PMS1 protein-like protein 1 DNA mismatch repair protein

Overview
NamePMS1 protein-like protein 1 DNA mismatch repair protein
Smed IDSMED30028625
Length (bp)2335
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PMS1 protein-like protein 1 DNA mismatch repair protein (SMED30028625) t-SNE clustered cells

Violin plots show distribution of expression levels for PMS1 protein-like protein 1 DNA mismatch repair protein (SMED30028625) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PMS1 protein-like protein 1 DNA mismatch repair protein (SMED30028625) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PMS1 protein-like protein 1 DNA mismatch repair protein (SMED30028625) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028625

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028625SMESG000066771.1 SmedASXL_009383SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
tail regionSMED30028625SMESG000066771.1 dd_Smed_v6_15640_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30028625SMESG000066771.1 dd_Smed_v4_15640_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Human
Match: PMS1 (PMS1 homolog 1, mismatch repair system component [Source:HGNC Symbol;Acc:HGNC:9121])

HSP 1 Score: 179.104 bits (453), Expect = 2.457e-46
Identity = 114/353 (32.29%), Postives = 185/353 (52.41%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGAS------KFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTY-MKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLP 1114
            MK+L  +TV+L+SSS +I+SV  V+KEL+ENS+DA A+ + + L+ +G DKIEV D+G G    D P++  ++ TSKI+   D+E + T+GFRGE L SIC I+ + I ++  ADN      +V D  G I++Q      QGT +T   +F NLPVR Q Y++    +  +K I   L    + + ++ I  +++  V+      S  K A+  V+G +       F+Y  E           ++ L+ F+P   D     T     E  ++F+N RP     + K +R  Y +K   ++   YP   L + +P + VDVN+ P+K ++ L N   +   ++  +   Y  LP
Sbjct:    1 MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADN--FSTQYVLDGSGHILSQKPSHLGQGTTVTALRLFKNLPVRKQFYSTAKKCKDEIKKIQDLLMSFGILKPDLRIVFVHNKAVIWQKSRVSDHKMALMSVLGTAVMNNMESFQYHSE---------ESQIYLSGFLP-KCDADHSFTSLSTPERSFIFINSRPVHQKDILKLIRHHYNLKCLKESTRLYPVFFLKIDVPTADVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGPLP 341          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Human
Match: PMS1 (PMS1 homolog 1, mismatch repair system component [Source:HGNC Symbol;Acc:HGNC:9121])

HSP 1 Score: 179.104 bits (453), Expect = 4.801e-46
Identity = 114/354 (32.20%), Postives = 186/354 (52.54%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGAS------KFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTY-MKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPN 1117
            MK+L  +TV+L+SSS +I+SV  V+KEL+ENS+DA A+ + + L+ +G DKIEV D+G G    D P++  ++ TSKI+   D+E + T+GFRGE L SIC I+ + I ++  ADN      +V D  G I++Q      QGT +T   +F NLPVR Q Y++    +  +K I   L    + + ++ I  +++  V+      S  K A+  V+G +       F+Y  E           ++ L+ F+P   D     T     E  ++F+N RP     + K +R  Y +K   ++   YP   L + +P + VDVN+ P+K ++ L N   +   ++  +   Y  LP+
Sbjct:    1 MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADN--FSTQYVLDGSGHILSQKPSHLGQGTTVTALRLFKNLPVRKQFYSTAKKCKDEIKKIQDLLMSFGILKPDLRIVFVHNKAVIWQKSRVSDHKMALMSVLGTAVMNNMESFQYHSE---------ESQIYLSGFLP-KCDADHSFTSLSTPERSFIFINSRPVHQKDILKLIRHHYNLKCLKESTRLYPVFFLKIDVPTADVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGPLPS 342          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Human
Match: PMS1 (PMS1 homolog 1, mismatch repair system component [Source:HGNC Symbol;Acc:HGNC:9121])

HSP 1 Score: 164.466 bits (415), Expect = 6.274e-42
Identity = 107/347 (30.84%), Postives = 172/347 (49.57%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTY-MKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLP 1114
            MK+L  +TV+L+SSS +I+SV  V+KEL+ENS+DA A+ + + L+ +G DKIEV D+G G    D P++  ++ TSKI+   D+E + T+GFRGE L SIC I+ + I ++  ADN      +V D  G I++Q      QGT +T   +F NLPVR Q Y++    +  +K I   L    + + ++                       I FV                    ++++ L+ F+P   D     T     E  ++F+N RP     + K +R  Y +K   ++   YP   L + +P + VDVN+ P+K ++ L N   +   ++  +   Y  LP
Sbjct:    1 MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADN--FSTQYVLDGSGHILSQKPSHLGQGTTVTALRLFKNLPVRKQFYSTAKKCKDEIKKIQDLLMSFGILKPDLR----------------------IVFV--------------------HNKIYLSGFLP-KCDADHSFTSLSTPERSFIFINSRPVHQKDILKLIRHHYNLKCLKESTRLYPVFFLKIDVPTADVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGPLP 302          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Human
Match: PMS1 (PMS1 homolog 1, mismatch repair system component [Source:HGNC Symbol;Acc:HGNC:9121])

HSP 1 Score: 164.466 bits (415), Expect = 6.274e-42
Identity = 107/347 (30.84%), Postives = 172/347 (49.57%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTY-MKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLP 1114
            MK+L  +TV+L+SSS +I+SV  V+KEL+ENS+DA A+ + + L+ +G DKIEV D+G G    D P++  ++ TSKI+   D+E + T+GFRGE L SIC I+ + I ++  ADN      +V D  G I++Q      QGT +T   +F NLPVR Q Y++    +  +K I   L    + + ++                       I FV                    ++++ L+ F+P   D     T     E  ++F+N RP     + K +R  Y +K   ++   YP   L + +P + VDVN+ P+K ++ L N   +   ++  +   Y  LP
Sbjct:    1 MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADN--FSTQYVLDGSGHILSQKPSHLGQGTTVTALRLFKNLPVRKQFYSTAKKCKDEIKKIQDLLMSFGILKPDLR----------------------IVFV--------------------HNKIYLSGFLP-KCDADHSFTSLSTPERSFIFINSRPVHQKDILKLIRHHYNLKCLKESTRLYPVFFLKIDVPTADVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGPLP 302          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Human
Match: PMS1 (PMS1 homolog 1, mismatch repair system component [Source:HGNC Symbol;Acc:HGNC:9121])

HSP 1 Score: 164.466 bits (415), Expect = 7.801e-42
Identity = 107/347 (30.84%), Postives = 172/347 (49.57%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTY-MKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLP 1114
            MK+L  +TV+L+SSS +I+SV  V+KEL+ENS+DA A+ + + L+ +G DKIEV D+G G    D P++  ++ TSKI+   D+E + T+GFRGE L SIC I+ + I ++  ADN      +V D  G I++Q      QGT +T   +F NLPVR Q Y++    +  +K I   L    + + ++                       I FV                    ++++ L+ F+P   D     T     E  ++F+N RP     + K +R  Y +K   ++   YP   L + +P + VDVN+ P+K ++ L N   +   ++  +   Y  LP
Sbjct:    1 MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADN--FSTQYVLDGSGHILSQKPSHLGQGTTVTALRLFKNLPVRKQFYSTAKKCKDEIKKIQDLLMSFGILKPDLR----------------------IVFV--------------------HNKIYLSGFLP-KCDADHSFTSLSTPERSFIFINSRPVHQKDILKLIRHHYNLKCLKESTRLYPVFFLKIDVPTADVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGPLP 302          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Celegans
Match: pms-2 (PMS (Post Meiotic Segregation) family [Source:UniProtKB/TrEMBL;Acc:G5EFG5])

HSP 1 Score: 129.798 bits (325), Expect = 8.934e-31
Identity = 93/369 (25.20%), Postives = 185/369 (50.14%), Query Frame = 2
Query:   80 KMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQ-----MYNSLFVLQKTLKSITTNLHHL-YLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASK----FKYFHELLKSETTEDNHELSLNLFVP----------------SSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFY 1102
            K+++++    + ++++ V+ S+   I++L++NSIDA ++ I I +K  G + IEV D+G G +  +   +C+ H TSK+++F+D + + T GFRGE L+++C +S++SI ++  A ++ +G    +D  G I+ + +   + GT I V+ +F  LPVR +            L  T++S      H+  L   NI+ K  N          T+S ++ +  + G ++     K    L+  +  + + E+     VP                SS +   G    D +   ++++N+RP E S +   +   Y +F   N  +YP +VL++ +P   +DVN+ P+K+ + L     +   ++ ++ + Y
Sbjct:    5 KIERISKEVAERLTTAQVVVSLSSAIRQLIDNSIDAGSTIIDIRVKNNGFESIEVQDNGSGIEARNFDALCKPHSTSKLTQFSDFDKLATLGFRGEALNALCTVSSVSIFTR--ASDTEIGTRLTYDHSGNIICRQSAARELGTTIIVNKLFETLPVRRKELERSQKREFVKLLSTVQSFALLCPHIKILCTNNINGKKTNLICTPGG---TTSIQDVVANLFGIARKIENSKIGSGLIPIQQNQPDVEIMTIHSVPMEEMHFFDLFKIRGFVSSCEHGCGRGTSDRQ---FVYINNRPVEYSRVCSVINDVYKQF---NKKQYPIIVLFIDVPPEKIDVNVTPDKKTVMLEKERHLLAVVRASMMKTY 362          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Celegans
Match: mlh-1 (MLH (MutL Homolog) family [Source:UniProtKB/TrEMBL;Acc:Q9XU10])

