Sorting nexin 22

Overview
NameSorting nexin 22
Smed IDSMED30028641
Length (bp)559
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sorting nexin 22 (SMED30028641) t-SNE clustered cells

Violin plots show distribution of expression levels for Sorting nexin 22 (SMED30028641) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sorting nexin 22 (SMED30028641) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sorting nexin 22 (SMED30028641) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028641

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028641SMESG000080994.1 SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069022.1 SMESG000066578.1 SMESG000060322.1 SMESG000043653.1 SMESG000034864.1 SMESG000032108.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 SMESG000005359.1 Contig5571uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028641SMESG000080994.1 SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069022.1 SMESG000066578.1 SMESG000060322.1 SMESG000043653.1 SMESG000034864.1 SMESG000032108.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 SMESG000005359.1 Contig5571newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028641SMESG000034864.1 SMESG000024585.1 SMESG000017900.1 SMESG000006895.1 SMESG000034870.1 Contig1901GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30028641SMESG000034870.1 SMESG000034864.1 SMESG000024585.1 SMESG000017900.1 SMESG000006895.1 SMESG000035129.1 dd_Smed_v4_4469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028641SMESG000034870.1 SMESG000034864.1 SMESG000024585.1 SMESG000017900.1 SMESG000006895.1 SMESG000035129.1 dd_Smed_v4_4469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30028641SMESG000034870.1 SMESG000034864.1 SMESG000024585.1 SMESG000017900.1 SMESG000006895.1 SMESG000035129.1 dd_Smed_v4_4469_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30028641SMESG000034870.1 SMESG000034864.1 SMESG000024585.1 SMESG000017900.1 SMESG000006895.1 SMESG000035129.1 dd_Smed_v4_4469_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sorting nexin 22 vs. Ensembl Human
Match: SNX24 (sorting nexin 24 [Source:HGNC Symbol;Acc:HGNC:21533])

HSP 1 Score: 73.1738 bits (178), Expect = 4.281e-16
Identity = 55/165 (33.33%), Postives = 80/165 (48.48%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSFLKVVSISEIK-SHDSSII---------------TCGVLDALY 498
            + + I SFR   S+    YT +KI+V +  +  H VE+RY+EF  L+KKL K IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   S    L K E   SF +  S    K SH   ++               TC +L ALY
Sbjct:    1 MEVYIPSFRYEESDLERGYTVFKIEVLMNGR-KHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENE-ELPKLFLDFLNVRHLPS----LPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASGNQTCHLLTALY 159          
BLAST of Sorting nexin 22 vs. Ensembl Human
Match: SNX24 (sorting nexin 24 [Source:HGNC Symbol;Acc:HGNC:21533])

HSP 1 Score: 73.1738 bits (178), Expect = 4.281e-16
Identity = 55/165 (33.33%), Postives = 80/165 (48.48%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSFLKVVSISEIK-SHDSSII---------------TCGVLDALY 498
            + + I SFR   S+    YT +KI+V +  +  H VE+RY+EF  L+KKL K IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   S    L K E   SF +  S    K SH   ++               TC +L ALY
Sbjct:    1 MEVYIPSFRYEESDLERGYTVFKIEVLMNGR-KHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENE-ELPKLFLDFLNVRHLPS----LPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASGNQTCHLLTALY 159          
BLAST of Sorting nexin 22 vs. Ensembl Human
Match: SNX24 (sorting nexin 24 [Source:HGNC Symbol;Acc:HGNC:21533])

HSP 1 Score: 71.633 bits (174), Expect = 2.236e-15
Identity = 45/123 (36.59%), Postives = 66/123 (53.66%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSF 420
            + + I SFR   S+    YT +KI+V +  +  H VE+RY+EF  L+KKL K IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   S    L K E   SF
Sbjct:    1 MEVYIPSFRYEESDLERGYTVFKIEVLMNGR-KHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENE-ELPKLFLDFLNVRHLPS----LPKAESCGSF 117          
BLAST of Sorting nexin 22 vs. Ensembl Human
Match: SNX22 (sorting nexin 22 [Source:HGNC Symbol;Acc:HGNC:16315])

HSP 1 Score: 64.6994 bits (156), Expect = 2.871e-13
Identity = 35/91 (38.46%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  103 SYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYA--LNQFQFGIPEELLNFLNYKQ 369
            S+  ++++V + S   H+V RRY+EF  L+K++ KL KV DFPS+ +  W  + LE R+   E Y+     LNQ    +P+ELL FL  + 
Sbjct:   23 SHMVFRVEV-LCSGRRHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQ---EVPKELLEFLRLRH 109          
BLAST of Sorting nexin 22 vs. Ensembl Human
Match: SNX22 (sorting nexin 22 [Source:HGNC Symbol;Acc:HGNC:16315])

