C2H2-type domain-containing protein

Overview
NameC2H2-type domain-containing protein
Smed IDSMED30028626
Length (bp)1449
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2H2-type domain-containing protein (SMED30028626) t-SNE clustered cells

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30028626) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2H2-type domain-containing protein (SMED30028626) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30028626) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028626

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30028626SMESG000019280.1 SMESG000019279.1 dd_Smed_v4_10324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30028626SMESG000019280.1 SMESG000019279.1 dd_Smed_v4_10324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30028626SMESG000019280.1 SMESG000019279.1 dd_Smed_v4_10324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30028626SMESG000019280.1 SMESG000019279.1 dd_Smed_v6_10324_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30028626SMESG000019280.1 SMESG000019279.1 dd_Smed_v4_10324_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testis primordiumSMED30028626SMESG000019280.1 Contig7447_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: FAM221A (family with sequence similarity 221 member A [Source:HGNC Symbol;Acc:HGNC:27977])

HSP 1 Score: 318.931 bits (816), Expect = 5.689e-106
Identity = 147/284 (51.76%), Postives = 195/284 (68.66%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREK 938
            M +LT     A+AVDEYLEY+RIVG+DDGG LFTPE+YEEYKRKV+P+R+ NR+F+SW +P GMDC L GP+T CFC HR  QHKTD + +P+  PI++PCQ  GC+C++Y Y+     QP RC CKH A +H+ +  + C + + KCSG+ + +TC CG PA+ H  ++ETK+ER+A+  P+GQD PY  MGG+TGFSSLA GY RLD SG+G PS E+L  PIT+ D PFL+    +         D     +     +S  RRP E ++ F+ERRYQER K
Sbjct:    1 MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKHFADQHSAAPGFTCNTCS-KCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDSGIGVPSVEFLESPITAVDSPFLKAFQASSSSSPETLTD-----VGTSSQVSSLRRPEEDDMAFFERRYQERMK 278          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: FAM221A (family with sequence similarity 221 member A [Source:HGNC Symbol;Acc:HGNC:27977])

HSP 1 Score: 280.411 bits (716), Expect = 1.881e-91
Identity = 134/284 (47.18%), Postives = 178/284 (62.68%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREK 938
            M +LT     A+AVDEYLEY+RIVG+DDGG LFTPE+YEEYKRKV+P+R+ NR+F+SW +P GMDC L GP+T CFC HR  QHKTD + +P+  PI++PCQ  GC+C++Y Y+     QP RC CKH A +H+ +  + C + + KCSG+ + +TC CG PA+ H  ++ETK+ER+A+  P+GQD PY  MGG+TGFSSLA GY RLD SG                                         ++     +S  RRP E ++ F+ERRYQER K
Sbjct:    1 MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKHFADQHSAAPGFTCNTCS-KCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDSG-----------------------------------------IVGTSSQVSSLRRPEEDDMAFFERRYQERMK 242          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: FAM221A (family with sequence similarity 221 member A [Source:HGNC Symbol;Acc:HGNC:27977])

HSP 1 Score: 199.904 bits (507), Expect = 1.295e-60
Identity = 94/205 (45.85%), Postives = 130/205 (63.41%), Query Frame = 3
Query:  324 RLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREK 938
            R  QHKTD + +P+  PI++PCQ  GC+C++Y Y+     QP RC CKH A +H+ +  + C + + KCSG+ + +TC CG PA+ H  ++ETK+ER+A+  P+GQD PY  MGG+TGFSSLA GY RLD SG+G PS E+L  PIT+ D PFL+    +         D     +     +S  RRP E ++ F+ERRYQER K
Sbjct:   22 RYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKHFADQHSAAPGFTCNTCS-KCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDSGIGVPSVEFLESPITAVDSPFLKAFQASSSSSPETLTD-----VGTSSQVSSLRRPEEDDMAFFERRYQERMK 220          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: FAM221A (family with sequence similarity 221 member A [Source:HGNC Symbol;Acc:HGNC:27977])

HSP 1 Score: 161.384 bits (407), Expect = 2.250e-46
Identity = 81/205 (39.51%), Postives = 113/205 (55.12%), Query Frame = 3
Query:  324 RLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREK 938
            R  QHKTD + +P+  PI++PCQ  GC+C++Y Y+     QP RC CKH A +H+ +  + C + + KCSG+ + +TC CG PA+ H  ++ETK+ER+A+  P+GQD PY  MGG+TGFSSLA GY RLD SG                                         ++     +S  RRP E ++ F+ERRYQER K
Sbjct:   22 RYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKHFADQHSAAPGFTCNTCS-KCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDSG-----------------------------------------IVGTSSQVSSLRRPEEDDMAFFERRYQERMK 184          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: FAM221A (family with sequence similarity 221 member A [Source:HGNC Symbol;Acc:HGNC:27977])

HSP 1 Score: 127.487 bits (319), Expect = 8.238e-35
Identity = 55/97 (56.70%), Postives = 74/97 (76.29%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPI 377
            M +LT     A+AVDEYLEY+RIVG+DDGG LFTPE+YEEYKRKV+P+R+ NR+F+SW +P GMDC L GP+T CFC HR++   + +  + ++  I
Sbjct:    1 MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRVLLCHSGWSAVARSWLI 97          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: fam221a (family with sequence similarity 221 member A [Source:ZFIN;Acc:ZDB-GENE-050320-27])