HSP 1 Score: 105.145 bits (261), Expect = 5.221e-23
Identity = 56/157 (35.67%), Postives = 94/157 (59.87%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVR 547
            +++L    V  +++  V++     IKELVENS+DA A+ I +N++  GL  ++V D+G G +  D  L+C+R  TSK+ +F D+  + T+GFRGE L+S+  ++ ++I+SK          N++  KM      +A   K GT IT +++F+NLP R
Sbjct:    4 IQRLPQDVVNRMAAGEVLARPCNAIKELVENSLDAGATEIMVNMQNGGLKLLQVSDNGKGIEREDFALVCERFATSKLQKFEDLMHMKTYGFRGEALASLSHVAKVNIVSKRADAKCAYQANFLDGKMTADTKPAA--GKNGTCITATDLFYNLPTR 158          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Fly
Match: Mlh1 (gene:FBgn0011659 transcript:FBtr0088790)

HSP 1 Score: 132.109 bits (331), Expect = 1.381e-31
Identity = 105/379 (27.70%), Postives = 179/379 (47.23%), Query Frame = 2
Query:   62 NYFKIFKMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKM-GQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDY---KENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNL----------RQFYESLPNNINEELPVAND 1150
             Y +   ++KL++  V  I++  +I      +KEL+ENS+DA ++ I + +K  GL  +++ D+G G   +D+ ++C+R  TSK++ F D+  I TFGFRGE L+SI  +++LSI +K   +       +   K+ GQ          QGT I + ++F+N+P R Q   S     + L  +    + ++  R    ++   D    L  P+ SSR E I  + GA+  K   ELL+    ++ ++      +          T  +Y   K    LF+N R  E + L  +V + Y  +  +    +P + + LTLP   +DVN+ P K ++      +I D I+  +          R FY+ L       LP A D
Sbjct:    3 EYLQPGVIRKLDEVVVNRIAAGEIIQRPANALKELLENSLDAQSTHIQVQVKAGGLKLLQIQDNGTGIRREDLAIVCERFTTSKLTRFEDLSQIATFGFRGEALASISHVAHLSIQTKTAKEKCGYKATYADGKLQGQ---PKPCAGNQGTIICIEDLFYNMPQRRQALRSPAEEFQRLSEVLAR-YAVHNPRVGFTLRKQGDAQPALRTPVASSRSENIRIIYGAAISK---ELLEFSHRDEVYKFEAECLI----------TQVNYSAKKCQMLLFINQRLVESTALRTSVDSIYATYLPR--GHHPFVYMSLTLPPQNLDVNVHPTKHEVHFLYQEEIVDSIKQQVEARLLGSNATRTFYKQL------RLPGAPD 356          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Fly
Match: Pms2 (gene:FBgn0011660 transcript:FBtr0087388)

HSP 1 Score: 129.413 bits (324), Expect = 1.751e-30
Identity = 103/362 (28.45%), Postives = 178/362 (49.17%), Query Frame = 2
Query:   80 KMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDDVPL--ICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVR---------------CQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTED---NHELSLNLFVPSSVDDKLGLTHCDY-----------------KENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSN 1054
            ++K +   TV  I S  V+ S+   +KELVENSIDA A+ + I LK  GL  +EV D+G G +++ L  +  ++ TSKI EF D+  + TFGFRGE LSS+CA+S++ I +++ + +  +G     D  G+I  +S      GT + ++N+F  LPVR               CQ+  +  ++ K ++ + +N  H     + I ++   D  V+ N+      ++A   V   S F    +L ++E   D     +L+       S +D   L   D+                 ++  + FVN RP +   + K +   Y ++   N+ + P + L +   +S VDVN+ P+KR++ ++N
Sbjct:   26 QIKAIGKDTVHKICSGQVVLSLAVAVKELVENSIDAGATLVEIKLKDQGLQSVEVSDNGSGVEEMNLEGMTAKYHTSKIREFVDLLGVETFGFRGEALSSLCALSDMVIQTRHKSTD--VGVKVELDHEGRIKKRSPCARGVGTTVLLANLFSTLPVRRRDFTRNIKKEFTKMCQILQAYCLVTKGVRILCSN--HTPKGAKTIVLQTHGDQEVMANISAIFGARQAADLVPLKSPFGQ-GQLTEAELRADLESGADLADTTSPQISTEDVERLNQADFQLEGFISSCRHGAGRSSRDRQFFFVNSRPCDPKNIAKVMNEVYHRY---NVQQQPFIYLNIITARSDVDVNLTPDKRQLLINN 379          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Fly
Match: Mlh1 (gene:FBgn0011659 transcript:FBtr0331379)

HSP 1 Score: 128.642 bits (322), Expect = 1.938e-30
Identity = 105/379 (27.70%), Postives = 179/379 (47.23%), Query Frame = 2
Query:   62 NYFKIFKMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKM-GQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDY---KENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNL----------RQFYESLPNNINEELPVAND 1150
             Y +   ++KL++  V  I++  +I      +KEL+ENS+DA ++ I + +K  GL  +++ D+G G   +D+ ++C+R  TSK++ F D+  I TFGFRGE L+SI  +++LSI +K   +       +   K+ GQ          QGT I + ++F+N+P R Q   S     + L  +    + ++  R    ++   D    L  P+ SSR E I  + GA+  K   ELL+    ++ ++      +          T  +Y   K    LF+N R  E + L  +V + Y  +  +    +P + + LTLP   +DVN+ P K ++      +I D I+  +          R FY+ L       LP A D
Sbjct:    3 EYLQPGVIRKLDEVVVNRIAAGEIIQRPANALKELLENSLDAQSTHIQVQVKAGGLKLLQIQDNGTGIRREDLAIVCERFTTSKLTRFEDLSQIATFGFRGEALASISHVAHLSIQTKTAKEKCGYKATYADGKLQGQ---PKPCAGNQGTIICIEDLFYNMPQRRQALRSPAEEFQRLSEVLAR-YAVHNPRVGFTLRKQGDAQPALRTPVASSRSENIRIIYGAAISK---ELLEFSHRDEVYKFEAECLI----------TQVNYSAKKCQMLLFINQRLVESTGL-TSVDSIYATYLPR--GHHPFVYMSLTLPPQNLDVNVHPTKHEVHFLYQEEIVDSIKQQVEARLLGSNATRTFYKQL------RLPGAPD 355          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Zebrafish
Match: pms1 (PMS1 homolog 1, mismatch repair system component [Source:ZFIN;Acc:ZDB-GENE-030616-528])

HSP 1 Score: 182.185 bits (461), Expect = 3.109e-47
Identity = 122/368 (33.15%), Postives = 199/368 (54.08%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLN---RYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNINEELPVANDGYNINKL 1171
            MK L   TV+L+ SS VI+SV  V+KEL+ENS+DA +S + + L+ +GLD+IEV D+G G    DV ++  +H TSKIS   D+E + T+GFRGE L+SICAIS + I +K   D+  +   +  D  GQI++Q      QGT +  +N+F NLPVR Q Y++    +  LK +   L    + +  + + L ++  VV      S  + A+  V+GA+       +L  +  ++  E+ ++ F P    D L  T     +  ++FVN RP     + K ++  Y    + + +   RYP+ ++ +T+P S VDVN+ P+K ++ L N  ++   ++T L   Y    +N  E L  A +  ++  L
Sbjct:    1 MKALPPETVRLLCSSQVITSVLNVVKELIENSLDAGSSSLEVKLENYGLDRIEVRDNGSGIKATDVSVMAVKHYTSKISCHEDLEQLETYGFRGEALASICAISEVIITTKTADDDFSI--QYSVDHNGQIVSQKPSHLGQGTTVCAANLFKNLPVRRQYYSNTKKCKDELKRVQNLLMAYAVIKPELRVTLSHNKAVVWQKSRVSDHRTALMAVLGAASVA---NMLPVQHHQEQPEIHIDGFFPKPGSD-LNSTSSSTTDKSFIFVNSRPVHHKEILKLIKQYYTSAQSNSESVSRRYPTFMMNITIPASTVDVNLTPDKTEVMLQNKDEVLLSVETMLISLYGY--SNGEENLKTAGNPSDVTSL 360          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Zebrafish
Match: pms1 (PMS1 homolog 1, mismatch repair system component [Source:ZFIN;Acc:ZDB-GENE-030616-528])

HSP 1 Score: 182.185 bits (461), Expect = 3.109e-47
Identity = 122/368 (33.15%), Postives = 199/368 (54.08%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLN---RYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNINEELPVANDGYNINKL 1171
            MK L   TV+L+ SS VI+SV  V+KEL+ENS+DA +S + + L+ +GLD+IEV D+G G    DV ++  +H TSKIS   D+E + T+GFRGE L+SICAIS + I +K   D+  +   +  D  GQI++Q      QGT +  +N+F NLPVR Q Y++    +  LK +   L    + +  + + L ++  VV      S  + A+  V+GA+       +L  +  ++  E+ ++ F P    D L  T     +  ++FVN RP     + K ++  Y    + + +   RYP+ ++ +T+P S VDVN+ P+K ++ L N  ++   ++T L   Y    +N  E L  A +  ++  L
Sbjct:    1 MKALPPETVRLLCSSQVITSVLNVVKELIENSLDAGSSSLEVKLENYGLDRIEVRDNGSGIKATDVSVMAVKHYTSKISCHEDLEQLETYGFRGEALASICAISEVIITTKTADDDFSI--QYSVDHNGQIVSQKPSHLGQGTTVCAANLFKNLPVRRQYYSNTKKCKDELKRVQNLLMAYAVIKPELRVTLSHNKAVVWQKSRVSDHRTALMAVLGAASVA---NMLPVQHHQEQPEIHIDGFFPKPGSD-LNSTSSSTTDKSFIFVNSRPVHHKEILKLIKQYYTSAQSNSESVSRRYPTFMMNITIPASTVDVNLTPDKTEVMLQNKDEVLLSVETMLISLYGY--SNGEENLKTAGNPSDVTSL 360          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Zebrafish
Match: pms1 (PMS1 homolog 1, mismatch repair system component [Source:ZFIN;Acc:ZDB-GENE-030616-528])