HSP 1 Score: 65.855 bits (159), Expect = 4.700e-13
Identity = 46/153 (30.07%), Postives = 72/153 (47.06%), Query Frame = 1
Query:  103 SYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYA--LNQFQFGIPEELLNFLNYKQ------------------ADSVKSVLKKPEMSSSFLKVVSISEIKSHDSSIITCGVLDALYS 501
            S+  ++++V    +  H+V RRY+EF  L+K++ KL KV DFPS+ +  W  + LE R+   E Y+     LNQ    +P+ELL FL  +                    DS     ++P +S      V     +S  + ++  GVL  LYS
Sbjct:   23 SHMVFRVEVLCSGR-RHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQ---EVPKELLEFLRLRHFPTDPKASNWGTLREFLPGDSSSQQHQRPVLSFHVDPYVCNPSPESLPNVVVN-GVLQGLYS 170          
BLAST of Sorting nexin 22 vs. Ensembl Zebrafish
Match: snx24 (sorting nexin 24 [Source:ZFIN;Acc:ZDB-GENE-050913-45])

HSP 1 Score: 74.3294 bits (181), Expect = 1.229e-16
Identity = 51/144 (35.42%), Postives = 75/144 (52.08%), Query Frame = 1
Query:   43 MSSIRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSFLKVVSISEIKSHDSSIIT 474
            M  I + I SFR   S     YT +KI+V +  +  H+VE+RY+EF  L+K L K+IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   S    L K E   SF       E +S +SS +T
Sbjct:    1 MHHIEVSIPSFRSEGSTVEKGYTVFKIEVLMCGR-QHTVEKRYSEFHALHKMLKKIIKPPEIPSKHVRNWVPKVLEQRRQGLELYLQTIIMENEV-LPKIFLDFLNIRHFPS----LPKTESCGSF-------ETESDESSKLT 131          
BLAST of Sorting nexin 22 vs. Ensembl Zebrafish
Match: snx22 (sorting nexin 22 [Source:ZFIN;Acc:ZDB-GENE-060825-154])

HSP 1 Score: 58.151 bits (139), Expect = 5.683e-11
Identity = 33/106 (31.13%), Postives = 56/106 (52.83%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQ 369
            I + I S  + + E       +++++    +  H V RR+ EF+ L++K+ K+++V DFPS+       K LE R+   E Y+   L Q    +P+ELL+FL  K 
Sbjct:   11 IEVFIPSLMREVDETGKLRKLFRVEILFNGR-KHFVLRRHGEFQTLHRKVKKILRVPDFPSKRNQHLRTKPLEQRRQELEDYIQVILYQNDV-VPQELLDFLQVKH 114          
BLAST of Sorting nexin 22 vs. Ensembl Zebrafish
Match: snx22 (sorting nexin 22 [Source:ZFIN;Acc:ZDB-GENE-060825-154])

HSP 1 Score: 59.6918 bits (143), Expect = 7.962e-11
Identity = 45/168 (26.79%), Postives = 72/168 (42.86%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSFL------------KVVSIS------EIKSHDSSIITCGVLDALYS 501
            I + I S  + + E       +++++    +  H V RR+ EF+ L++K+ K+++V DFPS+       K LE R+   E Y+   L Q    +P+ELL+FL  K            E  S +             +VV  S      E +S    I+  GVL   Y 
Sbjct:   11 IEVFIPSLMREVDETGKLRKLFRVEILFNGR-KHFVLRRHGEFQTLHRKVKKILRVPDFPSKRNQHLRTKPLEQRRQELEDYIQVILYQNDV-VPQELLDFLQVKHFHPTSKNCSSDENQSDYCREQEYRYQSFHQRVVGFSADPYQLESRSDLPDIVVAGVLQGFYP 176          
BLAST of Sorting nexin 22 vs. Ensembl Xenopus
Match: snx22 (sorting nexin 22 [Source:NCBI gene;Acc:549386])

HSP 1 Score: 65.4698 bits (158), Expect = 6.569e-13
Identity = 34/106 (32.08%), Postives = 59/106 (55.66%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQ 369
            I + I S    + +++ ++T +++DV    +  H+++RRY+EF  L+K L K  KV DFP + +  W  K  E R+   E Y+   L  +   +P+ELL+FL  + 
Sbjct:    2 IDVYIPSVGHQVYKSDKTHTVFRVDVLFNGR-RHTLDRRYSEFHALHKLLKKTCKVPDFPPKRVPNWMPKVQEQRRQGLEAYIQGVL-WYNTDVPKELLDFLKVRH 105          
BLAST of Sorting nexin 22 vs. Ensembl Xenopus
Match: snx24 (sorting nexin 24 [Source:NCBI gene;Acc:548879])