HSP 1 Score: 244.973 bits (624), Expect = 1.878e-78
Identity = 109/214 (50.93%), Postives = 154/214 (71.96%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMG 728
            M+K+  +  AA++V+ YLEYKRIVG+DDGG LF+ ++Y++YK  V+P R+ NR+++S+  P  +DC + GP+T CFC HR  QH+TD++E+PK RP+ +PC+  GC+C SY Y+     +P RC CKH  +EH     +LC  K   C+GY++ + C CG P + H  +IET+EER+ARGHP+G+  PY  MGG+TGFSSLA GY RLDPSG+G
Sbjct:    1 MAKIHIDKLAANSVEAYLEYKRIVGEDDGGRLFSEDEYKKYKETVVPGRIQNRLYVSFGVPGQIDCKVIGPETTCFCTHRYKQHRTDYEELPKERPVLLPCRVKGCQCASYEYVHINGSKPVRCRCKHTTSEHKEDARHLC-KKCTHCTGYRSPFPCGCGEPGYTHVTLIETREERIARGHPVGRAVPYAAMGGLTGFSSLAEGYLRLDPSGIG 213          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: fam221a (family with sequence similarity 221 member A [Source:ZFIN;Acc:ZDB-GENE-050320-27])

HSP 1 Score: 244.973 bits (624), Expect = 1.878e-78
Identity = 109/214 (50.93%), Postives = 154/214 (71.96%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMG 728
            M+K+  +  AA++V+ YLEYKRIVG+DDGG LF+ ++Y++YK  V+P R+ NR+++S+  P  +DC + GP+T CFC HR  QH+TD++E+PK RP+ +PC+  GC+C SY Y+     +P RC CKH  +EH     +LC  K   C+GY++ + C CG P + H  +IET+EER+ARGHP+G+  PY  MGG+TGFSSLA GY RLDPSG+G
Sbjct:    1 MAKIHIDKLAANSVEAYLEYKRIVGEDDGGRLFSEDEYKKYKETVVPGRIQNRLYVSFGVPGQIDCKVIGPETTCFCTHRYKQHRTDYEELPKERPVLLPCRVKGCQCASYEYVHINGSKPVRCRCKHTTSEHKEDARHLC-KKCTHCTGYRSPFPCGCGEPGYTHVTLIETREERIARGHPVGRAVPYAAMGGLTGFSSLAEGYLRLDPSGIG 213          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: fam221a (family with sequence similarity 221 member A [Source:ZFIN;Acc:ZDB-GENE-050320-27])

HSP 1 Score: 244.973 bits (624), Expect = 1.878e-78
Identity = 109/214 (50.93%), Postives = 154/214 (71.96%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMG 728
            M+K+  +  AA++V+ YLEYKRIVG+DDGG LF+ ++Y++YK  V+P R+ NR+++S+  P  +DC + GP+T CFC HR  QH+TD++E+PK RP+ +PC+  GC+C SY Y+     +P RC CKH  +EH     +LC  K   C+GY++ + C CG P + H  +IET+EER+ARGHP+G+  PY  MGG+TGFSSLA GY RLDPSG+G
Sbjct:    1 MAKIHIDKLAANSVEAYLEYKRIVGEDDGGRLFSEDEYKKYKETVVPGRIQNRLYVSFGVPGQIDCKVIGPETTCFCTHRYKQHRTDYEELPKERPVLLPCRVKGCQCASYEYVHINGSKPVRCRCKHTTSEHKEDARHLC-KKCTHCTGYRSPFPCGCGEPGYTHVTLIETREERIARGHPVGRAVPYAAMGGLTGFSSLAEGYLRLDPSGIG 213          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: rprd1b (regulation of nuclear pre-mRNA domain containing 1B [Source:Xenbase;Acc:XB-GENE-949983])

HSP 1 Score: 241.506 bits (615), Expect = 1.397e-76
Identity = 113/239 (47.28%), Postives = 155/239 (64.85%), Query Frame = 3
Query:  228 MRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREKKK 944
            MR+ NR+++SW +P GMDC L GP+T CFC HR  QHKTDF E+PK RP+ +PC+   C CKS+HY+     +P RC CKH A EH+ +  Y CT +  KCSG+ +S+TC C  PA+ H  ++ETKEER+A+G P+G D P+  MGG+TGFSSLA GY RLD SG GAPS  +L    +   HPFL+M+ + I   K+        ++     +S  R   + ++ ++ERRYQER  K+
Sbjct:    1 MRLQNRLYVSWRSPTGMDCKLVGPETPCFCTHRYKQHKTDFQELPKERPLLLPCRVSKCACKSFHYIPLNGSRPIRCRCKHFADEHSVAGTYHCT-QCTKCSGFHSSFTCGCSQPAYTHDTVVETKEERLAQGKPVGHDVPFAAMGGLTGFSSLAEGYMRLDESGTGAPSTSFLESSESGTSHPFLKMYYQPI---KVQAVSEPSGIVTQ---VSNMRISEDDDMAYFERRYQERLLKE 232          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Fam221a (family with sequence similarity 221, member A [Source:MGI Symbol;Acc:MGI:2442161])