HSP 1 Score: 181.8 bits (460), Expect = 3.560e-47
Identity = 122/368 (33.15%), Postives = 199/368 (54.08%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLN---RYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNINEELPVANDGYNINKL 1171
            MK L   TV+L+ SS VI+SV  V+KEL+ENS+DA +S + + L+ +GLD+IEV D+G G    DV ++  +H TSKIS   D+E + T+GFRGE L+SICAIS + I +K   D+  +   +  D  GQI++Q      QGT +  +N+F NLPVR Q Y++    +  LK +   L    + +  + + L ++  VV      S  + A+  V+GA+       +L  +  ++  E+ ++ F P    D L  T     +  ++FVN RP     + K ++  Y    + + +   RYP+ ++ +T+P S VDVN+ P+K ++ L N  ++   ++T L   Y    +N  E L  A +  ++  L
Sbjct:    1 MKALPPETVRLLCSSQVITSVLNVVKELIENSLDAGSSSLEVKLENYGLDRIEVRDNGSGIKATDVSVMAVKHYTSKISCHEDLEQLETYGFRGEALASICAISEVIITTKTADDDFSI--QYSVDHNGQIVSQKPSHLGQGTTVCAANLFKNLPVRRQYYSNTKKCKDELKRVQNLLMAYAVIKPELRVTLSHNKAVVWQKSRVSDHRTALMAVLGAASVA---NMLPVQHHQEQPEIHIDGFFPKPGSD-LNSTSSSTTDKSFIFVNSRPVHHKEILKLIKQYYTSAQSNSESVSRRYPTFMMNITIPASTVDVNLTPDKTEVMLQNKDEVLLSVETMLISLYGY--SNGEENLKTAGNPSDVTSL 360          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Zebrafish
Match: pms2 (PMS1 homolog 2, mismatch repair system component [Source:ZFIN;Acc:ZDB-GENE-030131-686])

HSP 1 Score: 130.954 bits (328), Expect = 3.657e-31
Identity = 103/372 (27.69%), Postives = 191/372 (51.34%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDD--VPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNS---------LFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKY---FHELLKSETTEDNHELS----------LNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNIN 1126
            +K ++  +V  I S  V+ S+   +KELVENSIDA A+ + + LK  G++ +EV D+G G ++     +  +H TSK+ EF+D+  + TFGFRGE LSS+CA+S+LS+++    +++ +G   V+D  G++        + GT +T+  +F  LPVR + +           +FVLQ +   I+T +  +  S +    K             ++S ++ I  V G  + +    F ++  +++ ++++ L           ++ FV S  D  +G +  D +   + F+N RP +   + K V   Y  +   N ++YP + L + +    VDVN+ P+KR+I L     +   ++++L   +E+  N I+
Sbjct:   30 IKAIDKQSVHQICSGQVVLSLATAVKELVENSIDAGATNVDVKLKDNGIELVEVSDNGKGVEEQNYEGLTLKHHTSKLKEFSDLIHVETFGFRGEALSSLCALSDLSVVT--CHESAQIGARLVYDHDGRLTQCVPHPRQHGTTVTLQKLFSTLPVRHKEFQRNIKKEYSKMIFVLQ-SYCIISTGV-RITCSNQMGQGKRSTVLCTSG----SNSMRDNIGAVFGPKQLQSLIPFRQISPNDSVKEDYGLGGVDVPKDLFNIDGFV-SQGDHGVGRSATDRQ---FFFINKRPCDPVKVSKLVNEVYHMY---NRHQYPFVALNIAVASDCVDVNVTPDKRQILLQEEKLLLAILKSSLIAMFETGVNKIS 386          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Zebrafish
Match: pms2 (PMS1 homolog 2, mismatch repair system component [Source:ZFIN;Acc:ZDB-GENE-030131-686])

HSP 1 Score: 130.954 bits (328), Expect = 7.100e-31
Identity = 103/372 (27.69%), Postives = 191/372 (51.34%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDD--VPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNS---------LFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKY---FHELLKSETTEDNHELS----------LNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNIN 1126
            +K ++  +V  I S  V+ S+   +KELVENSIDA A+ + + LK  G++ +EV D+G G ++     +  +H TSK+ EF+D+  + TFGFRGE LSS+CA+S+LS+++    +++ +G   V+D  G++        + GT +T+  +F  LPVR + +           +FVLQ +   I+T +  +  S +    K             ++S ++ I  V G  + +    F ++  +++ ++++ L           ++ FV S  D  +G +  D +   + F+N RP +   + K V   Y  +   N ++YP + L + +    VDVN+ P+KR+I L     +   ++++L   +E+  N I+
Sbjct:   12 IKAIDKQSVHQICSGQVVLSLATAVKELVENSIDAGATNVDVKLKDNGIELVEVSDNGKGVEEQNYEGLTLKHHTSKLKEFSDLIHVETFGFRGEALSSLCALSDLSVVT--CHESAQIGARLVYDHDGRLTQCVPHPRQHGTTVTLQKLFSTLPVRHKEFQRNIKKEYSKMIFVLQ-SYCIISTGV-RITCSNQMGQGKRSTVLCTSG----SNSMRDNIGAVFGPKQLQSLIPFRQISPNDSVKEDYGLGGVDVPKDLFNIDGFV-SQGDHGVGRSATDRQ---FFFINKRPCDPVKVSKLVNEVYHMY---NRHQYPFVALNIAVASDCVDVNVTPDKRQILLQEEKLLLAILKSSLIAMFETGVNKIS 368          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Xenopus
Match: col2a1 (collagen, type II, alpha 1 [Source:Xenbase;Acc:XB-GENE-6258353])

HSP 1 Score: 184.882 bits (468), Expect = 4.500e-48
Identity = 119/347 (34.29%), Postives = 193/347 (55.62%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNR-----YPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFY 1102
            M  L  +T++L+SSS VI+SV  V+KELVEN++DA A+ I I L+ FG DKIEV D+G G   DD P++  +H TSKI+   D+ET+ T+GFRGE L+SIC+++ + I +K   D+    K ++ D  G +++Q      QGT ++V  +F NLPVR Q Y+++   ++ +++I   L    +   N+ I   N+  +V     TS  K A   V+G++     + ++  +   ++ ++ +N ++P    D    T     E  +LF+N RP     + K VR     + NQ+LN+     YP   + + LP S +DVN+ P+K +I L N   +   ++  LR  Y
Sbjct:    1 MHCLPSATIRLLSSSQVITSVVSVVKELVENALDANATSIEIKLENFGFDKIEVRDNGKGIKSDDTPVMGVKHYTSKINSHDDLETLETYGFRGEALASICSVAEVHIATKTLEDD--FSKLYILDSSGHVVSQKPSHLGQGTTVSVHKLFKNLPVRKQYYSTIKKCKEEIRNIQELLMAYGIVTPNLRILFTNNKALVWQKSKTSDHKMAFMSVVGSA---IMNCMVPIQYQSEDPKIFINGYLPKPYADNT-TTSLSSSEKSFLFINRRPIYHKEILKMVRW----YHNQSLNKGTPRCYPVFFMNIELPASCLDVNLTPDKTQIMLQNKEFVLHAVENVLRSVY 337          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Xenopus
Match: col2a1 (collagen, type II, alpha 1 [Source:Xenbase;Acc:XB-GENE-6258353])

HSP 1 Score: 184.882 bits (468), Expect = 5.093e-48
Identity = 119/347 (34.29%), Postives = 193/347 (55.62%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNR-----YPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFY 1102
            M  L  +T++L+SSS VI+SV  V+KELVEN++DA A+ I I L+ FG DKIEV D+G G   DD P++  +H TSKI+   D+ET+ T+GFRGE L+SIC+++ + I +K   D+    K ++ D  G +++Q      QGT ++V  +F NLPVR Q Y+++   ++ +++I   L    +   N+ I   N+  +V     TS  K A   V+G++     + ++  +   ++ ++ +N ++P    D    T     E  +LF+N RP     + K VR     + NQ+LN+     YP   + + LP S +DVN+ P+K +I L N   +   ++  LR  Y
Sbjct:    1 MHCLPSATIRLLSSSQVITSVVSVVKELVENALDANATSIEIKLENFGFDKIEVRDNGKGIKSDDTPVMGVKHYTSKINSHDDLETLETYGFRGEALASICSVAEVHIATKTLEDD--FSKLYILDSSGHVVSQKPSHLGQGTTVSVHKLFKNLPVRKQYYSTIKKCKEEIRNIQELLMAYGIVTPNLRILFTNNKALVWQKSKTSDHKMAFMSVVGSA---IMNCMVPIQYQSEDPKIFINGYLPKPYADNT-TTSLSSSEKSFLFINRRPIYHKEILKMVRW----YHNQSLNKGTPRCYPVFFMNIELPASCLDVNLTPDKTQIMLQNKEFVLHAVENVLRSVY 337          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Xenopus
Match: col2a1 (collagen, type II, alpha 1 [Source:Xenbase;Acc:XB-GENE-6258353])