HSP 1 Score: 59.6918 bits (143), Expect = 7.685e-11
Identity = 34/95 (35.79%), Postives = 54/95 (56.84%), Query Frame = 1
Query:   97 NSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSV 381
            +S    ++I+V V  +  H VE+RY+EF  L+KKL K IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   S+
Sbjct:   26 HSIIPVFRIEVLVNGR-RHFVEKRYSEFHALHKKLKKSIKTPEIPSKHVRNWVPKVLEQRRQGLEAYLQAVIFENE-ELPKIFLDFLNVRHLPSL 118          
BLAST of Sorting nexin 22 vs. Ensembl Mouse
Match: Snx24 (sorting nexing 24 [Source:MGI Symbol;Acc:MGI:1916476])

HSP 1 Score: 72.0182 bits (175), Expect = 9.572e-16
Identity = 45/123 (36.59%), Postives = 66/123 (53.66%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSF 420
            + + I SFR   S+    YT +KI+V +  +  H VE+RY+EF  L+KKL K IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   S    L K E   SF
Sbjct:    1 MEVYIPSFRHEDSDLERGYTVFKIEVLMNGR-KHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENE-ELPKLFLDFLNVRHLPS----LPKAESCGSF 117          
BLAST of Sorting nexin 22 vs. Ensembl Mouse
Match: Snx24 (sorting nexing 24 [Source:MGI Symbol;Acc:MGI:1916476])

HSP 1 Score: 72.0182 bits (175), Expect = 9.572e-16
Identity = 45/123 (36.59%), Postives = 66/123 (53.66%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSF 420
            + + I SFR   S+    YT +KI+V +  +  H VE+RY+EF  L+KKL K IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   S    L K E   SF
Sbjct:    1 MEVYIPSFRHEDSDLERGYTVFKIEVLMNGR-KHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENE-ELPKLFLDFLNVRHLPS----LPKAESCGSF 117          
BLAST of Sorting nexin 22 vs. Ensembl Mouse
Match: Snx22 (sorting nexin 22 [Source:MGI Symbol;Acc:MGI:2685966])

