIPP A+ITF  PPI    +P+ S     +V + A
Sbjct:    6 EDSDPIGSILIQVHEDLHQLKEKLVKFSAEETRSTLDIQNLETAIQRTEMGLKIHIDKYLGVVNQEVLMAPVKKSLESPVTSKWSIPTVIDQKSFIFPMDSDFWRPQKHRGSLLHGLRRAKP----KIQLTTKVMQDPENKHHRAAVTASYGISLPHINQRKAQDKVQR---LIKGSTISNLTVLP-PSHRTDPHFIPIPVLQKDASKGVLSMIERGLIPPTARITFQNPPIKPQALPLHSFDEHRKVPMEA 249          
BLAST of IQ domain-containing protein H vs. Ensembl Mouse
Match: Iqch (IQ motif containing H [Source:MGI Symbol;Acc:MGI:1925500])

HSP 1 Score: 407.527 bits (1046), Expect = 7.921e-126
Identity = 188/431 (43.62%), Postives = 288/431 (66.82%), Query Frame = 1
Query: 1228 FVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQE 2517
            F + +G +     DF+ FK  + LIWG I S +E +EKFLK Y+I  A + G  +  L  E+EL+ K +  ++L+ L N   +  LL  PG+R+ G + +  AA  IQ+ WK+Y AR  ++ YR+K+WA+GVIA+ W+LH   T +K  ++++R +HL NF++R + L + W+++ +SRR +IH+PS G ++  R  +  L   QN Q+ RLCD++D NV+VIYI   PM +E+  Y+ KLLSL++AV +G   D+  L +R++II PEA+  F  H+MCL++ L YSP+A+ RIKN+I+G  A+IV G++H DD+ + ++LNVPI+G+EPE++ L+ +KSG +++F+ ANV + PG   I +  Q+ E  +QL+ DNL I++W+FK N +    G  F DI  HL CYNW  KE+ R+G E WKKKWAQ+
Sbjct:  307 FSVYNGCVDRTAPDFLAFKSRFKLIWGSIFSFLEQIEKFLKDYAISEAKIKGKSLVSLLPEFELKNKLTRNDVLAVLENPVHIQMLLNLPGQRYKGQDGKAEAATKIQATWKSYKARSSFISYRQKKWASGVIALAWLLHCHRTRLKRIVKESRQRHLENFRIRAQHLAANWSRIRTSRRTIIHIPSLGYSQYVRKHIFDLDVEQNMQLGRLCDIIDANVNVIYICSHPMTDELKLYYRKLLSLQAAVKTGYYGDRTDLQNRFRIITPEAVNVFTKHHMCLATHLMYSPKAIKRIKNLIRGEEAYIVGGILHRDDLAVADMLNVPILGSEPELVHLYSAKSGSKRIFDNANVPMPPGIYDIYTYQQMIEQLSQLVTDNLGIRRWVFKMNTEFGGNGTAFCDIPSHLQCYNWVLKERNRFGHEDWKKKWAQD 737          

HSP 2 Score: 95.1301 bits (235), Expect = 2.865e-19
Identity = 75/254 (29.53%), Postives = 132/254 (51.97%), Query Frame = 1
Query:   67 ENEAVIGNIVLRVHEDLNRLQEKL---KAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDN--SGQKRRISATLSINQEKLKQLQEIDL--NDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQ---KGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPA 798
            E+   IG+I+++VHEDL++L+EKL    A+ET++++++ +++  I  T+ GL+   ++ L  +N  V  +    +  S    + S    I+Q+      + D     + R + +     + P    K ++  K + +P NK +R      YGI LP I+++        D +Q   KGS +  L  LP  +++   +  P  + + DA KG+L++IERGLIPP A+ITF  PPI    +P+ S     +V + A
Sbjct:    6 EDSDPIGSILIQVHEDLHQLKEKLVKFSAEETRSTLDIQNLETAIQRTEMGLKIHIDKYLGVVNQEVLMAPVKKSLESPVTSKWSIPTVIDQKSFIFPMDSDFWRPQKHRGSLLHGLRRAKP----KIQLTTKVMQDPENKHHRAAVTASYGISLPHINQRKA-----QDKVQRLIKGSTISNLTVLP-PSHRTDPHFIPIPVLQKDASKGVLSMIERGLIPPTARITFQNPPIKPQALPLHSFDEHRKVPMEA 249          

HSP 3 Score: 81.6481 bits (200), Expect = 4.322e-15
Identity = 39/86 (45.35%), Postives = 59/86 (68.60%), Query Frame = 1
Query: 3181 KEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN--IINNESRVKE 3432
            +++QGT+F L +S  R  + M+TIG  L+  L +FA+NL+I+H+EIS+P+M G  NF+  I +IE+ILG+  EN  I   E + KE
Sbjct:  736 QDRQGTVFILYESLKRYKLGMLTIGVDLQGVLMTFARNLFIIHQEISAPDMQGETNFKTTIDDIETILGVTEENKMIFVREKQSKE 821          
BLAST of IQ domain-containing protein H vs. UniProt
Match: sp|Q86VS3|IQCH_HUMAN (IQ domain-containing protein H OS=Homo sapiens OX=9606 GN=IQCH PE=2 SV=2)

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 406/1138 (35.68%), Postives = 630/1138 (55.36%), Query Frame = 1
Query:   67 ENEAVIGNIVLRVHEDLNRLQEKL---KAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATL---SINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLE--TNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKNVTKAYHTKPKETEDNNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKA------------QFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIENIINNE 3417
            EN   +G+I++++HEDL +L+EKL     +E   ++++  ++  I  T+ GL+   E+ LN +N  V ++S  D S    + S  L    I+Q+     QE         +E   W                                 +   LP +  ++ IK      + KGS +  L  LP    T+ ++    P  + + DA KG+L++IERGLIPP A+ITF                 +N  I P  A         +  DEA                  ++  V   +  +  P  P  +K         PK+     KS++S   R +HD+                              K M V    TP   L KS  D  + F+I DG++ +   DF+ FK H+ L WGGI S++E +EKFL+ Y+IP   + G+ +  L  E+EL  K +  +LLS L +   V  L+  PG+R+ G +    AA+ IQ+ WK Y ARKF+L YR+++WA+GVIAI W+L+   T +K+ L+++R +HL NF++R K L + W ++ +SRR +IH+PS G ++  R  +      QN Q+ RLCD++D NV+VIYI    MN+E++ Y+ K+LSL +AV SGN  D+  L  R+KII PEA+  FP H+MCL++ L YSP+A+ RIKN+I+G  A+IV G++H DD+ + ++L++PI+G+EPE+  L+ +KSG +++F+ ANV + PG   I S  Q+ E  +QLI D+L I++W+FK + + +  G  F DI  +L CY W  KE  RYG E W+KKWAQE A  +I  E+  I+  +   V+ K + T  KF + F S+ G+IEA+P +++VTN+TV+M I+P GKI +  +GDQ+H  +P  + G +VPQ+S+D ++L     +I + CR  D+ GYFSID VTF++ +   Q +WA  ++  YSD  +L  L+++ T              +F P +      M  +S  P+L+ +R+  +++Q+ HSNLSLV + VF Q+CRAHGIG+D++E+QGT+F L +   R  + M+TIG  L+  L +FA++L+I+H+EIS+PNM G  NF+  I +IE+IL +  EN +  E
Sbjct:    6 ENHDPVGSILIQIHEDLYQLKEKLTKFSPEEKGETLDIQSLETAIKRTEVGLRIHIEKYLNVVNQNVLTTSVNDESLYTPQASKWLLPTVIDQKSFIFPQE---------SEGTFWQ----------------------------PQRQHSSSLP-VFPRAKIKVSK---LIKGSNISSLTVLPSSHCTDPYFT---PIPVLQADAHKGILSMIERGLIPPTARITF-----------------QNPPITPRAA-------PLHSFDEAR-----------------KIPTVATFTIPREPPPSPAEVKFF-------PKKQRSKGKSRRS---RGHHDR------------------------------KAMKV---KTPLRAL-KSLWD--YDFLIYDGVIDNTAPDFLAFKEHFSLAWGGIFSLLEHVEKFLRNYAIPEVKIKGNNLVALLPEFELTNKLTRYDLLSVLEDPAHVQMLINLPGQRYKGQDGNSEAAMKIQATWKCYKARKFFLFYRQQKWASGVIAIAWLLYCHKTRLKKILKESRQRHLENFRIRAKHLAANWNRIRTSRRTIIHIPSLGYSQPVREHIADFNTQQNMQLGRLCDILDANVNVIYICSHHMNDELVLYYKKILSLHAAVKSGNLEDRSDLQDRFKIITPEAVNIFPKHHMCLATHLMYSPKAIKRIKNLIRGTEAYIVSGLLHRDDLAVADMLDIPILGSEPELAHLYSTKSGGKRVFDSANVAVPPGIYDIYSQQQMIEQLSQLITDHLQIQRWLFKMDSEFRGNGTAFCDIPSYLKCYKWVLKESSRYGLEDWRKKWAQEPALVKISEELAGILAQHAQPVNEKRFPTWRKFLQTFLSQGGVIEAFPPADNVTNLTVDMLIEPNGKISVLSTGDQLHAESPFISSGTTVPQTSVDPQVLTYLCLQIGKACRMRDVVGYFSIDLVTFIDPSTLEQQVWATGLNLAYSDQLALTQLTLYLTNGHLDCSLSTLEVPRFVPKERKKTKCMSALSM-PMLATSRYAVMTTQLRHSNLSLVFHYVFLQICRAHGIGYDVEERQGTVFILYEHLKRHKLGMLTIGEDLQGVLMTFARHLFIIHQEISAPNMQGETNFKTTIADIETILRVTKENKMRFE 1011          
BLAST of IQ domain-containing protein H vs. UniProt
Match: sp|Q9D2K4|IQCH_MOUSE (IQ domain-containing protein H OS=Mus musculus OX=10090 GN=Iqch PE=2 SV=3)