HSP 1 Score: 324.709 bits (831), Expect = 2.037e-108
Identity = 157/308 (50.97%), Postives = 212/308 (68.83%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLR-MHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREK-----KKYMKVNPVRRIEPSSKP 992
            M +LT     A AVDEYLEY+RIVG+DDGG LFTPE+YEEYK+KV+PMR+ NR+F+SW +P GMDC L GP+T CFC HR  QHKTDF+ +P+ RPI +PC+  GC+CK+YHY+     QP RC CKH A +H+ +  + C + + KCSG+ + YTC CG PA+ H  ++ET++ER+A+G P+G+D PY  MGG+TGFSSLA GY RLD SG+GAPS E L+  +++ DHPFLR MH  +    +      E   +     +S  R+P E ++ ++ER+YQER K     K+  KV P+    PS+KP
Sbjct:    1 MERLTLPPGGAEAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKKKVLPMRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDFETIPQQRPIALPCRVSGCRCKAYHYVPLNGTQPIRCRCKHFADQHSAALGFTCNACS-KCSGFHSCYTCACGQPAYAHDTVVETRQERLAQGKPVGRDVPYAAMGGLTGFSSLAEGYMRLDDSGIGAPSVEVLDSAVSAMDHPFLRAMHAPSTSSPQPLAGGNE---VGPSTQLSSLRKPEEDDMAYFERQYQERIKLEKAAKQKGKVPPL----PSTKP 300          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Fam221a (family with sequence similarity 221, member A [Source:MGI Symbol;Acc:MGI:2442161])

HSP 1 Score: 304.679 bits (779), Expect = 4.272e-101
Identity = 140/256 (54.69%), Postives = 184/256 (71.88%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLR-MHVKAIHD---YKMANNDREG 842
            M +LT     A AVDEYLEY+RIVG+DDGG LFTPE+YEEYK+KV+PMR+ NR+F+SW +P GMDC L GP+T CFC HR  QHKTDF+ +P+ RPI +PC+  GC+CK+YHY+     QP RC CKH A +H+ +  + C + + KCSG+ + YTC CG PA+ H  ++ET++ER+A+G P+G+D PY  MGG+TGFSSLA GY RLD SG+GAPS E L+  +++ DHPFLR MH  +          N D+ G
Sbjct:    1 MERLTLPPGGAEAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKKKVLPMRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDFETIPQQRPIALPCRVSGCRCKAYHYVPLNGTQPIRCRCKHFADQHSAALGFTCNACS-KCSGFHSCYTCACGQPAYAHDTVVETRQERLAQGKPVGRDVPYAAMGGLTGFSSLAEGYMRLDDSGIGAPSVEVLDSAVSAMDHPFLRAMHAPSTSSPQPLAGGNEDKAG 255          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Fam221a (family with sequence similarity 221, member A [Source:MGI Symbol;Acc:MGI:2442161])

HSP 1 Score: 83.9593 bits (206), Expect = 9.251e-20
Identity = 36/63 (57.14%), Postives = 45/63 (71.43%), Query Frame = 3
Query:  276 MDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHC 464
            MDC L GP+T CFC HR  QHKTDF+ +P+ RPI +PC+  GC+CK+YHY+     QP RC C
Sbjct:    1 MDCKLVGPETLCFCTHRYKQHKTDFETIPQQRPIALPCRVSGCRCKAYHYVPLNGTQPIRCRC 63          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Fam221b (family with sequence similarity 221, member B [Source:MGI Symbol;Acc:MGI:2441678])

HSP 1 Score: 60.8474 bits (146), Expect = 2.068e-9
Identity = 47/207 (22.71%), Postives = 83/207 (40.10%), Query Frame = 3
Query:   84 FMSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGM-DCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMV-------------KMSGQP----TRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTC-DCGLPAHQHRMIIETKEERVARGHPIGQDN 647
              S+    +K A  V+      R   DD    LF      ++++      +   I+I W  P  + DC   G +++CFC H L +H+   D       +++PC    C+C  + ++              + +  P     +C CKH   EHA +  + C  + C C  +++++ C  C     +H    ET + R     P G +N
Sbjct:  286 VTSRPVVPAKRAELVEMAKAVHREQFDDQVNNLF------QWEKDSTLKAIQTGIYIGWRCPHYLWDCFRIGDESKCFCGHLLREHQIISD-------LSVPCSVSQCRCLMFCFIPSRPEEVGEFWLKKRATFDPKAWRAQCRCKHTHEEHAATGAHPCRHRGCFCPSFESNFLCVACDRRWEEHETFFETGDTRRKGKRPYGANN 479          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C790|F221A_MOUSE (Protein FAM221A OS=Mus musculus OX=10090 GN=Fam221a PE=1 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 1.425e-107
Identity = 157/308 (50.97%), Postives = 212/308 (68.83%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLR-MHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREK-----KKYMKVNPVRRIEPSSKP 992
            M +LT     A AVDEYLEY+RIVG+DDGG LFTPE+YEEYK+KV+PMR+ NR+F+SW +P GMDC L GP+T CFC HR  QHKTDF+ +P+ RPI +PC+  GC+CK+YHY+     QP RC CKH A +H+ +  + C + + KCSG+ + YTC CG PA+ H  ++ET++ER+A+G P+G+D PY  MGG+TGFSSLA GY RLD SG+GAPS E L+  +++ DHPFLR MH  +    +      E   +     +S  R+P E ++ ++ER+YQER K     K+  KV P+    PS+KP
Sbjct:    1 MERLTLPPGGAEAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKKKVLPMRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDFETIPQQRPIALPCRVSGCRCKAYHYVPLNGTQPIRCRCKHFADQHSAALGFTCNACS-KCSGFHSCYTCACGQPAYAHDTVVETRQERLAQGKPVGRDVPYAAMGGLTGFSSLAEGYMRLDDSGIGAPSVEVLDSAVSAMDHPFLRAMHAPSTSSPQPLAGGNE---VGPSTQLSSLRKPEEDDMAYFERQYQERIKLEKAAKQKGKVPPL----PSTKP 300          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4V8D7|F221A_RAT (Protein FAM221A OS=Rattus norvegicus OX=10116 GN=Fam221a PE=2 SV=2)