HSP 1 Score: 60.4622 bits (145), Expect = 2.758e-11
Identity = 32/91 (35.16%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  103 SYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYA--LNQFQFGIPEELLNFLNYKQ 369
             +  ++++V    +  H+V RRY+EF  L+K++ K  KV DFPS+ +  W  + LE R+   E Y+     LNQ    +P+ELL FL  + 
Sbjct:   23 GHMVFQVEVLYSGR-RHTVPRRYSEFHALHKRIKKRYKVPDFPSKRLPNWRTRGLEQRRQGLETYIQGILYLNQ---DVPKELLEFLRLRH 109          
BLAST of Sorting nexin 22 vs. UniProt/SwissProt
Match: sp|Q5U2S5|SNX24_RAT (Sorting nexin-24 OS=Rattus norvegicus OX=10116 GN=Snx24 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 6.696e-15
Identity = 45/123 (36.59%), Postives = 66/123 (53.66%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSF 420
            + + I SFR   S+    YT +KI+V +  +  H VE+RY+EF  L+KKL K IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   S    L K E   SF
Sbjct:    1 MEVYIPSFRHEDSDLERGYTVFKIEVLMNGR-KHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENE-ELPKLFLDFLNVRHLPS----LPKAESCGSF 117          
BLAST of Sorting nexin 22 vs. UniProt/SwissProt
Match: sp|Q9CRB0|SNX24_MOUSE (Sorting nexin-24 OS=Mus musculus OX=10090 GN=Snx24 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 6.696e-15
Identity = 45/123 (36.59%), Postives = 66/123 (53.66%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSF 420
            + + I SFR   S+    YT +KI+V +  +  H VE+RY+EF  L+KKL K IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   S    L K E   SF
Sbjct:    1 MEVYIPSFRHEDSDLERGYTVFKIEVLMNGR-KHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENE-ELPKLFLDFLNVRHLPS----LPKAESCGSF 117          
BLAST of Sorting nexin 22 vs. UniProt/SwissProt
Match: sp|Q9Y343|SNX24_HUMAN (Sorting nexin-24 OS=Homo sapiens OX=9606 GN=SNX24 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.074e-14
Identity = 45/123 (36.59%), Postives = 66/123 (53.66%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSF 420
            + + I SFR   S+    YT +KI+V +  +  H VE+RY+EF  L+KKL K IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   S    L K E   SF
Sbjct:    1 MEVYIPSFRYEESDLERGYTVFKIEVLMNGR-KHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENE-ELPKLFLDFLNVRHLPS----LPKAESCGSF 117          
BLAST of Sorting nexin 22 vs. UniProt/SwissProt
Match: sp|Q17QS1|SNX24_BOVIN (Sorting nexin-24 OS=Bos taurus OX=9913 GN=SNX24 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 4.514e-14
Identity = 45/123 (36.59%), Postives = 66/123 (53.66%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSF 420
            + + I SFR   S+    YT +KI+V +  +  H VE+RY+EF  L+KKL K IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   S    L K E   SF
Sbjct:    1 MEVYIPSFRYEESDLERGYTVFKIEVLMNGR-KHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENE-ELPKLFLDFLNVRHLPS----LPKTESYGSF 117          
BLAST of Sorting nexin 22 vs. UniProt/SwissProt
Match: sp|Q96L94|SNX22_HUMAN (Sorting nexin-22 OS=Homo sapiens OX=9606 GN=SNX22 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.257e-12
Identity = 46/153 (30.07%), Postives = 72/153 (47.06%), Query Frame = 1
Query:  103 SYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYA--LNQFQFGIPEELLNFLNYKQ------------------ADSVKSVLKKPEMSSSFLKVVSISEIKSHDSSIITCGVLDALYS 501
            S+  ++++V    +  H+V RRY+EF  L+K++ KL KV DFPS+ +  W  + LE R+   E Y+     LNQ    +P+ELL FL  +                    DS     ++P +S      V     +S  + ++  GVL  LYS
Sbjct:   23 SHMVFRVEVLCSGR-RHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQ---EVPKELLEFLRLRHFPTDPKASNWGTLREFLPGDSSSQQHQRPVLSFHVDPYVCNPSPESLPNVVVN-GVLQGLYS 170          
BLAST of Sorting nexin 22 vs. TrEMBL
Match: A0A2T7NGL7 (PX domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_20779 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 4.705e-22
Identity = 55/164 (33.54%), Postives = 92/164 (56.10%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSV--------------KSVLKKPEMSSSFLKVVSISEIKSHDSSIITCGVLDALYS 501
            IR+ + SFRKV  E + ++T + +DVWV  +  H+VERRY EFE+L+K++ K+IK  +FP + +L+W+NK LE R++  E YL   +      IP  +L+FL  K  D                ++V+  PE  ++FL+ +    +    +  +T G+ D+ Y+
Sbjct:    3 IRVSVPSFRKV-KEEDETFTVFLVDVWVSGR-RHTVERRYTEFEDLHKQVKKMIKTPEFPPKKVLKWNNKVLEQRRHGLEAYLQGVVC--CEAIPRPVLHFLEIKTEDDGFEFDMVDHSHKVVHQAVITFPE--NAFLQDIHRGTLPDIVAEGVTIGLFDSDYT 160          
BLAST of Sorting nexin 22 vs. TrEMBL
Match: A0A433SQS5 (PX domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_020642 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 5.349e-21
Identity = 55/158 (34.81%), Postives = 93/158 (58.86%), Query Frame = 1
Query:   49 SIRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSFLKVVSIS-----EIKSHDS--SIITCGVLDALYS 501
            +I++ + SFRKV  +++ +YTA+ +DVWV S   H +E+RY+EFE+L++ L K+ K  +FP + +L+W+ K LE R+   + Y    L+Q    +P  LL FL    A++    ++  +  ++   V+ +      + K+ DS  +IIT GVL  LYS
Sbjct:    2 AIQVNVSSFRKV-KDDDETYTAFTVDVWV-SGIHHVIEKRYSEFEKLHQMLKKVAKTPEFPPKKVLKWNPKVLEQRRVGLDAYFQGLLDQET--LPHALLLFLEADSANNTIEFMQAADQKTTHQPVIVLDTSIYLQNKTDDSLPNIITEGVLVGLYS 155          
BLAST of Sorting nexin 22 vs. TrEMBL
Match: A0A2C9KNP0 (PX domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106078665 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.623e-20
Identity = 58/159 (36.48%), Postives = 89/159 (55.97%), Query Frame = 1
Query:   49 SIRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLK---KPEMSSSF---LKVVSISEIKSHDS--SIITCGVLDALYS 501
            S+++ I SFRKV  E +  +TA+ +DVW+  ++ H +E+RY+EFE+L+K+L K+IK  +FP + +L+W++K LE R+   + Y    L      IP  LL FL     D     +K   +P++S      L+  S  + K  DS   II  GV   LYS
Sbjct:    7 SLKVNIPSFRKV-KEGDEVFTAFTVDVWIAGRH-HVIEKRYSEFEDLHKQLKKVIKTPEFPPKKVLKWNSKVLEQRRIGLDTYFQGILENDP--IPNALLVFLETSILDQCFDFIKGEDEPQLSHQVIITLEADSFLKEKKKDSLPDIIKQGVTLGLYS 161          
BLAST of Sorting nexin 22 vs. TrEMBL
Match: K1PWQ0 (Sorting nexin-24 OS=Crassostrea gigas OX=29159 GN=CGI_10013035 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 5.028e-18
Identity = 58/159 (36.48%), Postives = 94/159 (59.12%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVW-VGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYL-TYALNQFQFGIPEELLNFLN-----YKQADSVKSVLKKPEMSS--SFLKVVSISEIKSHDSSIITCGVLDALYS 501
            IR+ I S+ KV+ +NN SYTA+ I+V  V +  + SV++RY+EFE L+K+L K IK  +FP + ++++SNK LE R+   + YL   AL +    IP+ LL+FL+     Y  +  +  V  +    S  +F   V + + ++    I++ GVL ALY+
Sbjct:    2 IRVSIPSYHKVVEDNNDSYTAFIIEVCIVATGKTLSVQKRYSEFEMLHKQLKKQIKTPEFPPKKMMKFSNKVLEQRRLALQTYLQGVALAE---KIPKILLHFLDVEQYMYHGSQELLDVSNRTTHQSMIAFPPEVYLQDNRNGSWDIVSAGVLAALYN 157          
BLAST of Sorting nexin 22 vs. TrEMBL
Match: V4A766 (PX domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_204046 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.069e-16
Identity = 61/164 (37.20%), Postives = 91/164 (55.49%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYK-QADSVKSV--LKKPEMSSSFLKVVSISEI----KSHDSSI---ITCGVLDALYS*IFS 513
            IR+ I SF+KV  +   +YT Y I+VW  S     VE+RY+EFEELNK+L KL+    FP + +L+W++K LE+R+   E YL   + +     P  LLNFLN K  +DS +S+  L +P      + VV   +     +  D  +   +  GVLDA+ +  +S
Sbjct:    3 IRVFIPSFKKV--KGPQTYTVYTIEVW-NSGRKQIVEKRYSEFEELNKELKKLMATPFFPPKKVLKWNSKVLEHRRQALEAYLKALVERNT--KPIILLNFLNIKIPSDSTESLDRLGRPR-KKCLVPVVGFPDDAFVNEDPDRPLSFAVVDGVLDAINTPCYS 160          
BLAST of Sorting nexin 22 vs. Ensembl Cavefish
Match: snx24 (sorting nexin 24 [Source:NCBI gene;Acc:103038979])