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 317/769 (41.22%), Postives = 493/769 (64.11%), Query Frame = 1
Query: 1180 TPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVS---------------TAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN--IINNESRVKE 3432
            TP S+  KS  D  + F + +G +     DF+ FK  + LIWG I S +E +EKFLK Y+I  A + G  +  L  E+EL+ K +  ++L+ L N   +  LL  PG+R+ G + +  AA  IQ+ WK+Y AR  ++ YR+K+WA+GVIA+ W+LH   T +K  ++++R +HL NF++R + L + W+++ +SRR +IH+PS G ++  R  +  L   QN Q+ RLCD++D NV+VIYI   PM +E+  Y+ KLLSL++AV +G   D+  L +R++II PEA+  F  H+MCL++ L YSP+A+ RIKN+I+G  A+IV G++H DD+ + ++LNVPI+G+EPE++ L+ +KSG +++F+ ANV + PG   I +  Q+ E  +QL+ DNL I++W+FK N +    G  F DI  HL CYNW  KE+ R+G E WKKKWAQE+A  +I  E+  I+  ++ LV+ K + T  KF   F ++ G+IEAYP ++SVTN+TV+M I+P G++++   GDQ+H   P  + G ++PQ+S+D ++LN    +I   C++ D+ GYFSID VTF++ +   Q +W   ++  YSD  ++  L+++ T      +  L   ++P  +                AP    +R+  +S+Q+ H NLSL+ Y VF QMC+AHGIG+DL+++QGT+F L +S  R  + M+TIG  L+  L +FA+NL+I+H+EIS+P+M G  NF+  I +IE+ILG+  EN  I   E + KE
Sbjct:  294 TP-SKTRKSPWD--YIFSVYNGCVDRTAPDFLAFKSRFKLIWGSIFSFLEQIEKFLKDYAISEAKIKGKSLVSLLPEFELKNKLTRNDVLAVLENPVHIQMLLNLPGQRYKGQDGKAEAATKIQATWKSYKARSSFISYRQKKWASGVIALAWLLHCHRTRLKRIVKESRQRHLENFRIRAQHLAANWSRIRTSRRTIIHIPSLGYSQYVRKHIFDLDVEQNMQLGRLCDIIDANVNVIYICSHPMTDELKLYYRKLLSLQAAVKTGYYGDRTDLQNRFRIITPEAVNVFTKHHMCLATHLMYSPKAIKRIKNLIRGEEAYIVGGILHRDDLAVADMLNVPILGSEPELVHLYSAKSGSKRIFDNANVPMPPGIYDIYTYQQMIEQLSQLVTDNLGIRRWVFKMNTEFGGNGTAFCDIPSHLQCYNWVLKERNRFGHEDWKKKWAQESALVKISEELAGILAQHVQLVNEKRFPTWRKFLHMFLTQGGVIEAYPPADSVTNLTVDMLIEPDGEVRVLSMGDQLHADGPFISSGTTMPQTSVDPQVLNSLCLQIGNICKEKDVVGYFSIDLVTFIDPSTLEQQVWTTGLNLSYSDQLAMTQLTLYLTNGHL--NCSLSTLEVPRFTEDSERERKRLSIQAELAP--ETSRYAVMSTQLKHDNLSLIFYYVFLQMCKAHGIGYDLEDRQGTVFILYESLKRYKLGMLTIGVDLQGVLMTFARNLFIIHQEISAPDMQGETNFKTTIDDIETILGVTEENKMIFVREKQSKE 1055          

HSP 2 Score: 95.9005 bits (237), Expect = 1.451e-18
Identity = 76/252 (30.16%), Postives = 133/252 (52.78%), Query Frame = 1
Query:   67 ENEAVIGNIVLRVHEDLNRLQEKL---KAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDN--SGQKRRISATLSINQEKLKQLQEIDL--NDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHE-KSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPA 798
            E+   IG+I+++VHEDL++L+EKL    A+ET++++++ +++  I  T+ GL+   ++ L  +N  V  +    +  S    + S    I+Q+      + D     + R + +     + P    K ++  K + +P NK +R      YGI LP I++ K+  K Q    + KGS +  L  LP  +++   +  P  + + DA KG+L++IERGLIPP A+ITF  PPI    +P+ S     +V + A
Sbjct:    6 EDSDPIGSILIQVHEDLHQLKEKLVKFSAEETRSTLDIQNLETAIQRTEMGLKIHIDKYLGVVNQEVLMAPVKKSLESPVTSKWSIPTVIDQKSFIFPMDSDFWRPQKHRGSLLHGLRRAKP----KIQLTTKVMQDPENKHHRAAVTASYGISLPHINQRKAQDKVQR---LIKGSTISNLTVLP-PSHRTDPHFIPIPVLQKDASKGVLSMIERGLIPPTARITFQNPPIKPQALPLHSFDEHRKVPMEA 249          
BLAST of IQ domain-containing protein H vs. UniProt
Match: sp|Q1LXZ7|IQCH_DANRE (IQ motif-containing protein H OS=Danio rerio OX=7955 GN=iqch PE=4 SV=1)

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 283/763 (37.09%), Postives = 476/763 (62.39%), Query Frame = 1
Query: 1138 NDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSE------EELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNS-RYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRY-GEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            N  +T+ +    P  P S L    + + + F I DG +     DF ++K+ YCL WG +V  +E L++ L  +++PLA V G+R+A      EL  +         E+LLS L N  +V DL+ +PG+R+ G      AA+ IQ+ W+ Y AR  YL   R +WAA +IA+  +   K+ H+K+ LQ +R++ L NF  R + L + W  + S++R +IH+PS G ++  R  L+    LQN QM RLCD+ D NV+VIY+SPV + E++LQY+++LL L++A++ G+ S  +  ++ R+ I++PEA++ F   N+CL+S+LKYSPR L RIKN+IKG+ A+++ G+ HTDD+ + + L +P++GT+P +  L+ +KSG +++F  A V++ PG+  I ++ +L+E   QL+  ++ +++W+FK + ++  +G  ++D+  HL    WAQ+E  R+  ++W+   +Q++   + L EVP ++     L +   Y T + F + F  + G+IEA+P S+S+T + V++ ++P G + M   GDQ+   + L   G +VPQ+SI  E+L+    ++ + C+Q  I G+ S+D VTF++ N   Q +WA+D+D  YS+  ++  L +  T+         L  ++P   T+     +RF  + +++ H+NL LV+YS FF MC+A GIG+D+K +QGT+F+L DS  R ++ M+TI  +L+ AL +FA+NL I+H+EIS+PNM G  NF+ +IK+IE +LG+ I+N
Sbjct:  267 NRVLTRGLARLSPINPQS-LPVPAVVSKYPFTIVDGQIDPDAADFCRYKKQYCLYWGAMVEALERLQRMLLDFAVPLARVCGERLAACVQSGELNWRDGRGRCTHVEKLLSVLENRDEVWDLMCQPGQRYKGNGGHQAAAVRIQTCWRRYSARTAYLIRLRSKWAAEIIAMSLLKRAKLCHLKKSLQASRLRQLENFHSRAESLATNWKHITSAKRTIIHVPSLGYSQPRRLSLRGYDVLQNTQMGRLCDIRDENVEVIYVSPVRLGEDVLQYYTRLLGLQTAIELGDASATESHSAKRFTILMPEALEDFSTRNLCLASLLKYSPRTLKRIKNLIKGKQAYMISGVTHTDDLAVADELQIPLLGTDPVVTQLYSTKSGGKRIFSSAGVDMPPGKWDIYTLEKLYEGLAQLMAKHMEVQRWLFKIDSEVGGRGTAYVDV-CHLKSRPWAQQEFIRHEPQQWRTSQSQDSVMIKFLEEVPHLLASYARLANTSCYKTWACFLEHFLKEGGVIEAFPPSQSLTCLAVDLLLEPGGDVLMLSCGDQLRGPSGLEVLGCTVPQTSICPEVLHSVCTRVGQACQQRSIMGHISLDLVTFLDPNNLEQQVWAIDLDLGYSNQLAMTQLMLMMTRGTLNCRTSKL--EVPPSETS---VTSRFAVMCTRLLHTNLPLVYYSTFFLMCKAQGIGYDVKARQGTVFALHDSRYRRSLGMLTISENLQGALLTFARNLSIIHQEISAPNMQGASNFKELIKDIEEVLGMTIQN 1022          

HSP 2 Score: 54.299 bits (129), Expect = 8.468e-6
Identity = 43/165 (26.06%), Postives = 85/165 (51.52%), Query Frame = 1
Query:   61 LMENEAVIGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDL---ISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQ 546
            +++N+  +GNI+++V +DL +L++ +     Q +  + DI+ L   I  T+ G+++ AE+ L  +N++V +  +I+   +K+     L   Q   + L          ++ I      SPGE  K    ++ L NP +  N+    + YGIQLP + ++++I  Q
Sbjct:    4 VLKNKDEVGNILVKVQDDLRQLKKNIVQFTVQENGEILDIQALDAAIIRTENGIRRHAEDYLKTINNQVLTLPSIEEP-EKKTAHPKLVTWQPPYEALP----IAHPHRSPI---PGPSPGEKHKTAFIMRLLHNPFHPRNKEIFQQNYGIQLPHLQKRTSIGIQ 160          
BLAST of IQ domain-containing protein H vs. TrEMBL
Match: gnl|BL_ORD_ID|23908588 (tr|K1PF58|K1PF58_CRAGI IQ domain-containing protein H OS=Crassostrea gigas OX=29159 GN=CGI_10006527 PE=4 SV=1)