HSP 1 Score: 320.472 bits (820), Expect = 5.417e-106
Identity = 150/302 (49.67%), Postives = 206/302 (68.21%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREKKKYMKVNPVRRIEPSSKP 992
            M +LT     A AVDEYLEY+RIVG+DDGG LFTPE+YEEYK+KV+PMR+ NR+F+SW +P GMDC L GP+T CFC HR  QHKTDF+ +P+ RPI++PC+  GC+CK+YHY+     QP RC CKH A +H+ +  + C + + KCSG+ + +TC CG PA+ H  ++ET++ER+A+G P+GQD PY  MGG+TGFSSLA GY RLD SG+GAPS + L+ P++  DHPFLR           + +  +   +     IS  R+P E ++ ++ER+YQER K +           PS++P
Sbjct:    1 MERLTLPPGGAQAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKKKVLPMRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDFETVPQQRPIDLPCRVTGCQCKAYHYVPLNGTQPIRCRCKHFADQHSPALGFTCNACS-KCSGFHSCFTCACGQPAYAHDTVVETRQERLAQGKPVGQDVPYAAMGGLTGFSSLAEGYMRLDDSGIGAPSVDVLDSPVSVMDHPFLRAMQPP------STSSPQPLAVGPSTQISSLRKPEEDDMAYFERQYQERIKMEKAAKKGKALPPPSTQP 295          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A4D161|F221A_HUMAN (Protein FAM221A OS=Homo sapiens OX=9606 GN=FAM221A PE=1 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 2.732e-105
Identity = 147/284 (51.76%), Postives = 195/284 (68.66%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREK 938
            M +LT     A+AVDEYLEY+RIVG+DDGG LFTPE+YEEYKRKV+P+R+ NR+F+SW +P GMDC L GP+T CFC HR  QHKTD + +P+  PI++PCQ  GC+C++Y Y+     QP RC CKH A +H+ +  + C + + KCSG+ + +TC CG PA+ H  ++ETK+ER+A+  P+GQD PY  MGG+TGFSSLA GY RLD SG+G PS E+L  PIT+ D PFL+    +         D     +     +S  RRP E ++ F+ERRYQER K
Sbjct:    1 MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKHFADQHSAAPGFTCNTCS-KCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDSGIGVPSVEFLESPITAVDSPFLKAFQASSSSSPETLTD-----VGTSSQVSSLRRPEEDDMAFFERRYQERMK 278          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q28J59|F221A_XENTR (Protein FAM221A OS=Xenopus tropicalis OX=8364 GN=fam221a PE=2 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 5.849e-100
Identity = 143/282 (50.71%), Postives = 190/282 (67.38%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQER 932
            M KL +    A A+DEY EY+RIVGDDDGG LFTPE+YEEYK+ V+PMR+ NR+++SW +P GMDC L GP+T CFC HR  QHKTDF E+PK RP+ +PC+   C CKS+HY+     +P RC CKH A EH+ +  Y CT +  KCSG+ +S+TC C  PA+ H  ++ETKEER+A+G P+G D P+  MGG+TGFSSLA GY RLD SG GAPS  +L    +   HPFL+M+ + I   K+        ++     +S  R   + ++ ++ERRYQER
Sbjct:    1 MEKLQFQG-GARAIDEYAEYRRIVGDDDGGKLFTPEEYEEYKKTVLPMRLQNRLYVSWRSPTGMDCKLVGPETPCFCTHRYKQHKTDFQELPKERPLLLPCRVSKCACKSFHYIPLNGSRPIRCRCKHFADEHSVAGTYHCT-QCTKCSGFHSSFTCGCSQPAYTHDTVVETKEERLAQGKPVGHDVPFAAMGGLTGFSSLAEGYMRLDESGAGAPSTSFLESSESGTSHPFLKMYYQPI---KVQAVSEPSGIVTQ---VSNMRISEDDDMAYFERRYQER 274          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2VPL9|F221A_XENLA (Protein FAM221A OS=Xenopus laevis OX=8355 GN=fam221a PE=2 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.601e-99
Identity = 148/286 (51.75%), Postives = 190/286 (66.43%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREKKK 944
            M KL +      AVDEY EY+RIVGDDDGG LFTPE+YE+YK+ V+PMR+ NR+++SW +P GMDC L GP+T CFC HR  QHKTDF E+PK RP+ +PC+   C CKS+HY+     +P RC CKH A EH+ +  Y CT K  KCSG+ +S+TC CG PA+ H  I+ETKEER+A+G P+G D PY  MGG+TGFSSLA GY RLD SG GAP   +L    +   HPFL+M+              E   ID +  +S  R   E ++ ++ERRYQER +K+
Sbjct:    1 MEKLQFQG-GDRAVDEYAEYRRIVGDDDGGKLFTPEEYEQYKKTVLPMRLQNRLYVSWRSPCGMDCKLVGPETACFCTHRYKQHKTDFKELPKERPVLLPCKVSKCPCKSFHYIPLNGSRPIRCRCKHFADEHSLAGTYHCT-KCTKCSGFHSSFTCGCGQPAYAHDTIVETKEERLAQGKPVGHDVPYASMGGLTGFSSLAEGYMRLDASGTGAPGASFLESSQSGASHPFLKMYDMPC----TVQGVSEPPGIDKQ--VSSMRLSEEDDMAYFERRYQERLRKE 278          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A267E379 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008728g2 PE=4 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 5.158e-134
Identity = 181/286 (63.29%), Postives = 223/286 (77.97%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNC-KCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREKK 941
            M ++  +S+A   V  Y EY+ IVGDDDGG +FTPE+YE YK++V+P R+ NR+++SWT+P GMDC+L GP+TECFCQHR  QHKTDF+++P +RPI +PCQ  GC C  Y YM K  GQP RCHCKH+ TEHA + PYLC  + C KC+GYKTS+TCDCGLPAHQH  ++ET EER ARGHP+GQ  PYK MGGITGFSSLAAGY RLDPSG GAPS E+L+Q IT DD+PFLR HV  I ++KM   D + A+ D+EE  S  RRPGESELD+YERRYQE++K+
Sbjct:    1 MERIQLSSQAQHDVQAYAEYRHIVGDDDGGKMFTPEEYEAYKKRVLPGRIKNRLYVSWTSPSGMDCVLVGPETECFCQHRYKQHKTDFEQLPSSRPIPLPCQVRGCPCPGYCYMPKNGGQPVRCHCKHLGTEHAPTPPYLCKRRECMKCAGYKTSFTCDCGLPAHQHETLVETGEEREARGHPVGQSVPYKAMGGITGFSSLAAGYARLDPSGRGAPSAEFLDQEITGDDNPFLRAHVGGIKEHKMRMGDMQAALKDSEERQSQMRRPGESELDYYERRYQEKQKR 286          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A1I8IAH8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008728g1 PE=4 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 5.968e-134
Identity = 181/285 (63.51%), Postives = 222/285 (77.89%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNC-KCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREK 938
            M ++  +S+A   V  Y EY+ IVGDDDGG +FTPE+YE YK++V+P R+ NR+++SWT+P GMDC+L GP+TECFCQHR  QHKTDF+++P +RPI +PCQ  GC C  Y YM K  GQP RCHCKH+ TEHA + PYLC  + C KC+GYKTS+TCDCGLPAHQH  ++ET EER ARGHP+GQ  PYK MGGITGFSSLAAGY RLDPSG GAPS E+L+Q IT DD+PFLR HV  I ++KM   D + A+ D+EE  S  RRPGESELD+YERRYQE++K
Sbjct:    1 MERIQLSSQAQHDVQAYAEYRHIVGDDDGGKMFTPEEYEAYKKRVLPGRIKNRLYVSWTSPSGMDCVLVGPETECFCQHRYKQHKTDFEQLPSSRPIPLPCQVRGCPCPGYCYMPKNGGQPVRCHCKHLGTEHAPTPPYLCKRRECMKCAGYKTSFTCDCGLPAHQHETLVETGEEREARGHPVGQSVPYKAMGGITGFSSLAAGYARLDPSGRGAPSAEFLDQEITGDDNPFLRAHVGGIKEHKMRMGDMQAALKDSEERQSQMRRPGESELDYYERRYQEKQK 285          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A3R7H6Z5 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=Fam221a PE=4 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 1.819e-124
Identity = 168/284 (59.15%), Postives = 216/284 (76.06%), Query Frame = 3
Query:  123 AVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGA-PSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREKKKYMKVNPVRR 971
            A+DEY EYKRIVG+DDGG +FTPEQYE YK+K IP+R+ NRIFISW NP G+DCIL GPQTECFCQHRLIQH+TD++ +P  RPI +PC+   C C S+H M K   +  RCHCKH+ATEH+   P+ C+  NC+C+G+KTS  CDCG+ AH+H M++ET  ER ARG P+G+  PY+ MGG++GF+SL  G  R+D SG G   ++E L  PIT++DHPFLRMH +A+H +K+A ND EGA  +  E  S  RRPGESELD+YERRYQEREK KY++  P+++
Sbjct:   16 AIDEYAEYKRIVGEDDGGTMFTPEQYEAYKKKYIPIRIKNRIFISWVNPNGVDCILAGPQTECFCQHRLIQHQTDYETLPSERPIPVPCKH--CSCTSFHVMPKFGSRIARCHCKHMATEHSVKAPFFCSKPNCQCAGFKTSMHCDCGIEAHKHHMVMETAAERHARGRPVGKPCPYQAMGGLSGFTSLTPGIVRMDESGAGGMLTQEELEAPITANDHPFLRMHAQAVHAHKLAQNDLEGAAKERPEVESQMRRPGESELDYYERRYQEREKAKYIRKPPLKK 297          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A1I8JLQ0 (C2H2-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 2.109e-122
Identity = 186/312 (59.62%), Postives = 231/312 (74.04%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNC-KCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREKKKYMKVNPVRRIEPSSKPVQRGGRKPL 1019
            M ++  +S+A   V  Y EY+ IVGDDDGG +FTPE+YE YK++V+P R+ NR+++SWT+P GMDC+L GP+TECFCQHR  QHKTDF+++P +RPI +PCQ  GC C  Y YM K  GQP RCHCKH+ TEHA + PYLC  + C KC+GYKTS+TCDCGLPAHQH  ++ET EER ARGHP+GQ  PYK MGGITGFSSLAAGY RLDPSG GAPS E+L+Q IT DD+PFLR HV  I ++KM   D + A+ D+EE  S  RRPGESELD+YERRYQE++K+          +  +  P + G RK L
Sbjct: 1229 MERIQLSSQAQHDVQAYAEYRHIVGDDDGGKMFTPEEYEAYKKRVLPGRIKNRLYVSWTSPSGMDCVLVGPETECFCQHRYKQHKTDFEQLPSSRPIPLPCQVRGCPCPGYCYMPKNGGQPVRCHCKHLGTEHAPTPPYLCKRRECMKCAGYKTSFTCDCGLPAHQHETLVETGEEREARGHPVGQSVPYKAMGGITGFSSLAAGYARLDPSGRGAPSAEFLDQEITGDDNPFLRAHVGGIKEHKMRMGDMQAALKDSEERQSQMRRPGESELDYYERRYQEKQKRAAAAPA-RPAVSGNEAPAKVGQRKQL 1539          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4S2M0V7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003516 PE=4 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 2.137e-122
Identity = 168/295 (56.95%), Postives = 216/295 (73.22%), Query Frame = 3
Query:   90 SKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGA-PSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREKKKYMKVNPVRR 971
            + L        A+D+Y EYKRIVG+DDGG +FTPEQYE YK K IP+R+ NRIFISW NP G+DCIL GPQTECFCQHRLIQH+TD++ +P  RPI +PC+   C C S+H M K   Q  RCHCKH+ATEH+   P+ C+  NC+C+G+KTS  CDCG+ AH+H M++ET  ER ARG P+G+  PY+ MGG++GF+SL  G  R+D SG G   ++E L  PIT++DHPFLRMH  A++ +K+A ND EGA  +  E  S  RRPGESELD+YERRYQEREK KY++  P+++
Sbjct:    5 APLKITQDQLKAIDDYTEYKRIVGEDDGGTMFTPEQYEAYKNKYIPIRIKNRIFISWVNPNGVDCILAGPQTECFCQHRLIQHQTDYETLPSERPIPVPCKH--CNCTSFHVMPKFGSQIARCHCKHMATEHSVKAPFFCSKPNCQCAGFKTSMHCDCGIEAHKHHMVMETAAERHARGRPVGKPCPYQAMGGLSGFTSLNPGIVRMDESGAGGMLTQEELEAPITANDHPFLRMHAPAVYAHKLAQNDLEGAAKERPEVESQMRRPGESELDYYERRYQEREKAKYIRRPPLKK 297          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: fam221a (family with sequence similarity 221 member A [Source:NCBI gene;Acc:103029571])