HSP 1 Score: 73.1738 bits (178), Expect = 2.312e-16
Identity = 40/113 (35.40%), Postives = 63/113 (55.75%), Query Frame = 1
Query:   43 MSSIRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSV 381
            M  I + I SFR   +     YT +KI+V +  +  H VE+RY+EF  L+K L K+IK  + PS+ +  W  K LE R++  E YL   + + +  +P+  L+FLN +   S+
Sbjct:    1 MHQISVSIPSFRSEDTAAERGYTVFKIEVLMSGR-QHMVEKRYSEFHALHKMLKKIIKPPEIPSKHVRNWVPKVLEQRRHGLELYLQTIIMENEI-LPKIFLDFLNIRHFPSL 111          
BLAST of Sorting nexin 22 vs. Ensembl Cavefish
Match: snx24 (sorting nexin 24 [Source:NCBI gene;Acc:103038979])

HSP 1 Score: 73.1738 bits (178), Expect = 3.207e-16
Identity = 40/113 (35.40%), Postives = 63/113 (55.75%), Query Frame = 1
Query:   43 MSSIRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSV 381
            M  I + I SFR   +     YT +KI+V +  +  H VE+RY+EF  L+K L K+IK  + PS+ +  W  K LE R++  E YL   + + +  +P+  L+FLN +   S+
Sbjct:    1 MHQISVSIPSFRSEDTAAERGYTVFKIEVLMSGR-QHMVEKRYSEFHALHKMLKKIIKPPEIPSKHVRNWVPKVLEQRRHGLELYLQTIIMENEI-LPKIFLDFLNIRHFPSL 111          
BLAST of Sorting nexin 22 vs. Ensembl Nematostella
Match: EDO46056 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR59])

HSP 1 Score: 56.225 bits (134), Expect = 2.712e-10
Identity = 36/103 (34.95%), Postives = 59/103 (57.28%), Query Frame = 1
Query:   52 IRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQ-FGIPEELLNFL 357
            IRI I  +RK+  E+   YT ++I V      +  VERRY+EF + NKKL ++I+    P ++IL  S++ LE R+   E YL   +  ++ +G+  E L+ +
Sbjct:    2 IRISIPKYRKIRDES-GEYTVFEIRVARPGGQAM-VERRYSEFSKFNKKLREIIEPPTLPPKTILNKSSRLLEARREGLEYYLQNLIGIYEVYGLLGEFLDMV 102          
BLAST of Sorting nexin 22 vs. Ensembl Medaka
Match: snx24 (sorting nexin 24 [Source:NCBI gene;Acc:101172180])