HSP 1 Score: 921.383 bits (2380), Expect = 0.000e+0
Identity = 472/1149 (41.08%), Postives = 703/1149 (61.18%), Query Frame = 1
Query:   82 IGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTS-----SSTIDN---------------SGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKNVTKAYHTKPKETEDNNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPAS----QLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLL-IADMPTVSTA-----------PILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIENIINNES 3420
            +G I+L+V +D+  L+E++ A     +I++ D++  +  T+ GLQ + E+++N  N++V +     +S  DN               S   R+ISA + + +E+++Q Q    N    + + +     +PG+  K  + L+++ +P + MNR   N  +GIQLPLI+ K T K   S  I  GS ++ L  LP + N+      P  ITE DARKG+++LIERGLIPP A++T DP P+ N   P+    +++R         +  SL                         V+L+      +   +P +P   K+ + +       TE    S K+ +  +         S++ ++    ++  E+P            +PPPTTPAS    QLS       H+F I++G  R  + +FI FK+HYCL WG IV++I+ +EK L  Y++P+AFVNGDR+ADL++E+ELE  P+E++LL+ +IN  DV  L+ RPGRRF G   +D AA  IQS W+ +  R  YLEYRR++WA+GVIAI WI+H+KM+ VK +L+ +R +HL NF+ R ++L   W ++   RR VIH+PS GL++  R  + +    QN QM RLCD+ D NVDVI++SPVP++EE LQY+SKLL LKSAV+SG   DQ  +  +YKIIVPEAIKSFP H MCLS++LKYSPR L RIK++IKG +A+IV G+ H DD+ + + L+VPI+  EPE+  L+ +KSG +++F  A VE+ P E  + S+ QLHE   QL+ +NL +K+W+FK +     +GIG+ DI  HL CY WA KE +RYGEKW KKWAQE AY +I  E+ D++      V  +LY   SKF   F S+ G+IEA P S+S+T++TV+M I+PTG+  +   GDQIH   P + WG S+PQSS++ ++LN    K+AE C+   I GY S+DFVTF+++   +Q +WA+D+   YSD  ++  L  + +  +     H   +   P V              P  + +R+  +S+++ H+NL++VHYSVFFQMCRAHGIG+D+KEKQGT+F+L+DSFNRE++ M+TIG +L+ AL +FA+N+ ++H+EIS+PNM G  NF+L I +IESILG  +EN  + E+
Sbjct:   11 VGQILLKVQDDIRVLREQI-ANNKGGTISIQDLESALVKTEEGLQAKTEQVINQYNNQVRTLPNQEASRFDNNVVAIETTWDMRNQKSADPRKISAHI-LGRERMRQPQASRNNALLPKRQSVQMPGPTPGQQTKHMLTLRAVLDPQSNMNRQTLNANFGIQLPLINSKQTSKPAYSKPI-IGSTIEPLAVLP-KANRVDAQLAPPPITEEDARKGIMSLIERGLIPPAAQLTLDPSPVRNRIAPLHEPQVRHR-----PPQTEAVSLL----------------------SGVKLDPATMKHDASKMPAVPPHPKSASSSI------TETRTPSAKTRVTSS---------SLRQVKTPATLKTYEMPI---------QPLPPPTTPASGDFKQLS-------HRFAIQNGRTRDSSSEFIAFKQHYCLTWGSIVTMIKHIEKMLTSYAVPVAFVNGDRLADLAMEFELERPPTEDDLLTVIINREDVEALIGRPGRRFKGPRGKDLAATRIQSSWRMFKDRSEYLEYRRRKWASGVIAISWIMHVKMSKVKVKLKVSREEHLENFRRRARKLAMSWDRIKQHRRTVIHIPSLGLSQDIRDSINEFGIRQNTQMARLCDIRDPNVDVIFVSPVPLSEETLQYYSKLLGLKSAVESGVVEDQCDMGEKYKIIVPEAIKSFPAHRMCLSTLLKYSPRTLKRIKHLIKGCDAYIVTGVPHKDDLSVADYLDVPILSPEPEVAHLYSTKSGCKRVFASAGVEVPPSEFDVYSIGQLHECLAQLVTENLTVKRWLFKLDDCYDGRGIGYCDIAEHLECYQWALKESRRYGEKWNKKWAQEAAYIKIHAEIADVLAKYARPVHEELYEDWSKFLDAFLSQGGVIEATPPSDSITSLTVDMLIEPTGRANVLCMGDQIHAETPFSCWGVSMPQSSVEPDVLNAVCKKVAEACKSRGIIGYLSVDFVTFIDSKTNDQKLWALDLSLHYSDSLAMFQLMSYVSNGKLDLSTHTFNVPPPPQVQKKRRRRLAGQDDEPPPNTSRYAVMSTRLLHTNLAVVHYSVFFQMCRAHGIGYDIKEKQGTVFTLLDSFNREHLGMLTIGDNLQGALATFARNMSVIHQEISAPNMQGETNFKLAITDIESILGTTVENAEDTEA 1097          
BLAST of IQ domain-containing protein H vs. TrEMBL
Match: gnl|BL_ORD_ID|20345266 (tr|A0A1S3K594|A0A1S3K594_LINUN IQ domain-containing protein H-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106178692 PE=4 SV=1)

HSP 1 Score: 912.138 bits (2356), Expect = 0.000e+0
Identity = 466/1143 (40.77%), Postives = 698/1143 (61.07%), Query Frame = 1
Query:   82 IGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEK--LKQLQEIDLNDE-----------------ARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKN-RVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKNVTKAYHTKPKETEDNNKS-----KKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPIL-----------SVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            +G I+++V EDL++L+ KL  +    +I++  +++ I+ T+  L+ R+E+++  +N + ++  +++   Q+R  S T  + +    L++  EI                       R+T       ++PG+ +K+  +++   NPHN  NR    + +G+QLP + ++ +  T +S  I KG+ V+ L  LP + N+      P  I+E DA+ G+L+LIERGLIPP A++T DP P+++   P+     K+     P+  +D  ++LA   LD                         N  + +  +  +   ++     +    K TE  +K+     K  + L+   ++P     I  +                  VT    VPPPTTPAS   K+   + ++F ++ G +R    DF+ FK+HYCL WG IVS+ + LE+ L +Y++P+AF++GDR+ADLS+EYEL+ +P+ ++LLS +IN  DV  +LKRPGRR++G + E  AA  IQ+ WK +  R+ YLEYRR +WA+GVIAI W++++KM+ V+++L++TRI  L  F+ R K L ++W ++  S+RV+IH+PS G  +  R  +K     QN QM RLCDL D NVDVIYISPVP+N+E +QY++KLL LKSA+DSG+   Q  +  RYKIIVPEAIKSFP H MCL++ LKYSPRAL RIKN+I+GR+A+IVPGM H DD+ +  +LN+P++ TEPEI  L+ SKSG +++F+ ANV I P E  + S+ QLHES  QL+ DNL +K W+ K + +   +GI + ++  +L  + WA KE KRYG+KW KKWAQE  + +I  E+PDI+E     VD K+Y T   F   F +K GIIEA P +E +T +T +M ++P GKI +   GDQIH   P   WG SVPQSS++   LN+   +IAE C+   + GYF+IDFVTF++   ++Q++WAVD+   YSD  ++ NL  F    +   + H+     P                   + NRF  +S+Q+ HSNL++VHYSVFFQMCRAHGIGFD+KEKQG+IF+LIDSFNREN+ MIT+G +L+  L +FA+NL ++H+EIS+PNM G  NF+ VI++IESILG  + N
Sbjct:   14 VGQILVKVQEDLHQLKHKLLTQAQNGTIDLTALENAINKTEHDLKVRSEQVVGEINQQFSTLPSLEAQLQQREQSYTGPVVESTWDLQRGDEIRRPGSRTLIETRGMDTQPVLTLGRKTPRYQLTGATPGQKLKQVWSMRVAQNPHNPQNRTVMQDNFGVQLPQLEDRKS-ATPSSAKIVKGNTVEHLTVLP-KANRVDPQLIPPAISEDDAKHGILSLIERGLIPPAAELTLDPSPVHHRMAPLHDPMEKSGEKAKPSPMSDGSFNLASIKLD------------------------TNFKATESTVSSVVRGIRPSPPTHGKHRKGTEQPSKTPVMAKKFEMPLQPMPERPATNAVIMEL-------------LEQTAVTPIGQVPPPTTPASGDFKA---SNYRFAMQHGKVRDTAPDFLAFKQHYCLSWGAIVSMFKHLERMLTEYAVPVAFIHGDRLADLSLEYELDSQPTLDDLLSVIINKEDVESILKRPGRRYLGPDGEFAAATKIQATWKRFRDRRKYLEYRRLKWASGVIAITWVMNVKMSQVRKQLKRTRIAELEGFRKRAKLLSTQWNRMKHSKRVIIHVPSLGYNQPIRDSIKDFGIRQNAQMGRLCDLKDPNVDVIYISPVPVNDETVQYYTKLLGLKSAIDSGDVDKQGDMTDRYKIIVPEAIKSFPTHRMCLATHLKYSPRALRRIKNLIRGRDAYIVPGMPHKDDLSVAHILNIPLLCTEPEIAHLYTSKSGAKRIFQSANVAIPPSEFDVYSLPQLHESLAQLVTDNLEVKTWVLKIDDEFDGRGIAYCNVTTYLESHQWALKEAKRYGDKWSKKWAQEQVFMKIQSEIPDILEHWCFPVDSKVYPTWPAFLDAFLAKGGIIEARPPAEDITALTADMLLEPNGKISIVSLGDQIHAETPYKCWGLSVPQSSVEPAQLNDACMRIAEACKARGVVGYFTIDFVTFIDPKTDDQVLWAVDLSLSYSDSTTMNNLLQFVAGGKLDINTHIYNIPPPKKEPKKRRPKGREEEEVPPNTNRFAVMSTQLVHSNLAVVHYSVFFQMCRAHGIGFDIKEKQGSIFTLIDSFNRENLGMITVGDNLQGTLGAFARNLSVIHQEISAPNMQGESNFKAVIQDIESILGTTVLN 1114          
BLAST of IQ domain-containing protein H vs. TrEMBL
Match: gnl|BL_ORD_ID|20313952 (tr|A0A1S3I7P2|A0A1S3I7P2_LINUN IQ domain-containing protein H isoform X2 OS=Lingula unguis OX=7574 GN=LOC106161084 PE=4 SV=1)