HSP 1 Score: 182.185 bits (461), Expect = 3.666e-47
Identity = 116/333 (34.83%), Postives = 188/333 (56.46%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNR-----YPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTL 1060
            M  L  +T++L+SSS VI+SV  V+KELVEN++DA A+ I I L+ FG DKIEV D+G G   DD P++  +H TSKI+   D+ET+ T+GFRGE L+SIC+++ + I +K   D+    K ++ D  G +++Q      QGT ++V  +F NLPVR Q Y+++   ++ +++I   L    +   N+ I   N+  +V     TS  K A   V+G++     + ++  +   ++ ++ +N ++P    D    T     E  +LF+N RP     + K VR     + NQ+LN+     YP   + + LP S +DVN+ P+K +I L N +
Sbjct:    1 MHCLPSATIRLLSSSQVITSVVSVVKELVENALDANATSIEIKLENFGFDKIEVRDNGKGIKSDDTPVMGVKHYTSKINSHDDLETLETYGFRGEALASICSVAEVHIATKTLEDD--FSKLYILDSSGHVVSQKPSHLGQGTTVSVHKLFKNLPVRKQYYSTIKKCKEEIRNIQELLMAYGIVTPNLRILFTNNKALVWQKSKTSDHKMAFMSVVGSA---IMNCMVPIQYQSEDPKIFINGYLPKPYADNT-TTSLSSSEKSFLFINRRPIYHKEILKMVRW----YHNQSLNKGTPRCYPVFFMNIELPASCLDVNLTPDKTQIMLQNKV 323          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Xenopus
Match: col2a1 (collagen, type II, alpha 1 [Source:Xenbase;Acc:XB-GENE-6258353])

HSP 1 Score: 181.8 bits (460), Expect = 5.420e-47
Identity = 116/333 (34.83%), Postives = 188/333 (56.46%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNR-----YPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTL 1060
            M  L  +T++L+SSS VI+SV  V+KELVEN++DA A+ I I L+ FG DKIEV D+G G   DD P++  +H TSKI+   D+ET+ T+GFRGE L+SIC+++ + I +K   D+    K ++ D  G +++Q      QGT ++V  +F NLPVR Q Y+++   ++ +++I   L    +   N+ I   N+  +V     TS  K A   V+G++     + ++  +   ++ ++ +N ++P    D    T     E  +LF+N RP     + K VR     + NQ+LN+     YP   + + LP S +DVN+ P+K +I L N +
Sbjct:    1 MHCLPSATIRLLSSSQVITSVVSVVKELVENALDANATSIEIKLENFGFDKIEVRDNGKGIKSDDTPVMGVKHYTSKINSHDDLETLETYGFRGEALASICSVAEVHIATKTLEDD--FSKLYILDSSGHVVSQKPSHLGQGTTVSVHKLFKNLPVRKQYYSTIKKCKEEIRNIQELLMAYGIVTPNLRILFTNNKALVWQKSKTSDHKMAFMSVVGSA---IMNCMVPIQYQSEDPKIFINGYLPKPYADNT-TTSLSSSEKSFLFINRRPIYHKEILKMVRW----YHNQSLNKGTPRCYPVFFMNIELPASCLDVNLTPDKTQIMLQNKV 323          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Xenopus
Match: col2a1 (collagen, type II, alpha 1 [Source:Xenbase;Acc:XB-GENE-6258353])

HSP 1 Score: 181.03 bits (458), Expect = 7.436e-47
Identity = 116/333 (34.83%), Postives = 188/333 (56.46%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNR-----YPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTL 1060
            M  L  +T++L+SSS VI+SV  V+KELVEN++DA A+ I I L+ FG DKIEV D+G G   DD P++  +H TSKI+   D+ET+ T+GFRGE L+SIC+++ + I +K   D+    K ++ D  G +++Q      QGT ++V  +F NLPVR Q Y+++   ++ +++I   L    +   N+ I   N+  +V     TS  K A   V+G++     + ++  +   ++ ++ +N ++P    D    T     E  +LF+N RP     + K VR     + NQ+LN+     YP   + + LP S +DVN+ P+K +I L N +
Sbjct:    1 MHCLPSATIRLLSSSQVITSVVSVVKELVENALDANATSIEIKLENFGFDKIEVRDNGKGIKSDDTPVMGVKHYTSKINSHDDLETLETYGFRGEALASICSVAEVHIATKTLEDD--FSKLYILDSSGHVVSQKPSHLGQGTTVSVHKLFKNLPVRKQYYSTIKKCKEEIRNIQELLMAYGIVTPNLRILFTNNKALVWQKSKTSDHKMAFMSVVGSA---IMNCMVPIQYQSEDPKIFINGYLPKPYADNT-TTSLSSSEKSFLFINRRPIYHKEILKMVRW----YHNQSLNKGTPRCYPVFFMNIELPASCLDVNLTPDKTQIMLQNKV 323          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Mouse
Match: Pms1 (PMS1 homolog 1, mismatch repair system component [Source:MGI Symbol;Acc:MGI:1202302])

HSP 1 Score: 171.014 bits (432), Expect = 3.055e-44
Identity = 107/347 (30.84%), Postives = 183/347 (52.74%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTY-MKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLP 1114
            MK+L  +TV+L+SSS  I+SV  V+KEL+ENS+DA A+ I + L+ +G DKIE+ D+G G    DVP++  ++ TSKIS   D+  + T+GFRGE L SIC ++ + + ++ +AD+      +V D  G I++Q      QGT +T   +F NLPVR Q Y++    +  LK++   L    + + ++ I  +++  V+         + A+  V+G +       +   E   +  ++ L+ F P   D     T     E  ++F+N RP     + K +R  Y +K   ++   YP   L + +P + VD+N+ P+K ++ L N   +   ++  +   Y  LP
Sbjct:    1 MKQLPAATVRLLSSSQTITSVVSVVKELIENSLDAGATSIEVKLENYGFDKIEIRDNGEGIKAVDVPVMAVKYYTSKISSHEDLGNLTTYGFRGEALGSICNVAEVVVTTRTSADD--FSTQYVLDGSGHILSQKPSHLGQGTTVTALKLFKNLPVRKQFYSTAKKCKDELKNVQDLLISYGVLKPDVRITFVHNKAVIWQKSRVPDHRMALMSVLGTAVMGNMESV---EQHCEQSQIYLSGFFPKH-DADHNSTSLSTPERSFIFINSRPVHQKDILKLIRRYYNLKCLKESTRLYPIFFLKIDVPSAEVDINLTPDKSQVLLQNKESVLIALENLMMTCYGPLP 341          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Mouse
Match: Pms1 (PMS1 homolog 1, mismatch repair system component [Source:MGI Symbol;Acc:MGI:1202302])

HSP 1 Score: 171.014 bits (432), Expect = 1.352e-43
Identity = 107/347 (30.84%), Postives = 183/347 (52.74%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTY-MKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLP 1114
            MK+L  +TV+L+SSS  I+SV  V+KEL+ENS+DA A+ I + L+ +G DKIE+ D+G G    DVP++  ++ TSKIS   D+  + T+GFRGE L SIC ++ + + ++ +AD+      +V D  G I++Q      QGT +T   +F NLPVR Q Y++    +  LK++   L    + + ++ I  +++  V+         + A+  V+G +       +   E   +  ++ L+ F P   D     T     E  ++F+N RP     + K +R  Y +K   ++   YP   L + +P + VD+N+ P+K ++ L N   +   ++  +   Y  LP
Sbjct:    1 MKQLPAATVRLLSSSQTITSVVSVVKELIENSLDAGATSIEVKLENYGFDKIEIRDNGEGIKAVDVPVMAVKYYTSKISSHEDLGNLTTYGFRGEALGSICNVAEVVVTTRTSADD--FSTQYVLDGSGHILSQKPSHLGQGTTVTALKLFKNLPVRKQFYSTAKKCKDELKNVQDLLISYGVLKPDVRITFVHNKAVIWQKSRVPDHRMALMSVLGTAVMGNMESV---EQHCEQSQIYLSGFFPKH-DADHNSTSLSTPERSFIFINSRPVHQKDILKLIRRYYNLKCLKESTRLYPIFFLKIDVPSAEVDINLTPDKSQVLLQNKESVLIALENLMMTCYGPLP 341          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Mouse
Match: Pms2 (PMS1 homolog2, mismatch repair system component [Source:MGI Symbol;Acc:MGI:104288])

HSP 1 Score: 153.68 bits (387), Expect = 4.749e-38
Identity = 108/369 (29.27%), Postives = 188/369 (50.95%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDD--VPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPM-----TSSRKEAIPFVIGASKFKY---FHELLKSETTEDNHELSL-----NLFVPSSVDDKLGLTHCDYK------ENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNIN 1126
            +K ++  +V  I S  V+ S+   +KEL+ENS+DA A+ I + LK +G+D IEV D+GCG ++     +  +H TSKI EF D+  + TFGFRGE LSS+CA+S+++I       ++ +G   VFD  G+I  ++     +GT ++V ++F+ LPVR + +     ++K    +   L    +    + +   N        P+     +S  KE I  V G  + +    F +L  S+   + + LS      NLF  S       ++ C +       +  + F+N RP + + + K V   Y  +   N ++YP +VL +++    VD+N+ P+KR+I L     +   ++T+L   ++S  N +N
Sbjct:   15 IKPIDGKSVHQICSGQVVLSLSTAVKELIENSVDAGATTIDLRLKDYGVDLIEVSDNGCGVEEENFEGLALKHHTSKIQEFADLTQVETFGFRGEALSSLCALSDVTI--STCHGSASVGTRLVFDHNGKITQKTPYPRPKGTTVSVQHLFYTLPVRYKEFQR--NIKKEYAKMVQVLQAYCIISAGVRVSCTNQLGQGKRQPVVCTSGSSGMKENIGSVFGQKQLQSLIPFVQLPPSDAVCEEYGLSTSRTPQNLFYVSGF-----ISQCTHGAGRSATDRQFFFINQRPCDPAKVSKLVNEVYHMY---NRHQYPFVVLNVSVDSECVDINVTPDKRQILLQEEKLLLAVLKTSLIGMFDSDANKLN 371          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Mouse
Match: Pms2 (PMS1 homolog2, mismatch repair system component [Source:MGI Symbol;Acc:MGI:104288])