HSP 1 Score: 256.914 bits (655), Expect = 4.578e-82
Identity = 126/286 (44.06%), Postives = 180/286 (62.94%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREKKK 944
            M K+  +  AA +VD+Y+EY+RIVG+DDGG LF+  +YEEYKR+V+P+R  NR+++S+  P  +DC L GP+T CFC HR  QH+TDF+E+P+  PI +PC+  GC+C SY Y+ +   QP RC CKH+ ++H+ +  +LC   N  C+G+ + YTC CG P H H  ++ET+ +R ARG P+G D PY  MGG+TGFSSLA GY RLDPSG G  S   ++QP  ++                 A     GA     E     ++ GE  + + ERR++ER +K+
Sbjct:    1 MEKIRCSQSAADSVDQYVEYRRIVGEDDGGKLFSEAEYEEYKRRVLPIRARNRLYVSFGVPGKIDCKLIGPETPCFCSHRFKQHQTDFEELPEETPIALPCRVQGCRCGSYQYVHRSGSQPVRCRCKHLPSDHSEAAHHLCRKCN-TCTGFLSPYTCGCGEPGHAHVTLVETRAQREARGLPVGMDMPYAAMGGLTGFSSLAEGYLRLDPSGSGL-SPHDVSQPSQAEP--------------GTAPEGAYGAYRALSETSKDLKQTGEDVMGYNERRHKERVRKE 270          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO43591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY82])