HSP 1 Score: 911.368 bits (2354), Expect = 0.000e+0
Identity = 469/1142 (41.07%), Postives = 699/1142 (61.21%), Query Frame = 1
Query:   82 IGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSI-----------------------NQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKN-RVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKNVTKAYHTKPKETEDNNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPIL-----------SVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            +G I+++V EDL++L+ KL  +    +I++  +++ I+ T+  L+ R+E+++  +N + ++  +++   Q+R  S T  +                         E L+ +    +    R+T       ++PG+ +K+  +++   NPHN  NR    + +G+QLP + ++ +  T +S  I KG+ V+ L  LP + N+      P  I+E DA+ G+L+LIERGLIPP A++T DP P+++   P+     K+     P+  +D  ++LA   LD       +F   ++     V            + P  P   K+   A   +P +T    K K  + L+   ++P     I  +                  VT    VPPPTTPAS   K+   + ++F ++ G +R    DF+ FK+HYCL WG IVS+ + LE+ L +Y++P+AF++GDR+ADLS+EYEL+ +P+ ++LLS +IN  DV  +LKRPGRR++G + E  AA  IQ+ WK +  R+ YLEYRR +WA+GVIAI W++++KM+ V+++L++TRI  L  F+ R K L ++W ++  S+RV+IH+PS G  +  R  +K     QN QM RLCDL D NVDVIYISPVP+N+E +QY++KLL LKSA+DSG+   Q  +  RYKIIVPEAIKSFP H MCL++ LKYSPRAL RIKN+I+GR+A+IVPGM H DD+ +  +LN+P++ TEPEI  L+ SKSG +++F+ ANV I P E  + S+ QLHES  QL+ DNL +K W+ K + +   +GI + ++  +L  + WA KE KRYG+KW KKWAQE  + +I  E+PDI+E     VD K+Y T   F   F +K GIIEA P +E +T +T +M ++P GKI +   GDQIH   P   WG SVPQSS++   LN+   +IAE C+   + GYF+IDFVTF++   ++Q++WAVD+   YSD  ++ NL  F    +   + H+     P                   + NRF  +S+Q+ HSNL++VHYSVFFQMCRAHGIGFD+KEKQG+IF+LIDSFNREN+ MIT+G +L+  L +FA+NL ++H+EIS+PNM G  NF+ VI++IESILG  + N
Sbjct:   14 VGQILVKVQEDLHQLKHKLLTQAQNGTIDLTALENAINKTEHDLKVRSEQVVGEINQQFSTLPSLEAQLQQREQSYTGPVVESTWDLQRGDEIRRPGSRTLIETSELLRGMDTQPVLTLGRKTPRYQLTGATPGQKLKQVWSMRVAQNPHNPQNRTVMQDNFGVQLPQLEDRKS-ATPSSAKIVKGNTVEHLTVLP-KANRVDPQLIPPAISEDDAKHGILSLIERGLIPPAAELTLDPSPVHHRMAPLHDPMEKSGEKAKPSPMSDGSFNLASIKLD------TNFKATESTVSSVVR----------GIRPSPPTHGKHRKGA--EQPSKTPVMAK-KFEMPLQPMPERPATNAVIMEL-------------LEQTAVTPIGQVPPPTTPASGDFKA---SNYRFAMQHGKVRDTAPDFLAFKQHYCLSWGAIVSMFKHLERMLTEYAVPVAFIHGDRLADLSLEYELDSQPTLDDLLSVIINKEDVESILKRPGRRYLGPDGEFAAATKIQATWKRFRDRRKYLEYRRLKWASGVIAITWVMNVKMSQVRKQLKRTRIAELEGFRKRAKLLSTQWNRMKHSKRVIIHVPSLGYNQPIRDSIKDFGIRQNAQMGRLCDLKDPNVDVIYISPVPVNDETVQYYTKLLGLKSAIDSGDVDKQGDMTDRYKIIVPEAIKSFPTHRMCLATHLKYSPRALRRIKNLIRGRDAYIVPGMPHKDDLSVAHILNIPLLCTEPEIAHLYTSKSGAKRIFQSANVAIPPSEFDVYSLPQLHESLAQLVTDNLEVKTWVLKIDDEFDGRGIAYCNVTTYLESHQWALKEAKRYGDKWSKKWAQEQVFMKIQSEIPDILEHWCFPVDSKVYPTWPAFLDAFLAKGGIIEARPPAEDITALTADMLLEPNGKISIVSLGDQIHAETPYKCWGLSVPQSSVEPAQLNDACMRIAEACKARGVVGYFTIDFVTFIDPKTDDQVLWAVDLSLSYSDSTTMNNLLQFVAGGKLDINTHIYNIPPPKKEPKKRRPKGREEEEVPPNTNRFAVMSTQLVHSNLAVVHYSVFFQMCRAHGIGFDIKEKQGSIFTLIDSFNRENLGMITVGDNLQGTLGAFARNLSVIHQEISAPNMQGESNFKAVIQDIESILGTTVLN 1118          
BLAST of IQ domain-containing protein H vs. TrEMBL
Match: gnl|BL_ORD_ID|20311708 (tr|A0A1S3I548|A0A1S3I548_LINUN IQ domain-containing protein H isoform X3 OS=Lingula unguis OX=7574 GN=LOC106161084 PE=4 SV=1)

HSP 1 Score: 910.598 bits (2352), Expect = 0.000e+0
Identity = 470/1138 (41.30%), Postives = 700/1138 (61.51%), Query Frame = 1
Query:   82 IGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEK--LKQLQEIDLNDE-----------------ARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKN-RVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKNVTKAYHTKPKETEDNNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPIL-----------SVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            +G I+++V EDL++L+ KL  +    +I++  +++ I+ T+  L+ R+E+++  +N + ++  +++   Q+R  S T  + +    L++  EI                       R+T       ++PG+ +K+  +++   NPHN  NR    + +G+QLP + ++ +  T +S  I KG+ V+ L  LP + N+      P  I+E DA+ G+L+LIERGLIPP A++T DP P+++   P+     K+     P+  +D  ++LA   LD       +F   ++     V            + P  P   K+   A   +P +T    K K  + L+   ++P     I  +                  VT    VPPPTTPAS   K+   + ++F ++ G +R    DF+ FK+HYCL WG IVS+ + LE+ L +Y++P+AF++GDR+ADLS+EYEL+ +P+ ++LLS +IN  DV  +LKRPGRR++G + E  AA  IQ+ WK +  R+ YLEYRR +WA+GVIAI W++++KM+ V+++L++TRI  L  F+ R K L ++W ++  S+RV+IH+PS G  +  R  +K     QN QM RLCDL D NVDVIYISPVP+N+E +QY++KLL LKSA+DSG+   Q  +  RYKIIVPEAIKSFP H MCL++ LKYSPRAL RIKN+I+GR+A+IVPGM H DD+ +  +LN+P++ TEPEI  L+ SKSG +++F+ ANV I P E  + S+ QLHES  QL+ DNL +K W+ K + +   +GI + ++  +L  + WA KE KRYG+KW KKWAQE  + +I  E+PDI+E     VD K+Y T   F   F +K GIIEA P +E +T +T +M ++P GKI +   GDQIH   P   WG SVPQSS++   LN+   +IAE C+   + GYF+IDFVTF++   ++Q++WAVD+   YSD  ++ NL  F    +   + H+     P                   + NRF  +S+Q+ HSNL++VHYSVFFQMCRAHGIGFD+KEKQG+IF+LIDSFNREN+ MIT+G +L+  L +FA+NL ++H+EIS+PNM G  NF+ VI++IESILG  + N
Sbjct:   14 VGQILVKVQEDLHQLKHKLLTQAQNGTIDLTALENAINKTEHDLKVRSEQVVGEINQQFSTLPSLEAQLQQREQSYTGPVVESTWDLQRGDEIRRPGSRTLIETRGMDTQPVLTLGRKTPRYQLTGATPGQKLKQVWSMRVAQNPHNPQNRTVMQDNFGVQLPQLEDRKS-ATPSSAKIVKGNTVEHLTVLP-KANRVDPQLIPPAISEDDAKHGILSLIERGLIPPAAELTLDPSPVHHRMAPLHDPMEKSGEKAKPSPMSDGSFNLASIKLD------TNFKATESTVSSVVR----------GIRPSPPTHGKHRKGA--EQPSKTPVMAK-KFEMPLQPMPERPATNAVIMEL-------------LEQTAVTPIGQVPPPTTPASGDFKA---SNYRFAMQHGKVRDTAPDFLAFKQHYCLSWGAIVSMFKHLERMLTEYAVPVAFIHGDRLADLSLEYELDSQPTLDDLLSVIINKEDVESILKRPGRRYLGPDGEFAAATKIQATWKRFRDRRKYLEYRRLKWASGVIAITWVMNVKMSQVRKQLKRTRIAELEGFRKRAKLLSTQWNRMKHSKRVIIHVPSLGYNQPIRDSIKDFGIRQNAQMGRLCDLKDPNVDVIYISPVPVNDETVQYYTKLLGLKSAIDSGDVDKQGDMTDRYKIIVPEAIKSFPTHRMCLATHLKYSPRALRRIKNLIRGRDAYIVPGMPHKDDLSVAHILNIPLLCTEPEIAHLYTSKSGAKRIFQSANVAIPPSEFDVYSLPQLHESLAQLVTDNLEVKTWVLKIDDEFDGRGIAYCNVTTYLESHQWALKEAKRYGDKWSKKWAQEQVFMKIQSEIPDILEHWCFPVDSKVYPTWPAFLDAFLAKGGIIEARPPAEDITALTADMLLEPNGKISIVSLGDQIHAETPYKCWGLSVPQSSVEPAQLNDACMRIAEACKARGVVGYFTIDFVTFIDPKTDDQVLWAVDLSLSYSDSTTMNNLLQFVAGGKLDINTHIYNIPPPKKEPKKRRPKGREEEEVPPNTNRFAVMSTQLVHSNLAVVHYSVFFQMCRAHGIGFDIKEKQGSIFTLIDSFNRENLGMITVGDNLQGTLGAFARNLSVIHQEISAPNMQGESNFKAVIQDIESILGTTVLN 1114          
BLAST of IQ domain-containing protein H vs. TrEMBL
Match: gnl|BL_ORD_ID|20350637 (tr|A0A1S3I594|A0A1S3I594_LINUN IQ domain-containing protein H isoform X1 OS=Lingula unguis OX=7574 GN=LOC106161084 PE=4 SV=1)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 470/1154 (40.73%), Postives = 705/1154 (61.09%), Query Frame = 1
Query:   82 IGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQ---------TEILTW--------------------------NYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKN-RVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKNVTKAYHTKPKETEDNNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPIL-----------SVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            +G I+++V EDL++L+ KL  +    +I++  +++ I+ T+  L+ R+E+++  +N + ++  +++   Q+R  S T  +    ++   ++   DE R+         +E+L++                            ++PG+ +K+  +++   NPHN  NR    + +G+QLP + ++ +  T +S  I KG+ V+ L  LP + N+      P  I+E DA+ G+L+LIERGLIPP A++T DP P+++   P+     K+     P+  +D  ++LA   LD       +F   ++     V            + P  P   K+   A   +P +T    K K  + L+   ++P     I  +                  VT    VPPPTTPAS   K+   + ++F ++ G +R    DF+ FK+HYCL WG IVS+ + LE+ L +Y++P+AF++GDR+ADLS+EYEL+ +P+ ++LLS +IN  DV  +LKRPGRR++G + E  AA  IQ+ WK +  R+ YLEYRR +WA+GVIAI W++++KM+ V+++L++TRI  L  F+ R K L ++W ++  S+RV+IH+PS G  +  R  +K     QN QM RLCDL D NVDVIYISPVP+N+E +QY++KLL LKSA+DSG+   Q  +  RYKIIVPEAIKSFP H MCL++ LKYSPRAL RIKN+I+GR+A+IVPGM H DD+ +  +LN+P++ TEPEI  L+ SKSG +++F+ ANV I P E  + S+ QLHES  QL+ DNL +K W+ K + +   +GI + ++  +L  + WA KE KRYG+KW KKWAQE  + +I  E+PDI+E     VD K+Y T   F   F +K GIIEA P +E +T +T +M ++P GKI +   GDQIH   P   WG SVPQSS++   LN+   +IAE C+   + GYF+IDFVTF++   ++Q++WAVD+   YSD  ++ NL  F    +   + H+     P                   + NRF  +S+Q+ HSNL++VHYSVFFQMCRAHGIGFD+KEKQG+IF+LIDSFNREN+ MIT+G +L+  L +FA+NL ++H+EIS+PNM G  NF+ VI++IESILG  + N
Sbjct:   14 VGQILVKVQEDLHQLKHKLLTQAQNGTIDLTALENAINKTEHDLKVRSEQVVGEINQQFSTLPSLEAQLQQREQSYTGPV----VESTWDLQRGDEIRRPGSRTLIETSELLSFPLLPIHGGMDTQPVLTLGRKTPRYQLTGATPGQKLKQVWSMRVAQNPHNPQNRTVMQDNFGVQLPQLEDRKS-ATPSSAKIVKGNTVEHLTVLP-KANRVDPQLIPPAISEDDAKHGILSLIERGLIPPAAELTLDPSPVHHRMAPLHDPMEKSGEKAKPSPMSDGSFNLASIKLD------TNFKATESTVSSVVR----------GIRPSPPTHGKHRKGA--EQPSKTPVMAK-KFEMPLQPMPERPATNAVIMEL-------------LEQTAVTPIGQVPPPTTPASGDFKA---SNYRFAMQHGKVRDTAPDFLAFKQHYCLSWGAIVSMFKHLERMLTEYAVPVAFIHGDRLADLSLEYELDSQPTLDDLLSVIINKEDVESILKRPGRRYLGPDGEFAAATKIQATWKRFRDRRKYLEYRRLKWASGVIAITWVMNVKMSQVRKQLKRTRIAELEGFRKRAKLLSTQWNRMKHSKRVIIHVPSLGYNQPIRDSIKDFGIRQNAQMGRLCDLKDPNVDVIYISPVPVNDETVQYYTKLLGLKSAIDSGDVDKQGDMTDRYKIIVPEAIKSFPTHRMCLATHLKYSPRALRRIKNLIRGRDAYIVPGMPHKDDLSVAHILNIPLLCTEPEIAHLYTSKSGAKRIFQSANVAIPPSEFDVYSLPQLHESLAQLVTDNLEVKTWVLKIDDEFDGRGIAYCNVTTYLESHQWALKEAKRYGDKWSKKWAQEQVFMKIQSEIPDILEHWCFPVDSKVYPTWPAFLDAFLAKGGIIEARPPAEDITALTADMLLEPNGKISIVSLGDQIHAETPYKCWGLSVPQSSVEPAQLNDACMRIAEACKARGVVGYFTIDFVTFIDPKTDDQVLWAVDLSLSYSDSTTMNNLLQFVAGGKLDINTHIYNIPPPKKEPKKRRPKGREEEEVPPNTNRFAVMSTQLVHSNLAVVHYSVFFQMCRAHGIGFDIKEKQGSIFTLIDSFNRENLGMITVGDNLQGTLGAFARNLSVIHQEISAPNMQGESNFKAVIQDIESILGTTVLN 1126          
BLAST of IQ domain-containing protein H vs. Ensembl Cavefish
Match: iqch (IQ motif containing H [Source:NCBI gene;Acc:567336])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 285/757 (37.65%), Postives = 448/757 (59.18%), Query Frame = 1
Query: 1174 PTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSE-EELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNS-RYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYGEK-WKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTV---------STAP-ILSV-NRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            P  P   +SK      H F I DG +     +F  FK+ YCL WG ++  +  LE+ +++Y++P A V   R+  L    EL+        LLS L N  +V +L++RPG+R+ G      AA  IQ+ W+ + AR  YL  +R++WAA  IAI W+LH ++  V+              K    +  S   +L    R        G +E  R  L     LQN QM RLCD+ D N++VIY+ PV + E++L Y+++LL L+ AV++G+ S     ++ R+ I+ PEA + FPNHNMC+S++LKYSPR L RIK++I+G++A+IV G+ H DD+ + + L VP++G EP +  L+ +KSG R++F  A V + PG   I ++ QL+E   QL+ D+L +++W+FK + +  S+G  + D+  HLS  +WA ++ +R+G + W+  WAQE    +   EVP ++  +  L +   Y +   F + F  + G +EAYP S+SVT +TV++ ++P G++ M   GDQ+H+   +   G S+PQ+SI    L+    ++ + C Q  I G+ S+D VTF+E     Q +WAVD+D  YS+  ++  + +F T          L  ++P +           AP  LSV +RF  +SS++ H+NLS+VHYSVFFQMC+AH IGFD+KE+QG++F+L DS  R+++ ++TI   L+ AL +FA NL I+H+EIS+PN+ G  NF+ +IK IE ++G+ I+N
Sbjct:  290 PALPPVSISK------HCFSIVDGRIDPCCTEFCAFKKQYCLCWGPLMEALWRLEQLMQEYAVPHARVCDQRLVALMQTGELDWGGGGVGHLLSVLENQEEVWELMRRPGQRYRGEGGRQAAAERIQASWRCHQARTAYLRQQRRKWAAETIAISWLLHAQVGRVR--------------KKPAGDSPSPTGELPQQGR--------GYSEQQRRSLTGFDILQNTQMGRLCDIRDENIEVIYVCPVRLGEDLLHYYTQLLGLQGAVETGDLSAVPASSAKRFTILTPEAYQHFPNHNMCVSTLLKYSPRTLRRIKDLIQGKHAYIVSGVPHMDDLAVADELGVPVLGPEPAVAQLYGTKSGARRIFTSAGVSVPPGHGDIYTLQQLYECLAQLMTDHLEVQRWLFKMDGEFGSRGTAYCDVS-HLSFRSWALQKYRRHGPQLWRMAWAQEPVLIKFQEEVPALLASHAKLFNTSCYPSWISFLEHFLKEGGTVEAYPPSDSVTCLTVDLLVEPGGEVHMLSCGDQLHEPGSMQVVGCSMPQTSICQHTLHSICMRVGQACHQRHILGHLSLDLVTFLELGTLEQQVWAVDLDIGYSNQLAMTQMMLFMTSGTLNCRTGCL--EVPPLVINSKASARHKAPKALSVTSRFAVMSSKLFHTNLSMVHYSVFFQMCKAHRIGFDIKERQGSVFALHDSTERKSLGLVTISPDLKGALLTFAHNLSIIHQEISAPNLQGKTNFKKLIKNIEEVVGVTIQN 1015          