HSP 1 Score: 123.25 bits (308), Expect = 2.319e-29
Identity = 63/157 (40.13%), Postives = 100/157 (63.69%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDD--VPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVR 547
            +K ++  +V  I S  V+ S+   +KEL+ENS+DA A+ I + LK +G+D IEV D+GCG ++     +  +H TSKI EF D+  + TFGFRGE LSS+CA+S+++I       ++ +G   VFD  G+I  ++     +GT ++V ++F+ LPVR
Sbjct:   15 IKPIDGKSVHQICSGQVVLSLSTAVKELIENSVDAGATTIDLRLKDYGVDLIEVSDNGCGVEEENFEGLALKHHTSKIQEFADLTQVETFGFRGEALSSLCALSDVTI--STCHGSASVGTRLVFDHNGKITQKTPYPRPKGTTVSVQHLFYTLPVR 169          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Mouse
Match: Pms1 (PMS1 homolog 1, mismatch repair system component [Source:MGI Symbol;Acc:MGI:1202302])

HSP 1 Score: 111.694 bits (278), Expect = 1.884e-28
Identity = 56/129 (43.41%), Postives = 86/129 (66.67%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMG 463
            MK+L  +TV+L+SSS  I+SV  V+KEL+ENS+DA A+ I + L+ +G DKIE+ D+G G    DVP++  ++ TSKIS   D+  + T+GFRGE L SIC ++ + + ++ +AD+      +V D  G
Sbjct:    1 MKQLPAATVRLLSSSQTITSVVSVVKELIENSLDAGATSIEVKLENYGFDKIEIRDNGEGIKAVDVPVMAVKYYTSKISSHEDLGNLTTYGFRGEALGSICNVAEVVVTTRTSADD--FSTQYVLDGSG 127          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. UniProt/SwissProt
Match: sp|P54277|PMS1_HUMAN (PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=PMS1 PE=1 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.306e-45
Identity = 114/354 (32.20%), Postives = 186/354 (52.54%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGAS------KFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTY-MKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPN 1117
            MK+L  +TV+L+SSS +I+SV  V+KEL+ENS+DA A+ + + L+ +G DKIEV D+G G    D P++  ++ TSKI+   D+E + T+GFRGE L SIC I+ + I ++  ADN      +V D  G I++Q      QGT +T   +F NLPVR Q Y++    +  +K I   L    + + ++ I  +++  V+      S  K A+  V+G +       F+Y  E           ++ L+ F+P   D     T     E  ++F+N RP     + K +R  Y +K   ++   YP   L + +P + VDVN+ P+K ++ L N   +   ++  +   Y  LP+
Sbjct:    1 MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADN--FSTQYVLDGSGHILSQKPSHLGQGTTVTALRLFKNLPVRKQFYSTAKKCKDEIKKIQDLLMSFGILKPDLRIVFVHNKAVIWQKSRVSDHKMALMSVLGTAVMNNMESFQYHSE---------ESQIYLSGFLP-KCDADHSFTSLSTPERSFIFINSRPVHQKDILKLIRHHYNLKCLKESTRLYPVFFLKIDVPTADVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGPLPS 342          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. UniProt/SwissProt
Match: sp|P14242|PMS1_YEAST (DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMS1 PE=1 SV=3)