HSP 1 Score: 310.071 bits (793), Expect = 1.838e-103
Identity = 146/280 (52.14%), Postives = 192/280 (68.57%), Query Frame = 3
Query:   96 LTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRL-IQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQER 932
            L  ++ AA+++DEY EYK+IVGDDDGG LF+PE+YEEYK+KV+P R+ NR+F+SWTNP G+DC L GP+T CFC+HRL +QHKTD+  +P TRPI +PC+  GCKC+ Y+++ K   QP RC CKH   +H+   P+ C  K CKC  +K+S+TC CG P H+H+ I+ETKEER +RGHP+GQD PY  MGGITGFSSL  GY RLD SG+G P  E LNQ     DH FL    KA     + +   +G           +R   E ++ ++E+RYQER
Sbjct:    8 LKLDASAAASIDEYWEYKKIVGDDDGGKLFSPEEYEEYKKKVLPQRLKNRLFVSWTNPDGLDCKLVGPETPCFCEHRLYVQHKTDYSSLPDTRPIPVPCKVAGCKCRHYNFVPKNGSQPIRCQCKHYTDDHSECSPHRCL-KGCKCIAFKSSFTCGCGFPTHEHKTIVETKEERKSRGHPVGQDVPYAAMGGITGFSSLMEGYMRLDDSGIGPPPLELLNQAPGPHDHAFL----KAYGGLSLEDGPGQG------RGAVARRTTEEEDMAWFEKRYQER 276          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO36642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI04])