HSP 2 Score: 63.929 bits (154), Expect = 9.858e-10
Identity = 45/153 (29.41%), Postives = 82/153 (53.59%), Query Frame = 1
Query:   82 IGNIVLRVHEDLNRLQEKLKA---KETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKS 531
            +G I+++V  DL++L++ L      E   ++++  +   IS T+ G++K AEE L  +N +V++   I+++ +K R  A    + E +  L         R+  I+    +SPGE  K   A++ L NP +  NR   ++ YGIQLP + +K+
Sbjct:   11 VGRILVQVQNDLSQLKKSLSRVIISEPGETLDIQVLDAAISRTEIGIKKHAEEYLKTVNKQVSTLPIIEDNKKKTRKIAKWQPSPESIPNLL-------PRKYMIVG---ASPGEKHKAAFAMRLLYNPSHPKNRELIHQNYGIQLPDLQKKT 153          
BLAST of IQ domain-containing protein H vs. Ensembl Cavefish
Match: iqch (IQ motif containing H [Source:NCBI gene;Acc:567336])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 287/760 (37.76%), Postives = 448/760 (58.95%), Query Frame = 1
Query: 1174 PTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSE-EELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELG---SKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNS-RYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYGEK-WKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTV---------STAP-ILSV-NRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            P  P   +SK      H F I DG +     +F  FK+ YCL WG ++  +  LE+ +++Y++P A V   R+  L    EL+        LLS L N  +V +L++RPG+R+ G      AA  IQ+ W+ + AR  YL  +R++WAA  IAI W+LH ++  V                 R K  G   S   +L    R        G +E  R  L     LQN QM RLCD+ D N++VIY+ PV + E++L Y+++LL L+ AV++G+ S     ++ R+ I+ PEA + FPNHNMC+S++LKYSPR L RIK++I+G++A+IV G+ H DD+ + + L VP++G EP +  L+ +KSG R++F  A V + PG   I ++ QL+E   QL+ D+L +++W+FK + +  S+G  + D+  HLS  +WA ++ +R+G + W+  WAQE    +   EVP ++  +  L +   Y +   F + F  + G +EAYP S+SVT +TV++ ++P G++ M   GDQ+H+   +   G S+PQ+SI    L+    ++ + C Q  I G+ S+D VTF+E     Q +WAVD+D  YS+  ++  + +F T          L  ++P +           AP  LSV +RF  +SS++ H+NLS+VHYSVFFQMC+AH IGFD+KE+QG++F+L DS  R+++ ++TI   L+ AL +FA NL I+H+EIS+PN+ G  NF+ +IK IE ++G+ I+N
Sbjct:  257 PALPPVSISK------HCFSIVDGRIDPCCTEFCAFKKQYCLCWGPLMEALWRLEQLMQEYAVPHARVCDQRLVALMQTGELDWGGGGVGHLLSVLENQEEVWELMRRPGQRYRGEGGRQAAAERIQASWRCHQARTAYLRQQRRKWAAETIAISWLLHAQVGRV-----------------RKKPAGDSPSPTGELPQQGR--------GYSEQQRRSLTGFDILQNTQMGRLCDIRDENIEVIYVCPVRLGEDLLHYYTQLLGLQGAVETGDLSAVPASSAKRFTILTPEAYQHFPNHNMCVSTLLKYSPRTLRRIKDLIQGKHAYIVSGVPHMDDLAVADELGVPVLGPEPAVAQLYGTKSGARRIFTSAGVSVPPGHGDIYTLQQLYECLAQLMTDHLEVQRWLFKMDGEFGSRGTAYCDVS-HLSFRSWALQKYRRHGPQLWRMAWAQEPVLIKFQEEVPALLASHAKLFNTSCYPSWISFLEHFLKEGGTVEAYPPSDSVTCLTVDLLVEPGGEVHMLSCGDQLHEPGSMQVVGCSMPQTSICQHTLHSICMRVGQACHQRHILGHLSLDLVTFLELGTLEQQVWAVDLDIGYSNQLAMTQMMLFMTSGTLNCRTGCL--EVPPLVINSKASARHKAPKALSVTSRFAVMSSKLFHTNLSMVHYSVFFQMCKAHRIGFDIKERQGSVFALHDSTERKSLGLVTISPDLKGALLTFAHNLSIIHQEISAPNLQGKTNFKKLIKNIEEVVGVTIQN 982          