HSP 1 Score: 160.999 bits (406), Expect = 1.543e-39
Identity = 114/363 (31.40%), Postives = 184/363 (50.69%), Query Frame = 2
Query:   80 KMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHH------LYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHEL------------LKSETTEDNHELSLN--LFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFY 1102
            ++ ++ND  V  I+S  VI+ +   +KELV+NSIDA A++I I  K +GL+ IE  D+G G D  +   +  +H TSKI++F D+  + T GFRGE LSS+C I+ LS+++  +   +       +D +G I +++  +  +GT + VS +FHNLPVR + ++  F  Q T K +T    +      +  S  NI  K   +  +       SS ++ I  V GA   +   E+            +  + T+D   L L+  + V   +         + K+  +++VN RP E S L K     Y  F N    ++P++ L L LP S +DVN+ P+KR I L N   + D  +T L  +Y
Sbjct:    3 QIHQINDIDVHRITSGQVITDLTTAVKELVDNSIDANANQIEIIFKDYGLESIECSDNGDGIDPSNYEFLALKHYTSKIAKFQDVAKVQTLGFRGEALSSLCGIAKLSVITTTSPPKA---DKLEYDMVGHITSKTTTSRNKGTTVLVSQLFHNLPVRQKEFSKTFKRQFT-KCLTVIQGYAIINAAIKFSVWNITPKGKKNLILSTMR--NSSMRKNISSVFGAGGMRGLEEVDLVLDLNPFKNRMLGKYTDDPDFLDLDYKIRVKGYISQNSFGCGRNSKDRQFIYVNKRPVEYSTLLKCCNEVYKTFNNV---QFPAVFLNLELPMSLIDVNVTPDKRVILLHNERAVIDIFKTTLSDYY 356          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. UniProt/SwissProt
Match: sp|B0BA28|MUTL_CHLTB (DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) OX=471473 GN=mutL PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.408e-37
Identity = 121/401 (30.17%), Postives = 192/401 (47.88%), Query Frame = 2
Query:   80 KMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFI-----------QTNLRQFYESLPNNINEELPVANDGYNINKL-------PLSCELPT----TYLRT 1210
            +++ L+  TV  IS+  VI +   V+KEL+ENS+DA A  I I     G  +I V D+G G D  +VP+  QRH TSKI+ F DI ++ ++GFRGE L SI +IS + I   +TA    LG   + +K G+ +       +QGT I V ++F+N+P+R     S    Q    +I   L +  LS   I    +++    L++       E +  V+G S   +  E    +  + +  +   L  P+         H   ++   LF+N+R  E SF+ K V   Y         RYP  VL L LP  W D N+ P+K +++L    QI++ +            ++L +    +P    E++P+ N+G ++  +       PLSC  PT     YL+T
Sbjct:    7 RIRLLDSVTVNQISAGEVIENAASVVKELIENSLDAGADEIHIETLGGGRGQIVVRDNGVGMDPEEVPVALQRHATSKIAHFADIFSLASYGFRGEALPSIASISKMEI---HTARAGGLGSKTLIEK-GEPVCCEPAPRQQGTTIAVHSLFYNVPMRQSFQKS---PQMDRLAIRRLLENSVLSSEGIGWTWISERRQELHVAKKQGFIERVALVLGES---FVQEAFFIDKQQGDLRVLGFLGSPNQ--------HRSTRQGQRLFINNRAVESSFISKKVAEAYAWMIPA--QRYPIFVLKLFLPPMWCDFNVHPQKTEVRLLQEGQISNLLVEAISEALLRRSSSLEEIVLKVP---TEKIPIENEGISVPSIRPAIVSAPLSC--PTFSQQPYLKT 382          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. UniProt/SwissProt
Match: sp|B0B8E9|MUTL_CHLT2 (DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) OX=471472 GN=mutL PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.408e-37
Identity = 121/401 (30.17%), Postives = 192/401 (47.88%), Query Frame = 2
Query:   80 KMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFI-----------QTNLRQFYESLPNNINEELPVANDGYNINKL-------PLSCELPT----TYLRT 1210
            +++ L+  TV  IS+  VI +   V+KEL+ENS+DA A  I I     G  +I V D+G G D  +VP+  QRH TSKI+ F DI ++ ++GFRGE L SI +IS + I   +TA    LG   + +K G+ +       +QGT I V ++F+N+P+R     S    Q    +I   L +  LS   I    +++    L++       E +  V+G S   +  E    +  + +  +   L  P+         H   ++   LF+N+R  E SF+ K V   Y         RYP  VL L LP  W D N+ P+K +++L    QI++ +            ++L +    +P    E++P+ N+G ++  +       PLSC  PT     YL+T
Sbjct:    7 RIRLLDSVTVNQISAGEVIENAASVVKELIENSLDAGADEIHIETLGGGRGQIVVRDNGVGMDPEEVPVALQRHATSKIAHFADIFSLASYGFRGEALPSIASISKMEI---HTARAGGLGSKTLIEK-GEPVCCEPAPRQQGTTIAVHSLFYNVPMRQSFQKS---PQMDRLAIRRLLENSVLSSEGIGWTWISERRQELHVAKKQGFIERVALVLGES---FVQEAFFIDKQQGDLRVLGFLGSPNQ--------HRSTRQGQRLFINNRAVESSFISKKVAEAYAWMIPA--QRYPIFVLKLFLPPMWCDFNVHPQKTEVRLLQEGQISNLLVEAISEALLRRSSSLEEIVLKVP---TEKIPIENEGISVPSIRPAIVSAPLSC--PTFSQQPYLKT 382          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. UniProt/SwissProt
Match: sp|O84579|MUTL_CHLTR (DNA mismatch repair protein MutL OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=mutL PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.570e-37
Identity = 122/398 (30.65%), Postives = 192/398 (48.24%), Query Frame = 2
Query:   80 KMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFI-----QTNLRQ---FYESLPNNINEELPVANDGYNINKL-------PLSCELPT----TYLRT 1210
            +++ L+  TV  IS+  VI +   V+KEL+ENS+DA A  I I     G  +I V D+G G D  +VP+  QRH TSKI+ F DI ++ ++GFRGE L SI +IS + I   +TA    LG   + +K G+ +       +QGT I V ++F+N+P+R     S    Q    +I   L +  LS   I    +++    L +       E +  V+G S   +  E    +  + +  +   L  P+         H   ++   LF+N+R  E SF+ K V   Y         RYP  VL L LP  W D N+ P+K +++L    QI++ +     +  LR+     E++     E++P+ N+G ++  +       PLSC  PT     YL+T
Sbjct:    7 RIRLLDSVTVNQISAGEVIENAASVVKELIENSLDAGADEIHIETLGGGRGQIVVRDNGVGMDPEEVPVALQRHATSKIAHFADIFSLASYGFRGEALPSIASISKMEI---HTARAGGLGSKTLIEK-GEPVCCEPAPRQQGTTIAVHSLFYNVPMRQSFQKS---PQMDRLAIRRLLENSVLSSEGIGWTWISECRQELYVAKKQGFIERVALVLGES---FVQEAFFIDKQQGDLRVLGFLGSPNQ--------HRSTRQGQRLFINNRAVESSFISKKVAEAYAWMIPA--QRYPIFVLKLFLPPMWCDFNVHPQKTEVRLLQEGQISNLLVEAISEALLRRSPSLEETVLKVPTEKIPIENEGISVPSIRPAIVSAPLSC--PTFSQQPYLKT 382          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. TrEMBL
Match: A0A1B6K6X2 (DNA_mis_repair domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.45394 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 2.083e-49
Identity = 116/354 (32.77%), Postives = 200/354 (56.50%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNL--NRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNINEE 1132
            + +L  +TVKLI SS VI+SV  V+KEL+ENSID+ A  I I L + GL+KIEV DDGCG    D  L+C    TSKIS+F+D++ ++++GFRGE LS++C ++ +S+ +K T D++     + FD+ GQ+ +       +GT ITV+ +F NLPVR Q  ++     + LK +   +  L +    + + L+++  ++      ++ ++++  ++  S  K  H +L     E++ ++ + + VPS   D   +   ++ E  +LF+N RP     + + V +   ++    +   +YP  VL LTLP   +DVN++P K ++ L N   I DFI+  L  +Y      ++E+
Sbjct:    3 LAQLPPATVKLIGSSQVITSVSSVVKELMENSIDSGAGHIEIKLDKHGLEKIEVKDDGCGVAKSDATLMCLSSYTSKISDFSDLDCLSSYGFRGEALSALCNVAEVSVTTKTTQDDT--ASCYSFDQNGQVKSSKISHIAKGTIITVTALFKNLPVRRQFMSNAKRAAEELKKVEKVVKSLAVVHPRLRVTLVHNKFLIWQKVSVANLRQSVMQILSLSIVKQLHHIL-----ENSPQVRVEMLVPSRDCDVSCMCFSNFSEASFLFINHRPIRHKEIEQVVYSRLSEYFGVYVPAKKYPISVLSLTLPSDCLDVNLEPNKTRVYLKNQEDILDFIKQCLHLYYGEGAKVVDED 349          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. TrEMBL
Match: A0A218UNH3 (PMS1 1 OS=Lonchura striata domestica OX=299123 GN=PMS1 PE=4 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.892e-49
Identity = 124/353 (35.13%), Postives = 194/353 (54.96%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNR-YPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNINEE 1132
            MK+L   T++L+SSS VI+SV  V+KEL+ENS+DA A+ I I L+ +G  KIEV D+G G   DDVP++  +H TSKIS   D+E + T+GFRGE L SIC+IS + + +K  AD+  +   +  D  G + +Q      QGT +TV N+F NLPVR Q Y++    ++ LK +   L    + + ++ I L ++  V+      S  K A   V+G +       ++  +   +  E++L+ F+P +  D   LT     E  ++F+N+RP     + K +R  Y + T +   R YP   L +T+P S VDVNI P+K ++ L     +   ++  L+  Y  LP  +  E
Sbjct:    1 MKQLPGETIRLLSSSQVITSVVSVVKELIENSLDASATGIDIKLENYGFSKIEVRDNGSGIKVDDVPVMAIKHYTSKISSSEDLERLTTYGFRGEALGSICSISEVLVTTKTAADDFSI--QYALDSNGHVTSQKPSHLGQGTTVTVLNLFKNLPVRKQFYSTNRKCKEELKKVQDLLTAYGIIKPDLRITLTHNKAVIWQKTRVSDHKMACMSVLGTA---VMSSMVPFQHCCEYPEINLSGFLPKAESDA-SLTSLSSSERSFIFINNRPVLQKEILKLIRQYYSQVTQKECTRLYPVFFLSITVPASAVDVNITPDKTQVLLHYKESVLLAVENVLKSLYGPLPAAVPGE 347          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. TrEMBL
Match: A7RHM2 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g82384 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.253e-47
Identity = 110/339 (32.45%), Postives = 185/339 (54.57%), Query Frame = 2
Query:   92 LNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFY 1102
            L   TV  I+SS VI+SV   +KEL+EN++DA A+ I + L+ +GL+KIEV D+G G   DD   + QRH TSKI+ F +++++ ++GFRGE L S+CA+SN+S+++K   +N  +G  +  D+ G+I A   +    GT +T  N+F NLPVR Q        +  LK +   +    L   ++ + L ++ +++         K+A+  +IGA+      E++     +D   L +  FVP    D   +T     +  +++VN RP  +  + + VR  Y+K      NR+P   L + +P   VDVN++P K ++ L+    I D ++ +L + Y
Sbjct:    7 LPQDTVHRIASSQVITSVSSAVKELLENALDAGANSIEVKLEEYGLEKIEVRDNGTGIPQDDAQFMAQRHYTSKITTFHNLDSLASYGFRGEALCSLCAVSNVSVMTK--TNNEEVGMCYTLDQHGRISATKPLPLTTGTVVTACNLFKNLPVRKQFSRGNKKCKDELKKVEELIMAFGLIHPSVRLTLRHNKSIIWQKNKCEDLKKALTGIIGANAMSSMEEII---VKDDQTGLRIEGFVPKPGSDP-NVTSRSMGDRSFVYVNKRPVVLKEIAQVVREFYLKIHPTISNRHPVAFLSIEVPPCAVDVNLEPNKSRVLLTEKDIIIDLLRNSLEELY 339          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. TrEMBL
Match: A0A2I4DAP6 (PMS1 protein homolog 1-like OS=Austrofundulus limnaeus OX=52670 GN=LOC106536555 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.780e-47
Identity = 114/344 (33.14%), Postives = 195/344 (56.69%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTY-MKFTNQNL-NRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFY 1102
            MK+L   TV+L+SSS VI+SV  V+KEL+ENS+DA AS I + L+ FGLD++EV D+G G   +D P++  RH TSKI    D+E + T+GFRGE L SICA++ +++ +K   D+  +   +  D  G +++Q      +GT ++V+ +F NLPVR Q Y+S    ++ L+ +   L    + +  + + L+++  VV      +  + A+  V+G+    +   LL     ++  E+ L+ F P    D    T     E  ++F+N+RP +   + K +R  Y  ++++ +  +RYP+ +L +T+P S VDVN+ P+K ++ L N   +   ++  L   Y
Sbjct:    1 MKQLPADTVRLLSSSQVITSVVNVVKELMENSLDAGASSIDVKLENFGLDRVEVRDNGDGIRAEDAPVMAVRHFTSKICSHDDLERLETYGFRGEALGSICAVAEVAVTTKTEEDD--ISTQYTLDLTGAVVSQKPSHVGRGTTVSVTKLFKNLPVRRQYYSSTKRCKEELRKVQDLLMTYAVLKPELRLMLVHNKVVVWQKAKMADARSALLAVLGSGPVAH---LLPCHQRQEQPEIILDGFFPKPGAD-FSSTSSSTPEKTFVFINERPVQQKEIMKLLRQHYSAQYSDDSARHRYPTALLRITVPPSSVDVNVTPDKTQVLLHNKXAVLTAVEALLVSLY 338          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. TrEMBL
Match: A0A444U8P8 (PMS1 protein-like 1 OS=Acipenser ruthenus OX=7906 GN=EOD39_6861 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.451e-47
Identity = 115/355 (32.39%), Postives = 197/355 (55.49%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFT--NQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNINEEL 1135
            MK+L   TV+L++SS VI+SV  V+KELVENS+D+ AS I + L  +G D+IEV D+G G +  D P++  +H TSKIS   D+E++ T+GFRGE L ++CA+S + I++K  +D+  +   +  D  G +++Q      QGT +TV  +F NLPVR Q Y++    ++ LK +   L    + +  + +   ++  +V      S  K A+  V+G +       +L  +  + + E++LN F+P    D   LT     +  ++FVN RP  +  + K VR  Y   +      +R P + + + +P + VD+N+ P+K ++ L N   I   ++T L   Y +LP ++ +++
Sbjct:    1 MKQLPPETVRLLTSSQVITSVLNVVKELVENSLDSGASSIEVKLDNYGFDRIEVRDNGIGIEAADAPVMAVKHYTSKISSHDDLESLETYGFRGEALGALCAVSEVIIITKTASDD--VSTQYTLDFTGNVVSQKPSHLGQGTTVTVLKLFKNLPVRKQFYSTAKKCKEELKKVQDLLMAYAIIKPELRMIFTHNKAIVWQKARVSDHKMALMSVLGTA---LMSSMLPFQHHQVDPEVTLNGFLPKPGSDNT-LTSSSSSDKTFVFVNQRPVHLKEVMKLVRQYYSSQSCRQSAHSRCPVLFMNIVVPAASVDINLTPDKTQVMLQNKENILSAVETILISVYGALPGSVPKDV 349          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Cavefish
Match: pms1 (PMS1 homolog 1, mismatch repair system component [Source:ZFIN;Acc:ZDB-GENE-030616-528])