HSP 1 Score: 58.5362 bits (140), Expect = 8.542e-10
Identity = 52/207 (25.12%), Postives = 83/207 (40.10%), Query Frame = 3
Query:  180 LFTPEQYEEYKRKVIPMRMANRIFISWTNPQ-GMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVK---------MSGQP--------TRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAH--QHRMIIETKEERVARGHPIGQDN-PYKGMGGITGFSSLAAGYERLDPSGMGAPS 737
            LF PE      R+     +   I+I W  P    DC+  G  ++CFC H L +H   +D       + +PC    CKCK + ++           +  +P         +C CKH   EH  +    C    C C  + +++ C C    H  +H  + ET+  R   G P G+   P+  + G+   +++  G E  D   M   S
Sbjct:   46 LFDPE------REAALEAIETGIYIGWRIPSFKHDCVRVGSSSKCFCGHLLSEHGR-YD----GNSVRVPCGMASCKCKVFAFIPSRAEDVGEYWLQRRPNFDPRSWRAKCKCKHTHEEHVATGMRQCRIAGCGCGRFFSNFLC-CACDKHWEEHETVFETERMRKDEGIPYGEAYLPFHELPGLR--NAVLTGREDDDSQYMALTS 238          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000019280.1 (SMESG000019280.1)

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 299/312 (95.83%), Postives = 302/312 (96.79%), Query Frame = 3
Query:   87 MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREKKKYMKVNPVRRIEPSSKPVQRGGRKPLE 1022
            M  +    +    +DEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREKKKYMKVNPVRRIEPSSKPVQRGGRKPLE
Sbjct:    1 MEHIRITGEQQRGIDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSGYKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSSLAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDREGAMIDNEEYISGQRRPGESELDFYERRYQEREKKKYMKVNPVRRIEPSSKPVQRGGRKPLE 312          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000035378.1 (SMESG000035378.1)

HSP 1 Score: 65.855 bits (159), Expect = 9.293e-12
Identity = 55/193 (28.50%), Postives = 84/193 (43.52%), Query Frame = 3
Query:  132 EYLEYKRIVGDDDG---GVLFTPEQYEEYKRKVIPMRMANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYMVKM---SGQ--------------PTRCHCKHIATEH-ATSEPYLCTSKNCKCSGYKTSYTCD-CGLPAHQHRMIIETKEERVARGHPIGQD 644
            + +   R + DD       LF PEQ    +     + +  R   S  N Q  DCI    + +CFC H L +H    D+     PI + C    C CK++ ++      SG+                +C CKH   +H A   P+ C    C CS + +++ C  C L  H+H+ ++ET+ ER   G PIG+D
Sbjct:   54 DVINVARAMNDDFAPKLKELFNPEQEACMEAIQSGLYICYRPLDSPMNQQ--DCIRISTKGKCFCSHLLKEH----DKFTGHEPI-LKCLQMNCPCKAFAWVPSRPEESGEFWLRKRRDFVAADYKAKCRCKHSHVDHKAHPPPHKCKVSGCGCSMFYSAFVCAACDLHWHRHQTVLETESERKIAGRPIGKD 239          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000048037.1 (SMESG000048037.1)