HSP 2 Score: 63.5438 bits (153), Expect = 1.195e-9
Identity = 45/153 (29.41%), Postives = 82/153 (53.59%), Query Frame = 1
Query:   82 IGNIVLRVHEDLNRLQEKLKA---KETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKS 531
            +G I+++V  DL++L++ L      E   ++++  +   IS T+ G++K AEE L  +N +V++   I+++ +K R  A    + E +  L         R+  I+    +SPGE  K   A++ L NP +  NR   ++ YGIQLP + +K+
Sbjct:   11 VGRILVQVQNDLSQLKKSLSRVIISEPGETLDIQVLDAAISRTEIGIKKHAEEYLKTVNKQVSTLPIIEDNKKKTRKIAKWQPSPESIPNLL-------PRKYMIVG---ASPGEKHKAAFAMRLLYNPSHPKNRELIHQNYGIQLPDLQKKT 153          
BLAST of IQ domain-containing protein H vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000946.1 (pep scaffold:Pmarinus_7.0:GL478317:30367:69358:-1 gene:ENSPMAG00000000853.1 transcript:ENSPMAT00000000946.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 263.462 bits (672), Expect = 1.547e-75
Identity = 206/736 (27.99%), Postives = 347/736 (47.15%), Query Frame = 1
Query: 1240 DGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEM---KPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRA-LGRIKNMI-KGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLH---KSKSGIRKLFEQANVEISPGERGIKS--VAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDH----LLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            DG +     DF +F++ +   WG I S +  +E  L   +   A  +   ++ ++ E EL +   + +E +LL    N   ++ LL   GR F      D AA  IQ+ W+A++AR+ +  +RR+RWAAGV+A+ W+L ++   V+  L + R   L NF+ R + L   W ++ SSRR +IH+PS G ++  R +LK    LQN QM RLCD+ D NVDVIY+SPVP+++E+L Y+ +LL L ++   G          RY IIVP+A+  FPN + C+  +L  +P A +G+       G+  ++  G++    + I +LL++ +      +L      +SK G R    Q N  +S     + S    QL ES ++L+  +  ++ W+ KT      +G     +  HL C+ W   E +RYG E+W+ +WAQ  A + I ++    +  N + ++P       +F   F +   I +     +   ++T+ M  +  G      SG ++    PL   G   P       +L       +  CR           F +  E   ++                       F T +Q  P  H     L  D+  V    +L+++         + + ++   +  F  +    G          T+F+LI    RE + M+ I   L+ AL +FA+NL ++H++ISS +M G  NF+  ++EIESILG+ ++N
Sbjct:    1 DGRVDQTAGDFSEFQKLHRTAWGPISSTLRGMEGLLANAAN-AAAASTPSLSSVAQELELGLQRRRVTERDLLFAAENPDSLLPLL---GRGFRSPGGHDRAATRIQASWRAFLARRHFERHRRRRWAAGVVAVAWMLRVQRGRVRRSLAQRRQAQLENFRTRAQYLAENWKRIQSSRRTIIHIPSLGYSKHLRRRLKHFDVLQNLQMGRLCDIKDPNVDVIYVSPVPLSDEVLHYYERLLGLSASGGDG--------TGRYTIIVPDAVVRFPNTSACVLPVLMPNPPASMGKTSYWRDSGKKEYLELGLLCPRAIRIEDLLSLSLSLVILPLLKWMVSLRSKGGSRV---QVNAVVSCFNSVLDSHLYRQLVESLSRLVAAHAGVRCWLLKTEEGPGGRGTASCPVAQHLPCHRWVLSESRRYGSEQWRHRWAQIFALSHISQKPHGTLSAN-SPINPIRLFPCGQFIHVFITFGIISQREHQQQQQQSLTLQMVQENKGGWHQLNSGGKVRRPCPLFPMGEQWPWIQASEWLLATGRLSRSSRCRN---------PFDSCAEAAVQD-----------------------FITPSQRVPRPHTTPAALTHDLQIVLLHTVLAISDTPDGLDLTTLTIITTTEFVQFLPILERQG----------TVFTLIHGQRRERLGMMVIMDDLQVALMTFAQNLALIHQQISSADMQGETNFKEAVQEIESILGITVQN 678          
BLAST of IQ domain-containing protein H vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000944.1 (pep scaffold:Pmarinus_7.0:GL478317:30367:69358:-1 gene:ENSPMAG00000000853.1 transcript:ENSPMAT00000000944.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 217.238 bits (552), Expect = 1.885e-59
Identity = 145/443 (32.73%), Postives = 235/443 (53.05%), Query Frame = 1
Query: 1240 DGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEM---KPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRA-LGRIKNMI-KGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLH---KSKSGIRKLFEQANVEISPGERGIKS--VAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQENAYNRI 2535
            DG +     DF +F++ +   WG I S +  +E  L   +   A  +   ++ ++ E EL +   + +E +LL    N   ++ LL   GR F      D AA  IQ+ W+A++AR+ +  +RR+RWAAGV+A+ W+L ++   V+  L + R   L NF+ R + L   W ++ SSRR +IH+PS G ++  R +LK    LQN QM RLCD+ D NVDVIY+SPVP+++E+L Y+ +LL L ++   G          RY IIVP+A+  FPN + C+  +L  +P A +G+       G+  ++  G++    + I +LL++ +      +L      +SK G R    Q N  +S     + S    QL ES ++L+  +  ++ W+ KT      +G     +  HL C+ W   E +RYG E+W+ +WAQ  A + I
Sbjct:    1 DGRVDQTAGDFSEFQKLHRTAWGPISSTLRGMEGLLANAAN-AAAASTPSLSSVAQELELGLQRRRVTERDLLFAAENPDSLLPLL---GRGFRSPGGHDRAATRIQASWRAFLARRHFERHRRRRWAAGVVAVAWMLRVQRGRVRRSLAQRRQAQLENFRTRAQYLAENWKRIQSSRRTIIHIPSLGYSKHLRRRLKHFDVLQNLQMGRLCDIKDPNVDVIYVSPVPLSDEVLHYYERLLGLSASGGDG--------TGRYTIIVPDAVVRFPNTSACVLPVLMPNPPASMGKTSYWRDSGKKEYLELGLLCPRAIRIEDLLSLSLSLVILPLLKWMVSLRSKGGSRV---QVNAVVSCFNSVLDSHLYRQLVESLSRLVAAHAGVRCWLLKTEEGPGGRGTASCPVAQHLPCHRWVLSESRRYGSEQWRHRWAQIFALSHI 428          

HSP 2 Score: 81.6481 bits (200), Expect = 5.647e-16
Identity = 36/76 (47.37%), Postives = 56/76 (73.68%), Query Frame = 1
Query: 3175 DLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            DL+E+QGT+F+LI    RE + M+ I   L+ AL +FA+NL ++H++ISS +M G  NF+  ++EIESILG+ ++N
Sbjct:  619 DLQERQGTVFTLIHGQRRERLGMMVIMDDLQVALMTFAQNLALIHQQISSADMQGETNFKEAVQEIESILGITVQN 694          
BLAST of IQ domain-containing protein H vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000949.1 (pep scaffold:Pmarinus_7.0:GL478317:30406:63650:-1 gene:ENSPMAG00000000853.1 transcript:ENSPMAT00000000949.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.297 bits (521), Expect = 6.610e-56
Identity = 118/339 (34.81%), Postives = 185/339 (54.57%), Query Frame = 1
Query: 1528 DCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNH--NMCLSSILKYSPRALGRIKNMIKGR----NAWIVPGMMHTDDVYIGELLNVPIIGTEP-EILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYG-EKWKKKWAQEN 2520
            D AA  IQ+ W+A++AR+ +  +RR+RWAAGV+A+ W+L ++   V+  L + R   L NF+ R + L   W ++ SSRR +IH+PS G ++  R +LK    LQN QM RLCD+ D NVDVIY+SPVP+++E+L Y+ +LL L ++   G          RY IIVP+A+  FP      CL S L   PR   R+    KGR    + ++V      ++   G  +   ++  +P     LH + +  +    +A + I P   G     QL ES ++L+  +  ++ W+ KT      +G     +  HL C+ W   E +RYG E+W+ +WAQ++
Sbjct:    4 DRAATRIQASWRAFLARRHFERHRRRRWAAGVVAVAWMLRVQRGRVRRSLAQRRQAQLENFRTRAQYLAENWKRIQSSRRTIIHIPSLGYSKHLRRRLKHFDVLQNLQMGRLCDIKDPNVDVIYVSPVPLSDEVLHYYERLLGLSASGGDG--------TGRYTIIVPDAVVRFPTRAPACCLCSCLT-RPRLCARVYISAKGRKGLESTFLVGHTFVDNERMCGFTVCSELLERQPVNSHVLHVTLAEGKNTKTRATINIPPCLWGSICKDQLVESLSRLVAAHAGVRCWLLKTEEGPGGRGTASCPVAQHLPCHRWVLSESRRYGSEQWRHRWAQKS 333          

HSP 2 Score: 79.7221 bits (195), Expect = 1.894e-15
Identity = 35/75 (46.67%), Postives = 55/75 (73.33%), Query Frame = 1
Query: 3178 LKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIEN 3402
            +KE+QGT+F+LI    RE + M+ I   L+ AL +FA+NL ++H++ISS +M G  NF+  ++EIESILG+ ++N
Sbjct:  567 IKERQGTVFTLIHGQRRERLGMMVIMDDLQVALMTFAQNLALIHQQISSADMQGETNFKEAVQEIESILGITVQN 641          
BLAST of IQ domain-containing protein H vs. Ensembl Nematostella
Match: EDO37640 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF81])