HSP 1 Score: 74.3294 bits (181), Expect = 9.313e-17
Identity = 45/117 (38.46%), Postives = 67/117 (57.26%), Query Frame = 1
Query:   43 MSSIRIRIDSFRKVLSENNS---SYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVK 384
            M  +R+ I SFR   SENNS    YT +KIDV +  +  +S+E+RY+EF  L+K L + IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   SV 
Sbjct:    1 MHPVRVSIPSFR---SENNSIEKGYTVFKIDVLMSGRL-YSIEKRYSEFHALHKMLKRSIKPPEMPSKHVRNWVPKVLEQRRQGLELYLQTIIMENEV-LPKIFLDFLNIRHFPSVP 112          
BLAST of Sorting nexin 22 vs. Ensembl Medaka
Match: snx24 (sorting nexin 24 [Source:NCBI gene;Acc:101172180])

HSP 1 Score: 74.3294 bits (181), Expect = 1.366e-16
Identity = 45/117 (38.46%), Postives = 67/117 (57.26%), Query Frame = 1
Query:   43 MSSIRIRIDSFRKVLSENNS---SYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVK 384
            M  +R+ I SFR   SENNS    YT +KIDV +  +  +S+E+RY+EF  L+K L + IK  + PS+ +  W  K LE R+   E YL   + + +  +P+  L+FLN +   SV 
Sbjct:    1 MHPVRVSIPSFR---SENNSIEKGYTVFKIDVLMSGRL-YSIEKRYSEFHALHKMLKRSIKPPEMPSKHVRNWVPKVLEQRRQGLELYLQTIIMENEV-LPKIFLDFLNIRHFPSVP 112          
BLAST of Sorting nexin 22 vs. Ensembl Medaka
Match: snx22 (sorting nexin 22 [Source:ZFIN;Acc:ZDB-GENE-060825-154])

HSP 1 Score: 43.5134 bits (101), Expect = 8.814e-6
Identity = 25/85 (29.41%), Postives = 44/85 (51.76%), Query Frame = 1
Query:   58 IRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYAL 312
            + I S  K + E+  S   ++++V    +  H V RR  +F+ L+KKL K+I   DFPS+       K +E R+   + Y+  ++
Sbjct:   11 VSIPSLEKEVDESGKSRKLFRVEVLFNER-KHYVLRRNGDFQSLHKKLKKIINTPDFPSKRNPHLRTKPMEQRRQELQVYVRSSI 94          
BLAST of Sorting nexin 22 vs. Planmine SMEST
Match: SMESG000017900.1 (SMESG000017900.1)

HSP 1 Score: 231.491 bits (589), Expect = 6.188e-76
Identity = 114/130 (87.69%), Postives = 122/130 (93.85%), Query Frame = 1
Query:   70 SFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSFLKVVSISEIKSHD 459
            +FRKVLSENN+SY+A+KIDV VGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSI RWSNKTLENRK+IF QYLTY+LNQFQFGIPEELLN LNYKQA+SVKSVL KPEMS SFL  VSISEIKSH+
Sbjct:    3 NFRKVLSENNNSYSAHKIDVCVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSIFRWSNKTLENRKFIFVQYLTYSLNQFQFGIPEELLNLLNYKQANSVKSVLTKPEMSISFLNAVSISEIKSHE 132          
BLAST of Sorting nexin 22 vs. Planmine SMEST
Match: SMESG000034870.1 (SMESG000034870.1)

HSP 1 Score: 219.935 bits (559), Expect = 1.634e-74
Identity = 117/153 (76.47%), Postives = 118/153 (77.12%), Query Frame = 1
Query:   43 MSSIRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSFLKVVSISEIKSHDSSIITCGVLDALYS 501
            MSSIRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKK                                   YALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSFLKVVSISEIK+HDSSIITCGVLDALYS
Sbjct:    1 MSSIRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKK-----------------------------------YALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSFLKVVSISEIKAHDSSIITCGVLDALYS 118          
BLAST of Sorting nexin 22 vs. Planmine SMEST
Match: SMESG000006895.1 (SMESG000006895.1)