HSP 1 Score: 172.94 bits (437), Expect = 1.908e-44
Identity = 117/367 (31.88%), Postives = 195/367 (53.13%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQN----LNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNINEELPVANDGYNIN 1165
            MK L+  TV+L+SSS VI+SV  V+KEL+ENS+DA ++ + + L+ +GLD+IEV D+GCG    D  ++  +H TSKIS   D+E + T+GFRGE L+SICAIS + + +K TAD+ V    +  D  G++++Q      QGT +    +F NLPVR Q Y++    ++ +K +   L    + +  + I   ++   V      S  + A+  V+GA+       LL  +  ++  E+++  + P    D L  T  +  +  ++FVN RP     + K V+  Y    + +      R+P +++ + +P S VDVN+ P+K ++ L N   +   +++ L   Y S          V ND + I 
Sbjct:    1 MKALSAETVRLLSSSQVITSVLNVVKELIENSLDAGSTSLEVKLENYGLDRIEVRDNGCGIKSADASVMAVKHYTSKISCHEDLEHLETYGFRGEALASICAISEVVVTTK-TADDDV-STQYTLDLSGRVISQKPSHLGQGTTVCALKLFKNLPVRRQYYSNSKKCKEEVKKVQDLLMAYAVIKPELRIVFTHNKATVWQKARVSDHRAALMAVLGAASAA---NLLPVQHRQEQPEIAIEGYFPKPNSD-LNSTSSNTSDKTFVFVNSRPVHHKDILKLVKQYYANAAHSSNESASRRFPVLMMNIIVPASNVDVNLTPDKTQVMLQNKDAVLLAVESVLISLYGS--------FSVGNDNHTIG 353          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Cavefish
Match: pms2 (PMS1 homolog 2, mismatch repair system component [Source:ZFIN;Acc:ZDB-GENE-030131-686])

HSP 1 Score: 144.05 bits (362), Expect = 2.719e-35
Identity = 110/407 (27.03%), Postives = 204/407 (50.12%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDD--VPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLS----RRNIHIKXXXXXXXXXXXPM-----TSSRKEAIPFVIGASKFKY---FHELLKSETTEDNH-----ELSLNLFVPSS----VDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNINEELPVANDGYNINKLPLSCELPTTYLRTIRPSNLNE 1234
            +K ++  +V  I S  V+ S+   +KELVENS+DA A+ + I LK  G + +EV D+G G ++     +  +H TSK+ EF+D+  + TFGFRGE LSS+CA+S+LS+++    D++ +G   V+D  G+++ ++    +QGT +++  +F  LPVR + +      Q+ +K   + + H+  S       + I   N         +     + S ++ I  + G  + +    F ++  ++  ++++     +L  +LF  S      D  +G +  D +   + F+N RP + S + K V   Y  F   N ++YP + L + +    VDVN+ P+KR+I L     +   ++++L   YE+  N I           ++N  P   +L  ++ R + P+   E
Sbjct:   10 IKAIDRHSVHQICSGQVVLSLATAVKELVENSVDAGATNVDIRLKDHGTELVEVTDNGKGVEEENFEGLTLKHHTSKLREFSDLIHVETFGFRGEALSSLCALSDLSVVT--CHDSTSVGTRLVYDHDGRLVQRAPQPRQQGTTVSLQQLFSTLPVRHKEF------QRNIKKEYSKMIHVLQSYCIISTGVRITCTNQIGQGKRNTVLCTSGSQSMRDNIGALFGPKQLQSLIPFQQISPTDNIKEDYGLNGADLPKDLFTISGYVSQADHGVGRSATDRQ---FFFINKRPCDPSKVSKLVNEVYHMF---NRHQYPFVALNIAVASECVDVNVTPDKRQIFLQEEKFLLAILKSSLISMYETGVNKI-----------SLNHTP---QLSGSFFRPVDPAAAAE 388          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Cavefish
Match: mlh1 (mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-040426-1600])

HSP 1 Score: 115.161 bits (287), Expect = 3.888e-26
Identity = 98/351 (27.92%), Postives = 178/351 (50.71%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMA-QSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHL--YLSRRNIH-------IKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYK-ENC--YLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNL 1090
            +++L+++ V  I++  VI      IKE++EN +DA ++ I + +K  GL  I++ D+G G   +D+ ++C+R  TSK+  F D+ +I+T+GFRGE L+SI  +++++I +K TAD     +    D  G++ A        QGT I+V ++F+N+P R          +K LKS +     +   +SR  IH       +K   +    +     +S  + I  V G +  +   E++  E   ++ +L+  L        K  +++ +Y  + C   LF+N R  E S L KA+ T Y  +  +N   +P + L L +    +DVN+ P K ++   +   I + IQ ++
Sbjct:    5 IRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTNIQVTVKEGGLKLIQIQDNGTGIRKEDLEIVCERFTTSKLQTFEDLTSISTYGFRGEALASISHVAHVTITTK-TADGKCAYRGNYCD--GKLKAPPKPCAGNQGTLISVEDLFYNVPTR----------RKALKSPSEEYSRIVEVMSRYAIHNSGKSFTVKKQGEMVADVKTLPNASVLDNIRVVFGVAVSR---EMI--EVGCEDQKLAFKL--------KGYISNANYSVKKCIFILFINHRLVESSALKKAIETVYTAYLPKNT--HPFLYLSLEIAPHNIDVNVHPTKHEVHFLHEDCIIESIQKHI 327          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Cavefish
Match: mlh3 (mutL homolog 3 [Source:NCBI gene;Acc:103038515])

HSP 1 Score: 82.4185 bits (202), Expect = 1.229e-15
Identity = 54/162 (33.33%), Postives = 87/162 (53.70%), Query Frame = 2
Query:  107 VKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNL-SILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQK 583
             KL S   V S  +CV +ELV NSIDA A+ I + +      K++VID+G G   +D+  +  R+CTSK S   D++ +  +GFRGE ++SI ++S L  I S+  A      K +   +   +          GT + + N FHN+PVR +  +S+  +++
Sbjct:   11 AKLRSGVAVFSLQQCV-EELVLNSIDAGATCIAVKID-IEACKVQVIDNGSGMSREDMEKVGTRYCTSKCSSLEDLDDLRFYGFRGEAIASIASLSTLVEISSQTKASVKTFVKTFNEGRGSGVCEVQDTRPSPGTTVLICNFFHNMPVRRKRMDSVLEVER 170          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Sea Lamprey
Match: pms1 (PMS1 homolog 1, mismatch repair system component [Source:ZFIN;Acc:ZDB-GENE-030616-528])

HSP 1 Score: 176.792 bits (447), Expect = 3.267e-46
Identity = 118/347 (34.01%), Postives = 184/347 (53.03%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKF--TNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESL 1111
            MK+L+  TV+L+SS+ V SSV  V+KEL+ENS+DA A+ + I L+ +G DKIEV D+G G   +D   +  RH TSKIS   D+E I T+GFRGE L SICA++ +SI +  TA++ V    +  D  G + ++      +GT + ++ +F NLPVR Q Y++    ++ LK I   L    +   +I   L ++  VV   P  + ++ A+   +G +       ++  +      +LS++ FVP    D  G+T     + C L +N RP     L K VR  Y     ++     YP   L L++P + +DVN+ P+K ++ L N   I   +   L Q Y  L
Sbjct:    1 MKQLSAETVRLLSSAQVASSVWSVVKELLENSLDAHATSVEIKLENYGFDKIEVRDNGDGVRSEDTQFMAVRHYTSKISSHEDLEDIATYGFRGEGLGSICAVAEVSI-TTCTAEDEV-SMIYSLDSQGHVTSRKPSHLGKGTTVCITKLFKNLPVRKQFYSTAKKCKEELKKIEDLLVAYGVIHPDIRFSLAHNKAVVWQKPRVADQRTALLRCLGTT---VMGSMIPVQHQASTMQLSISGFVPKPGADP-GITSSTSSDRCLLAINGRPVHYKDLLKLVRQYYRNTSPSSSTHTHYPVFFLSLSIPANTIDVNLTPDKMQVMLHNKEAILAELDEMLLQVYGPL 341          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Sea Lamprey
Match: mlh1 (mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-040426-1600])

HSP 1 Score: 118.627 bits (296), Expect = 9.860e-28
Identity = 101/357 (28.29%), Postives = 173/357 (48.46%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMA-QSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHL--YLSRRNIH-------IKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENC---------YLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNL 1090
            +++L+++ V  I++  VI      IKE++EN +DA A+ I + +K  GL  I++ D+G G   +D+ ++C+R  TSK+ +F D+ +I TFGFRGE L+SI  +++++I +K TAD+    +    D  G++ A        QGT IT  ++F+N+  R          +K LKS +     +   +SR +IH       +K   ++   +     ++  + I  V GAS        +  E  E N+E           D KL L    Y  N           LF+N R  + + L KA+   Y  +  +  N +P + + L L    VDVN+ P K ++   +   IT+ +Q ++
Sbjct:    8 IRRLDEAVVNRIAAGEVIQRPANAIKEMMENCLDAKATSIQVTVKNGGLKLIQIQDNGTGIRKEDMEIVCERFTTSKLEKFEDLSSIATFGFRGEALASISHVAHVTITTK-TADSMCAYRAMYCD--GKLKAPPKPCAGNQGTQITAEDLFYNVATR----------RKALKSASEEHGKITEVVSRYSIHYSGVSFTLKKQGESTADVRTLPGATTVDNIRAVYGAS--------VARELIEVNYE-----------DKKLVLKMRGYISNANYSMKKCVFLLFINHRLVDSTALRKAIEMVYAAYLPK--NSHPFLYISLELAPQNVDVNVHPTKHEVHFLHEDSITEAVQQHV 330          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Sea Lamprey
Match: mlh3 (mutL homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-060810-45])

HSP 1 Score: 75.0998 bits (183), Expect = 5.181e-14
Identity = 49/151 (32.45%), Postives = 85/151 (56.29%), Query Frame = 2
Query:  116 ISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLD--KIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISN-LSILSKNTADNSVLGKNWVFDKMGQIMAQSA--VTCKQGTAITVSNIFHNLPVR 547
            + S   +S+    ++EL+ NS+DA AS +     R  +D  + +V+D+G G   +D+ ++  R+ TSK  +  D+E +  +G+RGE L+SI ++S+ + I S+ T+ +    K  V   M  ++   A  +    GT +TV N F+NLPVR
Sbjct:   13 LRSGVALSTASQCVEELLLNSLDAGASCV---AARLHMDDFRFQVVDNGNGITSNDLQVLGNRYFTSKCHKIKDLENLRYYGYRGEALASIASVSSVVEITSRATSSSRTYTK--VIQDMQSVIVHEAEKIRPSHGTTVTVHNFFYNLPVR 158          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Sea Lamprey
Match: mlh3 (mutL homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-060810-45])