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 346/768 (45.05%), Postives = 513/768 (66.80%), Query Frame = 1
Query: 1165 VPPPT-TPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLK----SAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMP----------------TVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIENI 3405
            VP P  TPAS+L      + HKFVI++G  R  + D++ FK+HYCL WG I+++I  LE+    +S+P+AF++GDR+ADL++ +ELE +PS E  ++C++N  DV  +++ PGRR++G N  + AA+ IQS W+ +  R  YL YR+++WAAGVIAI WI++ K++ ++++L++TR+  L  F++R K L  +W ++  SRRV+IHLPS G  +  R  L  +  LQN QM RLCD+ D  V+VIYI PV +NEE+ QY++KLL++K    S+       D  + N RYKIIVP+A+ SFP HNM LSSIL YSPR + RI+N+IKGR+A+IV G+++ DDVY+ +LL++PI+  EPE+  L+ +KSG +++F    V I PG+  I S+ QLHES +QL+ +NL++++WIFK + +   +G  + D+  HL CY+WA KE +RYGEKW KKWA E    ++  E+PDI+  +   V+ +LY T   F  +F  + G++EA P SESVT +TV++ I+PTG  ++   GDQIH  +PL  WGYSVPQ+S++  +L+    K    C+   I GYFSIDFVTF++ +   Q +WAVD+  QYSD  ++ NL ++ T     P       ++P                T    P  + NR+   S+++ HSNLS++HYSVFFQMCRAHGIG+D+KEK GTIF+L+DS  R+++ M+ +   L+ +L +FA+NL ++H+EIS+PNM G  NFQ  I +I++ILG   EN+
Sbjct:  329 VPAPVPTPASELK-----SVHKFVIQNGKTRVTSQDYLNFKQHYCLSWGSILTLIVKLEELFSNFSVPIAFIDGDRLADLALVFELEQEPSLEHFMTCILNGDDVEKIIRTPGRRYLGPNGTEMAAIKIQSTWRRHKDRTAYLIYRKQKWAAGVIAISWIMNCKLSMIRKQLKQTRLNQLDRFRIRTKRLKQEWPRIQQSRRVIIHLPSMGYPQHIRDDLSNISLLQNLQMARLCDIADPKVEVIYICPVEVNEEVYQYYAKLLAMKARPLSSTKKPGEEDDNIEN-RYKIIVPDAVNSFPTHNMSLSSILMYSPRTIKRIRNLIKGRDAYIVSGVVNKDDVYVADLLDIPILSAEPEVSQLYSTKSGSKRIFRSGQVSIPPGQFDIYSLPQLHESLSQLVTENLHVERWIFKMDSEFNGRGTAYCDVTPHLKCYSWALKECQRYGEKWAKKWAHEPTLIKVSAEIPDILSRHAHPVNSELYPTWEGFLHDFLKRGGVVEACPPSESVTALTVDVLIEPTGDSKILSMGDQIHATSPLMCWGYSVPQASVEPAVLSAAIEKTTLACKLRGIMGYFSIDFVTFIDPHTMEQQVWAVDLKLQYSDSMAMTNLMLYVTGGAIDPTRASF--EVPVKRKREESGRRRRRRVTDDKEPPPNPNRYAITSTRLLHSNLSVIHYSVFFQMCRAHGIGYDIKEKAGTIFTLVDSSKRDHLGMLVMSDDLQGSLSTFARNLSVIHQEISAPNMQGESNFQSAIDDIDNILGTTSENV 1088          

HSP 2 Score: 95.5153 bits (236), Expect = 8.375e-20
Identity = 64/248 (25.81%), Postives = 126/248 (50.81%), Query Frame = 1
Query:   88 NIVLRVHEDLNRLQEKLK-AKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEKLKQLQEIDLNDE-------------ARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVI 789
            NI+ +V +DL  L+E +  A  +   I++  ++  I+ T+  ++++AE+ +   N++V +  +++  G KR  +     N+     ++ + LN +             AR+      N  +PG+  K    L+ +SNP + + R   ++ YG+  P +  +   + +    +  G+ V  L  LP + N+      P  I+E DA+KG+L+LIERGLIPP A++T +P P+ +   P+  + + N ++
Sbjct:   10 NILSQVQDDLRHLKETISNAGGSTEIIDLKALESAITRTEISVREKAEQFIQASNNQVVTLPSLEAPGIKRTDAFR---NKNSAFSMKSVLLNKQKKTGSRLLQPLVVAREGNKPGPNAPAPGQQAKNLRNLQVISNPAHPVARDLLHDKYGVAFPNLVNRRDDQEKAPGKVVTGTSVDHLSTLP-KANRVDATRTPPPISEDDAKKGILSLIERGLIPPAAELTLEPSPVRHHQAPVSDSKLTNPIL 253          
BLAST of IQ domain-containing protein H vs. Ensembl Nematostella
Match: EDO28864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T599])

HSP 1 Score: 58.9214 bits (141), Expect = 1.967e-9
Identity = 31/63 (49.21%), Postives = 42/63 (66.67%), Query Frame = 1
Query: 1876 DNNVDVIYISPVPMNEEILQYFSKLLSLK----SAVDSGNTSDQKLLNSRYKIIVPEAIKSFP 2052
            D  V+VIYI PV +NEE+ QY++KLL++K    S+       D  + N RYKIIVP+A+ SFP
Sbjct:  104 DPKVEVIYICPVEVNEEVYQYYAKLLAMKARPLSSTKKPGEEDDNIEN-RYKIIVPDAVNSFP 165          
BLAST of IQ domain-containing protein H vs. Planmine SMEST
Match: SMESG000037909.1 (SMESG000037909.1)

HSP 1 Score: 2266.11 bits (5871), Expect = 0.000e+0
Identity = 1099/1124 (97.78%), Postives = 1104/1124 (98.22%), Query Frame = 1
Query:   64 MENEAVIGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKNVTKAYHTKPKETEDNNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIENIINNESRVKEI 3435
            MENE+VIGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSS IDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSD IQK SMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMK               NNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTR+KHL+NFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDID+HLSCYNWAQKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNL+IFATKAQFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGL IEN INNESRVKEI
Sbjct:    1 MENESVIGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSKIDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDAIQKASMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKKY-------------NNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRVKHLANFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDIHLSCYNWAQKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLTIFATKAQFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLAIENTINNESRVKEI 1111          
BLAST of IQ domain-containing protein H vs. Planmine SMEST
Match: SMESG000037909.1 (SMESG000037909.1)