HSP 1 Score: 208.764 bits (530), Expect = 5.050e-70
Identity = 102/111 (91.89%), Postives = 106/111 (95.50%), Query Frame = 1
Query:  127 VWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSFLKVVSISEIKSHD 459
            + VGSKYSHSVERRYNEFEELNKKL+KLIKVTDFPSRSILRWSNKTLENRK+IFEQYLTYALNQFQFGIPEELLN LNYKQADSVKSVL KPEMSSS LK VSISEIKSH+
Sbjct:    1 MCVGSKYSHSVERRYNEFEELNKKLNKLIKVTDFPSRSILRWSNKTLENRKFIFEQYLTYALNQFQFGIPEELLNLLNYKQADSVKSVLTKPEMSSSLLKAVSISEIKSHE 111          
BLAST of Sorting nexin 22 vs. Planmine SMEST
Match: SMESG000024585.1 (SMESG000024585.1)

HSP 1 Score: 199.134 bits (505), Expect = 2.586e-63
Identity = 98/103 (95.15%), Postives = 100/103 (97.09%), Query Frame = 1
Query:  151 HSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSFLKVVSISEIKSHD 459
            HSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRK+IFEQYLTYALNQFQFGIPEELLN LNYKQADSVKSVL KPEMSSSFLK VSISEIKSH+
Sbjct:  151 HSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKFIFEQYLTYALNQFQFGIPEELLNLLNYKQADSVKSVLTKPEMSSSFLKAVSISEIKSHE 253          
BLAST of Sorting nexin 22 vs. Planmine SMEST
Match: SMESG000069022.1 (SMESG000069022.1)

HSP 1 Score: 182.956 bits (463), Expect = 7.523e-60
Identity = 97/132 (73.48%), Postives = 105/132 (79.55%), Query Frame = 1
Query:   55 RIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELNKKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEELLNFLNYKQADSVKSVLKKPEMSSSFLKVVSISEIK 450
            ++ + +FRKVLSENN+SY AYKID  VGS+                 KLSKLIKVTDFPSRSILRWSNKTLENRK+ FEQYLTYALNQFQFGI EELLN LNYKQADSVKSVL KPEMSSSFLK VSISE+K
Sbjct:    8 KVLMLNFRKVLSENNNSYAAYKIDACVGSE-----------------KLSKLIKVTDFPSRSILRWSNKTLENRKFNFEQYLTYALNQFQFGIYEELLNLLNYKQADSVKSVLTKPEMSSSFLKAVSISEMK 122          
The following BLAST results are available for this feature:
BLAST of Sorting nexin 22 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNX244.281e-1633.33sorting nexin 24 [Source:HGNC Symbol;Acc:HGNC:2153... [more]
SNX244.281e-1633.33sorting nexin 24 [Source:HGNC Symbol;Acc:HGNC:2153... [more]
SNX242.236e-1536.59sorting nexin 24 [Source:HGNC Symbol;Acc:HGNC:2153... [more]
SNX222.871e-1338.46sorting nexin 22 [Source:HGNC Symbol;Acc:HGNC:1631... [more]
SNX224.700e-1330.07sorting nexin 22 [Source:HGNC Symbol;Acc:HGNC:1631... [more]
back to top
BLAST of Sorting nexin 22 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sorting nexin 22 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sorting nexin 22 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
snx241.229e-1635.42sorting nexin 24 [Source:ZFIN;Acc:ZDB-GENE-050913-... [more]
snx225.683e-1131.13sorting nexin 22 [Source:ZFIN;Acc:ZDB-GENE-060825-... [more]
snx227.962e-1126.79sorting nexin 22 [Source:ZFIN;Acc:ZDB-GENE-060825-... [more]
back to top
BLAST of Sorting nexin 22 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snx226.569e-1332.08sorting nexin 22 [Source:NCBI gene;Acc:549386][more]
snx247.685e-1135.79sorting nexin 24 [Source:NCBI gene;Acc:548879][more]
back to top
BLAST of Sorting nexin 22 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Snx249.572e-1636.59sorting nexing 24 [Source:MGI Symbol;Acc:MGI:19164... [more]
Snx249.572e-1636.59sorting nexing 24 [Source:MGI Symbol;Acc:MGI:19164... [more]
Snx222.758e-1135.16sorting nexin 22 [Source:MGI Symbol;Acc:MGI:268596... [more]
back to top
BLAST of Sorting nexin 22 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5U2S5|SNX24_RAT6.696e-1536.59Sorting nexin-24 OS=Rattus norvegicus OX=10116 GN=... [more]
sp|Q9CRB0|SNX24_MOUSE6.696e-1536.59Sorting nexin-24 OS=Mus musculus OX=10090 GN=Snx24... [more]
sp|Q9Y343|SNX24_HUMAN1.074e-1436.59Sorting nexin-24 OS=Homo sapiens OX=9606 GN=SNX24 ... [more]
sp|Q17QS1|SNX24_BOVIN4.514e-1436.59Sorting nexin-24 OS=Bos taurus OX=9913 GN=SNX24 PE... [more]
sp|Q96L94|SNX22_HUMAN2.257e-1230.07Sorting nexin-22 OS=Homo sapiens OX=9606 GN=SNX22 ... [more]
back to top
BLAST of Sorting nexin 22 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NGL74.705e-2233.54PX domain-containing protein OS=Pomacea canalicula... [more]
A0A433SQS55.349e-2134.81PX domain-containing protein OS=Elysia chlorotica ... [more]
A0A2C9KNP08.623e-2036.48PX domain-containing protein OS=Biomphalaria glabr... [more]
K1PWQ05.028e-1836.48Sorting nexin-24 OS=Crassostrea gigas OX=29159 GN=... [more]
V4A7662.069e-1637.20PX domain-containing protein OS=Lottia gigantea OX... [more]
back to top
BLAST of Sorting nexin 22 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snx242.312e-1635.40sorting nexin 24 [Source:NCBI gene;Acc:103038979][more]
snx243.207e-1635.40sorting nexin 24 [Source:NCBI gene;Acc:103038979][more]
back to top
BLAST of Sorting nexin 22 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sorting nexin 22 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sorting nexin 22 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO460562.712e-1034.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sorting nexin 22 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
snx249.313e-1738.46sorting nexin 24 [Source:NCBI gene;Acc:101172180][more]
snx241.366e-1638.46sorting nexin 24 [Source:NCBI gene;Acc:101172180][more]
snx228.814e-629.41sorting nexin 22 [Source:ZFIN;Acc:ZDB-GENE-060825-... [more]
back to top
BLAST of Sorting nexin 22 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017900.16.188e-7687.69SMESG000017900.1[more]
SMESG000034870.11.634e-7476.47SMESG000034870.1[more]
SMESG000006895.15.050e-7091.89SMESG000006895.1[more]
SMESG000024585.12.586e-6395.15SMESG000024585.1[more]
SMESG000069022.17.523e-6073.48SMESG000069022.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028641 ID=SMED30028641|Name=Sorting nexin 22|organism=Schmidtea mediterranea sexual|type=transcript|length=559bp
GTTAAAGCTATCTCACAAATGACCTAAATATATTTTGAATAAATGTCCTC
TATTAGAATAAGAATTGATAGTTTTAGAAAGGTTTTATCTGAAAACAATA
GTTCCTATACTGCTTATAAAATTGATGTGTGGGTTGGAAGTAAATATAGT
CATTCCGTCGAAAGAAGATATAACGAATTTGAAGAATTAAATAAGAAGTT
AAGTAAATTGATCAAAGTCACAGATTTCCCGTCTAGATCGATTTTGAGAT
GGTCAAATAAAACTCTGGAAAACAGGAAATATATTTTTGAACAATATTTA
ACATACGCACTCAATCAGTTTCAATTTGGTATTCCTGAAGAATTGCTGAA
CTTTTTAAATTATAAACAAGCCGATTCGGTAAAATCCGTTTTAAAAAAAC
CTGAAATGTCTAGCTCATTTTTGAAAGTGGTTTCGATTTCAGAAATAAAA
TCACATGATAGTAGCATAATAACCTGTGGGGTTCTCGATGCTCTTTATTC
ATAGATATTTTCTTAATATTTTGATTTTAATATTCGACTTTTGATCATTT
TTACGGAAG
back to top