HSP 1 Score: 62.003 bits (149), Expect = 2.492e-10
Identity = 39/141 (27.66%), Postives = 60/141 (42.55%), Query Frame = 3
Query:  279 DCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIPCQAGGCKCKSYHYM-----------------VKMSGQPTRCHCKHIATEH-ATSEPYLCTSKNCKCSGYKTSYTC-DCGLPAHQHRMIIETKEERVARGHPIGQD 644
            DCI    +  CFC H L QH    D      P+ + C   GC CKS+ ++                    +    +C CKH   EH A   P+ C +K C C  + +++ C  C +  H+H  + ET+ ER     P+ ++
Sbjct:  115 DCIRISTKGRCFCSHSLAQH----DNFTGREPV-VKCVQPGCLCKSFAWVPSRPEESGEFWLPKRRDYNAAAYRAKCRCKHTHEEHEAYPPPHRCRTKGCGCQLFHSAFVCAACDMHWHRHSTVFETEAERKRDNRPVREE 250          
The following BLAST results are available for this feature:
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM221A5.689e-10651.76family with sequence similarity 221 member A [Sour... [more]
FAM221A1.881e-9147.18family with sequence similarity 221 member A [Sour... [more]
FAM221A1.295e-6045.85family with sequence similarity 221 member A [Sour... [more]
FAM221A2.250e-4639.51family with sequence similarity 221 member A [Sour... [more]
FAM221A8.238e-3556.70family with sequence similarity 221 member A [Sour... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fam221a1.878e-7850.93family with sequence similarity 221 member A [Sour... [more]
fam221a1.878e-7850.93family with sequence similarity 221 member A [Sour... [more]
fam221a1.878e-7850.93family with sequence similarity 221 member A [Sour... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rprd1b1.397e-7647.28regulation of nuclear pre-mRNA domain containing 1... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Fam221a2.037e-10850.97family with sequence similarity 221, member A [Sou... [more]
Fam221a4.272e-10154.69family with sequence similarity 221, member A [Sou... [more]
Fam221a9.251e-2057.14family with sequence similarity 221, member A [Sou... [more]
Fam221b2.068e-922.71family with sequence similarity 221, member B [Sou... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8C790|F221A_MOUSE1.425e-10750.97Protein FAM221A OS=Mus musculus OX=10090 GN=Fam221... [more]
sp|Q4V8D7|F221A_RAT5.417e-10649.67Protein FAM221A OS=Rattus norvegicus OX=10116 GN=F... [more]
sp|A4D161|F221A_HUMAN2.732e-10551.76Protein FAM221A OS=Homo sapiens OX=9606 GN=FAM221A... [more]
sp|Q28J59|F221A_XENTR5.849e-10050.71Protein FAM221A OS=Xenopus tropicalis OX=8364 GN=f... [more]
sp|Q2VPL9|F221A_XENLA1.601e-9951.75Protein FAM221A OS=Xenopus laevis OX=8355 GN=fam22... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E3795.158e-13463.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IAH85.968e-13463.51Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3R7H6Z51.819e-12459.15Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A1I8JLQ02.109e-12259.62C2H2-type domain-containing protein OS=Macrostomum... [more]
A0A4S2M0V72.137e-12256.95Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam221a4.578e-8244.06family with sequence similarity 221 member A [Sour... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO435911.838e-10352.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366428.542e-1025.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000019280.10.000e+095.83SMESG000019280.1[more]
SMESG000035378.19.293e-1228.50SMESG000035378.1[more]
SMESG000048037.12.492e-1027.66SMESG000048037.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028626 ID=SMED30028626|Name=C2H2-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1449bp
AAAAAATCTGAAAAATTAAAATTGATTTTGTTTTGTTTTTATAAGTGATT
ATTTCAATAGTTGCTACTAGAAACGAATATATTTTCATGAGTAAATTAAC
CTATAATAGCAAAGCAGCCAGTGCTGTTGATGAATATTTAGAGTATAAAA
GAATTGTTGGAGATGATGATGGAGGGGTGTTGTTTACGCCTGAACAATAT
GAGGAATATAAAAGAAAAGTTATTCCAATGAGAATGGCTAATAGGATTTT
TATAAGTTGGACTAATCCACAAGGCATGGATTGTATTCTTCCGGGTCCTC
AAACCGAATGTTTCTGTCAACACCGTCTAATTCAACACAAAACCGATTTC
GATGAAATGCCTAAAACGAGACCTATTAATATTCCCTGCCAGGCTGGTGG
ATGTAAATGTAAATCATATCATTACATGGTGAAAATGTCTGGTCAGCCGA
CACGTTGTCATTGTAAGCATATTGCCACCGAACATGCAACGAGTGAGCCT
TATTTGTGTACAAGTAAAAATTGTAAATGTAGCGGATATAAAACCAGCTA
TACTTGTGACTGTGGTCTTCCGGCTCATCAACATCGAATGATTATTGAAA
CTAAAGAAGAGAGAGTTGCCAGAGGTCATCCGATTGGACAGGATAATCCA
TACAAAGGTATGGGTGGAATAACAGGTTTCAGTTCTTTGGCAGCTGGTTA
TGAAAGGTTGGATCCAAGTGGAATGGGGGCTCCGTCTGAGGAATGGCTTA
ATCAACCAATCACAAGTGACGATCACCCGTTTTTGAGGATGCATGTCAAA
GCAATACATGACTACAAAATGGCAAATAACGACAGGGAAGGGGCCATGAT
CGATAATGAAGAATACATTTCCGGTCAACGAAGACCAGGAGAATCAGAAC
TCGATTTCTATGAAAGAAGGTATCAAGAAAGAGAAAAAAAGAAATATATG
AAAGTGAATCCAGTTCGAAGAATAGAGCCGTCATCCAAACCAGTCCAGAG
AGGCGGCCGGAAACCCCTTGAATAACGAAAAACATTTTCATCAAAGATAT
TTTCATCAACTCTATATTATCGACATCTCTATGCGTATTCTATATATCCA
TCTTTCTTCAACTGGATTTTGATATATCAATAATTCTTCGTAACCCAATA
AAATCAAATATGATAACTATTGTTGTTTTTAATATTCATTTTTGATGACG
CATTTGTAAATTTGTGAAAAGGTTGCCTTAAAATCGCGAATTTTAAATAG
TATATCATTGGAATAGTTCAGTTTCGAGTTTTTGAATTTTTATTTTATTA
ACTATTTACAGGGCTCTCATTGGTGCAATACAAGAATTATTTACATCCAT
TGGATGACATTCAAGCTTGAATTGGGTGTGCATGAGACAAGCGAGTAAAG
CAGTATAATATAATAAGGAAGCCCCAGGTTTATAATCCAAGAAAATGAC
back to top

protein sequence of SMED30028626-orf-1

>SMED30028626-orf-1 ID=SMED30028626-orf-1|Name=SMED30028626-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=313bp
MSKLTYNSKAASAVDEYLEYKRIVGDDDGGVLFTPEQYEEYKRKVIPMRM
ANRIFISWTNPQGMDCILPGPQTECFCQHRLIQHKTDFDEMPKTRPINIP
CQAGGCKCKSYHYMVKMSGQPTRCHCKHIATEHATSEPYLCTSKNCKCSG
YKTSYTCDCGLPAHQHRMIIETKEERVARGHPIGQDNPYKGMGGITGFSS
LAAGYERLDPSGMGAPSEEWLNQPITSDDHPFLRMHVKAIHDYKMANNDR
EGAMIDNEEYISGQRRPGESELDFYERRYQEREKKKYMKVNPVRRIEPSS
KPVQRGGRKPLE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005509calcium ion binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0008150biological_process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005575cellular_component
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR026755Fam221a/b
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026755Protein FAM221A/BPFAMPF14753FAM221coord: 20..214
e-value: 3.2E-83
score: 278.1
IPR026755Protein FAM221A/BPANTHERPTHR31214FAMILY NOT NAMEDcoord: 2..290
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 290..312
NoneNo IPR availablePANTHERPTHR31214:SF2PROTEIN FAM221Acoord: 2..290