HSP 1 Score: 2220.66 bits (5753), Expect = 0.000e+0
Identity = 1081/1124 (96.17%), Postives = 1086/1124 (96.62%), Query Frame = 1
Query:   64 MENEAVIGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNAMKNVTKAYHTKPKETEDNNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWAQKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLVIENIINNESRVKEI 3435
            MENE+VIGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSS IDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSD IQK SMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQK                  LPNAMK               NNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTR+KHL+NFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDID+HLSCYNWAQKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNL+IFATKAQFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGL IEN INNESRVKEI
Sbjct:    1 MENESVIGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDLISTTQTGLQKRAEEILNHLNSRVTSSSKIDNSGQKRRISATLSINQEKLKQLQEIDLNDEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLPLIHEKSTIKTQNSDAIQKASMVKKLEKLPLETNKFYNNTKPSKITEFDARKGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQGYSLACYHLDEAGGTGNDFLDDDAPEQKR-----------------LPNAMKKY-------------NNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVEEKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVTDDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEYELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWKAYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRVKHLANFKLRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRLCDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSRYKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMHTDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIKSVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDIHLSCYNWAQKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKFWKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPLNAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEENQLIWAVDIDFQYSDLASLMNLTIFATKAQFKPDDHLLIADMPTVSTAPILSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLIDSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVIKEIESILGLAIENTINNESRVKEI 1094          
The following BLAST results are available for this feature:
BLAST of IQ domain-containing protein H vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IQCH0.000e+035.68IQ motif containing H [Source:HGNC Symbol;Acc:HGNC... [more]
IQCH4.173e-9640.80IQ motif containing H [Source:HGNC Symbol;Acc:HGNC... [more]
IQCH1.003e-7243.38IQ motif containing H [Source:HGNC Symbol;Acc:HGNC... [more]
IQCH9.865e-5132.89IQ motif containing H [Source:HGNC Symbol;Acc:HGNC... [more]
IQCH3.952e-4345.51IQ motif containing H [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of IQ domain-containing protein H vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ domain-containing protein H vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ domain-containing protein H vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
iqch1.122e-637.09IQ motif containing H [Source:NCBI gene;Acc:567336... [more]
iqch1.108e-636.46IQ motif containing H [Source:NCBI gene;Acc:567336... [more]
iqch1.053e-636.33IQ motif containing H [Source:NCBI gene;Acc:567336... [more]
iqch3.462e-2932.95IQ motif containing H [Source:NCBI gene;Acc:567336... [more]
back to top
BLAST of IQ domain-containing protein H vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pter0.000e+036.36phosphotriesterase related [Source:Xenbase;Acc:XB-... [more]
pter0.000e+036.09phosphotriesterase related [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of IQ domain-containing protein H vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Iqch2.075e-1941.22IQ motif containing H [Source:MGI Symbol;Acc:MGI:1... [more]
Iqch2.835e-1141.22IQ motif containing H [Source:MGI Symbol;Acc:MGI:1... [more]
Iqch2.566e-1940.92IQ motif containing H [Source:MGI Symbol;Acc:MGI:1... [more]
Iqch2.821e-1939.97IQ motif containing H [Source:MGI Symbol;Acc:MGI:1... [more]
Iqch7.921e-12643.62IQ motif containing H [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of IQ domain-containing protein H vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q86VS3|IQCH_HUMAN0.000e+035.68IQ domain-containing protein H OS=Homo sapiens OX=... [more]
sp|Q9D2K4|IQCH_MOUSE1.451e-1841.22IQ domain-containing protein H OS=Mus musculus OX=... [more]
sp|Q1LXZ7|IQCH_DANRE8.468e-637.09IQ motif-containing protein H OS=Danio rerio OX=79... [more]
back to top
BLAST of IQ domain-containing protein H vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|239085880.000e+041.08tr|K1PF58|K1PF58_CRAGI IQ domain-containing protei... [more]
gnl|BL_ORD_ID|203452660.000e+040.77tr|A0A1S3K594|A0A1S3K594_LINUN IQ domain-containin... [more]
gnl|BL_ORD_ID|203139520.000e+041.07tr|A0A1S3I7P2|A0A1S3I7P2_LINUN IQ domain-containin... [more]
gnl|BL_ORD_ID|203117080.000e+041.30tr|A0A1S3I548|A0A1S3I548_LINUN IQ domain-containin... [more]
gnl|BL_ORD_ID|203506370.000e+040.73tr|A0A1S3I594|A0A1S3I594_LINUN IQ domain-containin... [more]
back to top
BLAST of IQ domain-containing protein H vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
iqch9.858e-1037.65IQ motif containing H [Source:NCBI gene;Acc:567336... [more]
iqch1.195e-937.76IQ motif containing H [Source:NCBI gene;Acc:567336... [more]
back to top
BLAST of IQ domain-containing protein H vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000000946.11.547e-7527.99pep scaffold:Pmarinus_7.0:GL478317:30367:69358:-1 ... [more]
ENSPMAT00000000944.11.885e-5932.73pep scaffold:Pmarinus_7.0:GL478317:30367:69358:-1 ... [more]
ENSPMAT00000000949.16.610e-5634.81pep scaffold:Pmarinus_7.0:GL478317:30406:63650:-1 ... [more]
back to top
BLAST of IQ domain-containing protein H vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ domain-containing protein H vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO376408.375e-2045.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288641.967e-949.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of IQ domain-containing protein H vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ domain-containing protein H vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000037909.10.000e+097.78SMESG000037909.1[more]
SMESG000037909.10.000e+096.17SMESG000037909.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028653 ID=SMED30028653|Name=IQ domain-containing protein H|organism=Schmidtea mediterranea sexual|type=transcript|length=3441bp
ATTATTTAAATGTTAACTTTAATAAAAACTTACAATTAAATTACTAAAAT
AAATAATTTCTTAATGGAAAATGAAGCAGTAATTGGAAATATTGTTTTAC
GTGTTCATGAAGATTTGAATAGGTTGCAAGAAAAATTAAAGGCCAAAGAA
ACCCAAAACAGCATAAATGTAGCTGATATCAAAGATTTAATTTCAACAAC
ACAAACCGGTTTGCAGAAACGAGCTGAAGAGATATTAAATCATTTGAATA
GTCGAGTGACAAGCTCGTCGACAATCGACAATTCCGGACAGAAAAGGCGA
ATTTCGGCAACTTTATCCATTAACCAAGAAAAACTTAAGCAATTGCAAGA
AATTGATCTCAATGACGAGGCAAGGCAGACAGAAATTTTGACGTGGAACT
ACTCCAGTCCGGGTGAAAATGTAAAAAAAGAAATGGCATTGAAAAGTCTA
TCAAATCCTCACAATAAAATGAATCGCTACTTTGCTAATGAAATGTATGG
GATTCAATTGCCACTGATTCATGAAAAGTCAACTATCAAGACCCAAAATT
CAGATTGCATTCAGAAAGGTTCGATGGTAAAAAAACTGGAAAAATTACCT
TTGGAAACAAATAAGTTTTACAATAACACAAAACCTTCCAAAATAACAGA
ATTCGATGCACGGAAAGGATTGCTGAATCTTATCGAACGAGGTTTAATAC
CACCTAACGCAAAAATTACATTTGACCCCCCGCCGATAAATAATGGCACG
ATTCCAATATTATCAGCATCCATGAAAAACAGAGTAATTGTACCTGCTGG
TGCCAATGACCAAGGTTATAGTTTGGCATGTTATCATCTTGATGAAGCTG
GAGGGACTGGTAATGATTTCCTTGATGATGATGCACCTGAACAAAAGAGT
GTCGAATTGGAAAATGTTAATAAAACTTCCAATGACAAAGTTATTCCAGG
ACTACCAAATGCAATGAAAAATGTTACTAAAGCCTACCATACAAAACCGA
AAGAAACTGAAGACAATAATAAATCGAAAAAGTCAATTCTCCTTCGAAAT
AACCACGACAAACCAACGAATTTCAAGTCAATTAAAACAATTCAATTCAA
TAAAGATGTGGAAGAAAAAGAAATCCCAACATTTCGGAATGATAACGTGA
CAAAAGAAATGACTGTACCTCCTCCGACGACTCCAGCATCACAATTGTCA
AAATCGAATATGGATACGTATCACAAATTTGTAATAAAAGATGGGATATT
GCGTCATGTCACGGATGATTTTATCAAATTCAAGCGTCATTATTGTCTGA
TTTGGGGCGGAATCGTTAGCATTATTGAAGCATTGGAAAAGTTTCTGAAG
AAATATTCAATCCCGCTCGCATTCGTCAATGGAGATAGGGTCGCGGACTT
GTCAGTTGAATATGAACTGGAAATGAAGCCATCTGAAGAAGAATTGTTAT
CTTGTCTAATTAATGCCAGAGATGTCATAGACTTGTTAAAAAGACCAGGA
CGCCGATTTATGGGACTGAACCGAGAAGATTGCGCTGCATTAGTTATCCA
AAGTAAATGGAAAGCCTATGTAGCTCGAAAATTCTATCTAGAATATCGGC
GAAAACGTTGGGCAGCTGGTGTTATTGCCATTCAGTGGATCTTGCACATG
AAAATGACCCATGTTAAAGAAGAACTACAAAAGACGAGAATTAAGCATCT
TTCGAATTTCAAATTACGATATAAAGAATTAGGATCTAAATGGGCTAAAC
TAAATTCATCGAGGCGAGTAGTGATTCACTTGCCATCCTTCGGTTTGACA
GAAATACATCGATCTAAATTAAAAAAGCTGCCTGAGCTTCAAAATCATCA
AATGACTCGACTGTGTGATCTAATGGATAACAATGTCGATGTCATTTATA
TAAGTCCAGTACCAATGAACGAAGAAATACTTCAGTATTTCTCGAAGTTA
TTATCCTTGAAATCAGCAGTGGACTCTGGCAATACCAGTGATCAGAAACT
GCTAAATTCGAGGTATAAAATTATTGTTCCTGAAGCAATAAAGTCATTTC
CGAATCATAACATGTGTTTGTCATCCATTTTAAAATATAGTCCAAGGGCG
CTGGGGAGAATTAAAAATATGATCAAAGGACGAAATGCATGGATAGTTCC
AGGAATGATGCATACTGATGATGTATACATAGGTGAATTGCTCAATGTTC
CGATTATTGGCACCGAGCCAGAAATCCTTGATCTTCATAAATCAAAGTCA
GGAATTCGTAAATTATTCGAACAAGCTAATGTCGAAATCTCTCCAGGTGA
AAGAGGAATCAAGTCAGTAGCACAACTTCATGAATCTTTTACTCAACTCA
TTATTGACAACCTGAATATCAAGCAATGGATTTTCAAAACAAATTTCGAC
ATCAAAAGTCAAGGAATCGGGTTCATAGATATTGATGTTCACCTGTCTTG
CTATAATTGGGCGCAAAAAGAACAAAAACGATACGGAGAAAAATGGAAGA
AAAAATGGGCTCAGGAAAATGCCTACAACAGAATACTGAGAGAAGTTCCT
GATATCATTGAGATGAATTTGACTTTAGTTGATCCTAAGTTATATTCGAC
AACATCCAAATTTTGGAAGGAATTTTTCTCAAAAGATGGTATCATTGAAG
CGTATCCTGGCAGTGAAAGCGTTACAAATATAACCGTAAATATGTTTATT
GACCCAACCGGGAAGATTCAAATGACCGGAAGTGGAGATCAAATTCATGA
TGGCAATCCTCTAAATGCGTGGGGATATTCAGTTCCTCAATCATCAATTG
ATTCCGAGATTCTCAATGAGTATAGTTATAAAATCGCCGAAACCTGCCGA
CAGAATGACATCAAAGGATATTTCTCCATAGATTTTGTCACCTTTGTGGA
AAATAATGAAGAAAATCAATTGATTTGGGCAGTGGATATCGATTTCCAAT
ATTCGGATCTTGCCAGCTTGATGAACCTGTCAATATTTGCAACGAAAGCA
CAGTTCAAACCCGACGATCATTTGCTCATTGCCGATATGCCAACAGTTTC
TACAGCACCAATTCTCTCCGTAAATCGATTCGTTTGTCTTAGTTCTCAGA
TTTCCCACAGTAATCTCTCACTGGTTCACTATTCCGTATTTTTTCAGATG
TGTCGTGCCCACGGCATAGGGTTTGATTTGAAGGAAAAACAAGGTACAAT
ATTCTCATTGATCGACAGCTTCAATAGGGAAAATATTAGCATGATAACCA
TTGGGACAAGTTTAGAGCAAGCTCTGGAATCCTTTGCAAAAAATTTATAT
ATTCTTCACAAGGAGATTTCATCTCCTAATATGGCTGGTCATGGAAACTT
TCAGCTTGTTATAAAGGAGATAGAAAGCATTCTTGGACTTGTCATCGAAA
ATATAATTAACAATGAATCCAGAGTCAAGGAAATATGATTA
back to top

protein sequence of SMED30028653-orf-1

>SMED30028653-orf-1 ID=SMED30028653-orf-1|Name=SMED30028653-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1125bp
MENEAVIGNIVLRVHEDLNRLQEKLKAKETQNSINVADIKDLISTTQTGL
QKRAEEILNHLNSRVTSSSTIDNSGQKRRISATLSINQEKLKQLQEIDLN
DEARQTEILTWNYSSPGENVKKEMALKSLSNPHNKMNRYFANEMYGIQLP
LIHEKSTIKTQNSDCIQKGSMVKKLEKLPLETNKFYNNTKPSKITEFDAR
KGLLNLIERGLIPPNAKITFDPPPINNGTIPILSASMKNRVIVPAGANDQ
GYSLACYHLDEAGGTGNDFLDDDAPEQKSVELENVNKTSNDKVIPGLPNA
MKNVTKAYHTKPKETEDNNKSKKSILLRNNHDKPTNFKSIKTIQFNKDVE
EKEIPTFRNDNVTKEMTVPPPTTPASQLSKSNMDTYHKFVIKDGILRHVT
DDFIKFKRHYCLIWGGIVSIIEALEKFLKKYSIPLAFVNGDRVADLSVEY
ELEMKPSEEELLSCLINARDVIDLLKRPGRRFMGLNREDCAALVIQSKWK
AYVARKFYLEYRRKRWAAGVIAIQWILHMKMTHVKEELQKTRIKHLSNFK
LRYKELGSKWAKLNSSRRVVIHLPSFGLTEIHRSKLKKLPELQNHQMTRL
CDLMDNNVDVIYISPVPMNEEILQYFSKLLSLKSAVDSGNTSDQKLLNSR
YKIIVPEAIKSFPNHNMCLSSILKYSPRALGRIKNMIKGRNAWIVPGMMH
TDDVYIGELLNVPIIGTEPEILDLHKSKSGIRKLFEQANVEISPGERGIK
SVAQLHESFTQLIIDNLNIKQWIFKTNFDIKSQGIGFIDIDVHLSCYNWA
QKEQKRYGEKWKKKWAQENAYNRILREVPDIIEMNLTLVDPKLYSTTSKF
WKEFFSKDGIIEAYPGSESVTNITVNMFIDPTGKIQMTGSGDQIHDGNPL
NAWGYSVPQSSIDSEILNEYSYKIAETCRQNDIKGYFSIDFVTFVENNEE
NQLIWAVDIDFQYSDLASLMNLSIFATKAQFKPDDHLLIADMPTVSTAPI
LSVNRFVCLSSQISHSNLSLVHYSVFFQMCRAHGIGFDLKEKQGTIFSLI
DSFNRENISMITIGTSLEQALESFAKNLYILHKEISSPNMAGHGNFQLVI
KEIESILGLVIENIINNESRVKEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038752IQCH
IPR000048IQ_motif_EF-hand-BS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038752IQ domain-containing protein HPANTHERPTHR14465IQ DOMAIN-CONTAINING PROTEIN Hcoord: 10..754
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 123..152
score: 7.437