protein sequence of SMED30028641-orf-1

>SMED30028641-orf-1 ID=SMED30028641-orf-1|Name=SMED30028641-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=154bp
MSSIRIRIDSFRKVLSENNSSYTAYKIDVWVGSKYSHSVERRYNEFEELN
KKLSKLIKVTDFPSRSILRWSNKTLENRKYIFEQYLTYALNQFQFGIPEE
LLNFLNYKQADSVKSVLKKPEMSSSFLKVVSISEIKSHDSSIITCGVLDA
LYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000070intestinal phagocyte
PLANA:0000240body wall musculature
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036871PX_dom_sf
IPR001683Phox
Vocabulary: molecular function
TermDefinition
GO:0035091phosphatidylinositol binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001683Phox homologous domainPFAMPF00787PXcoord: 12..107
e-value: 9.9E-11
score: 41.6
IPR001683Phox homologous domainPROSITEPS50195PXcoord: 3..112
score: 13.079
IPR036871PX domain superfamilyGENE3DG3DSA:3.30.1520.10coord: 1..112
e-value: 4.1E-22
score: 80.2
IPR036871PX domain superfamilySUPERFAMILYSSF64268PX domaincoord: 4..109
NoneNo IPR availablePANTHERPTHR15813:SF8SORTING NEXIN-22coord: 16..111
NoneNo IPR availablePANTHERPTHR15813SORTING NEXIN-22 AND 24coord: 16..111