HSP 1 Score: 74.7146 bits (182), Expect = 5.371e-14
Identity = 49/151 (32.45%), Postives = 85/151 (56.29%), Query Frame = 2
Query:  116 ISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLD--KIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISN-LSILSKNTADNSVLGKNWVFDKMGQIMAQSA--VTCKQGTAITVSNIFHNLPVR 547
            + S   +S+    ++EL+ NS+DA AS +     R  +D  + +V+D+G G   +D+ ++  R+ TSK  +  D+E +  +G+RGE L+SI ++S+ + I S+ T+ +    K  V   M  ++   A  +    GT +TV N F+NLPVR
Sbjct:   13 LRSGVALSTASQCVEELLLNSLDAGASCV---AARLHMDDFRFQVVDNGNGITSNDLQVLGNRYFTSKCHKIKDLENLRYYGYRGEALASIASVSSVVEITSRATSSSRTYTK--VIQDMQSVIVHEAEKIRPSHGTTVTVHNFFYNLPVR 158          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Sea Lamprey
Match: mlh3 (mutL homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-060810-45])

HSP 1 Score: 74.7146 bits (182), Expect = 6.788e-14
Identity = 49/151 (32.45%), Postives = 85/151 (56.29%), Query Frame = 2
Query:  116 ISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLD--KIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISN-LSILSKNTADNSVLGKNWVFDKMGQIMAQSA--VTCKQGTAITVSNIFHNLPVR 547
            + S   +S+    ++EL+ NS+DA AS +     R  +D  + +V+D+G G   +D+ ++  R+ TSK  +  D+E +  +G+RGE L+SI ++S+ + I S+ T+ +    K  V   M  ++   A  +    GT +TV N F+NLPVR
Sbjct:   13 LRSGVALSTASQCVEELLLNSLDAGASCV---AARLHMDDFRFQVVDNGNGITSNDLQVLGNRYFTSKCHKIKDLENLRYYGYRGEALASIASVSSVVEITSRATSSSRTYTK--VIQDMQSVIVHEAEKIRPSHGTTVTVHNFFYNLPVR 158          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Yeast
Match: PMS1 (ATP-binding protein required for mismatch repair; required for both mitosis and meiosis; functions as a heterodimer with Mlh1p; binds double- and single-stranded DNA via its N-terminal domain, similar to E. coli MutL [Source:SGD;Acc:S000005026])

HSP 1 Score: 160.999 bits (406), Expect = 2.222e-41
Identity = 114/363 (31.40%), Postives = 184/363 (50.69%), Query Frame = 2
Query:   80 KMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHH------LYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHEL------------LKSETTEDNHELSLN--LFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFY 1102
            ++ ++ND  V  I+S  VI+ +   +KELV+NSIDA A++I I  K +GL+ IE  D+G G D  +   +  +H TSKI++F D+  + T GFRGE LSS+C I+ LS+++  +   +       +D +G I +++  +  +GT + VS +FHNLPVR + ++  F  Q T K +T    +      +  S  NI  K   +  +       SS ++ I  V GA   +   E+            +  + T+D   L L+  + V   +         + K+  +++VN RP E S L K     Y  F N    ++P++ L L LP S +DVN+ P+KR I L N   + D  +T L  +Y
Sbjct:    3 QIHQINDIDVHRITSGQVITDLTTAVKELVDNSIDANANQIEIIFKDYGLESIECSDNGDGIDPSNYEFLALKHYTSKIAKFQDVAKVQTLGFRGEALSSLCGIAKLSVITTTSPPKA---DKLEYDMVGHITSKTTTSRNKGTTVLVSQLFHNLPVRQKEFSKTFKRQFT-KCLTVIQGYAIINAAIKFSVWNITPKGKKNLILSTMR--NSSMRKNISSVFGAGGMRGLEEVDLVLDLNPFKNRMLGKYTDDPDFLDLDYKIRVKGYISQNSFGCGRNSKDRQFIYVNKRPVEYSTLLKCCNEVYKTFNNV---QFPAVFLNLELPMSLIDVNVTPDKRVILLHNERAVIDIFKTTLSDYY 356          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Yeast
Match: MLH1 (Protein required for mismatch repair in mitosis and meiosis; also required for crossing over during meiosis; forms a complex with Pms1p and Msh2p-Msh3p during mismatch repair; human homolog is associated with hereditary non-polyposis colon cancer [Source:SGD;Acc:S000004777])

HSP 1 Score: 105.916 bits (263), Expect = 5.039e-24
Identity = 57/165 (34.55%), Postives = 97/165 (58.79%), Query Frame = 2
Query:   77 FKMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNS 565
             ++K L+ S V  I++  +I S    +KE++ENSIDA A+ I I +K  G+  +++ D+G G +  D+P++C+R  TSK+ +F D+  I T+GFRGE L+SI  ++ +++ +K   D      ++   KM  + +   V  K GT I V ++F N+P R +   S
Sbjct:    3 LRIKALDASVVNKIAAGEIIISPVNALKEMMENSIDANATMIDILVKEGGIKVLQITDNGSGINKADLPILCERFTTSKLQKFEDLSQIQTYGFRGEALASISHVARVTVTTKVKEDRCAWRVSYAEGKM--LESPKPVAGKDGTTILVEDLFFNIPSRLRALRS 165          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Yeast
Match: MLH2 (Protein involved in mismatch repair and meiotic recombination; only certain frameshift intermediates are mismatch repair substrates; forms a complex with Mlh1p [Source:SGD;Acc:S000004025])

HSP 1 Score: 95.9005 bits (237), Expect = 7.508e-21
Identity = 65/191 (34.03%), Postives = 101/191 (52.88%), Query Frame = 2
Query:   98 DSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKR--FGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGE---VLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIM--AQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIH 643
            +S  K++SSS++   V  V +EL++NSID+ A ++FI++     G + I V DDG G D  D P +C  + TSK+S   DI  + T GFRGE   +LS++C       +   TAD+ V+G+ W+ D  G I    +  V+C  GT + +  +   L  R    +S    +KT   +   ++H  L  RNI 
Sbjct:    9 ESQWKIVSSSFIYGPVAAV-RELLDNSIDSGAKKVFIDVDSTTGGCEYISVKDDGSGVDIIDRPSMCLEYTTSKMSSLGDISILTTLGFRGEALFLLSNLCNQKGSMQVETKTADD-VIGEKWLVDSKGGITNGKRYKVSCPVGTTVILRKLLGGLRARYLEISSR--PRKTFDELIYLINHYSLIHRNIR 195          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Yeast
Match: MLH3 (Protein involved in DNA mismatch repair and meiotic recombination; involved in crossing-over during meiotic recombination; forms a complex with Mlh1p; mammalian homolog is implicated mammalian microsatellite instability [Source:SGD;Acc:S000006085])

HSP 1 Score: 73.559 bits (179), Expect = 6.240e-14
Identity = 53/170 (31.18%), Postives = 88/170 (51.76%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNS-----------VLGKNWVF--DKMGQIMAQSAVTCKQGTAITVSNIFHNLPVR 547
            ++KL+    + + S     S+   ++E+V+NS+DA A+ I + +    L    V DDG G    D+ ++  ++ TSKI +  D+ T+ T+G+RG+ L SI  +SNL + SK    NS           +L +N +   D   +I   S    K GT + V ++ +NLPVR
Sbjct:    5 IRKLDSDVSERLKSQACTVSLASAVREIVQNSVDAHATTIDVMIDLPNLS-FAVYDDGIGLTRSDLNILATQNYTSKIRKMNDLVTMKTYGYRGDALYSISNVSNLFVCSKKKDYNSAWMRKFPSKSVMLSENTILPIDPFWKICPWSRT--KSGTVVIVEDMLYNLPVR 171          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Nematostella
Match: EDO49003 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM2])

HSP 1 Score: 182.956 bits (463), Expect = 1.732e-51
Identity = 110/339 (32.45%), Postives = 185/339 (54.57%), Query Frame = 2
Query:   92 LNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFY 1102
            L   TV  I+SS VI+SV   +KEL+EN++DA A+ I + L+ +GL+KIEV D+G G   DD   + QRH TSKI+ F +++++ ++GFRGE L S+CA+SN+S+++K   +N  +G  +  D+ G+I A   +    GT +T  N+F NLPVR Q        +  LK +   +    L   ++ + L ++ +++         K+A+  +IGA+      E++     +D   L +  FVP    D   +T     +  +++VN RP  +  + + VR  Y+K      NR+P   L + +P   VDVN++P K ++ L+    I D ++ +L + Y
Sbjct:    7 LPQDTVHRIASSQVITSVSSAVKELLENALDAGANSIEVKLEEYGLEKIEVRDNGTGIPQDDAQFMAQRHYTSKITTFHNLDSLASYGFRGEALCSLCAVSNVSVMTK--TNNEEVGMCYTLDQHGRISATKPLPLTTGTVVTACNLFKNLPVRKQFSRGNKKCKDELKKVEELIMAFGLIHPSVRLTLRHNKSIIWQKNKCEDLKKALTGIIGANAMSSMEEII---VKDDQTGLRIEGFVPKPGSDP-NVTSRSMGDRSFVYVNKRPVVLKEIAQVVREFYLKIHPTISNRHPVAFLSIEVPPCAVDVNLEPNKSRVLLTEKDIIIDLLRNSLEELY 339          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Nematostella
Match: EDO34014 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQJ8])

HSP 1 Score: 134.035 bits (336), Expect = 2.140e-32
Identity = 103/360 (28.61%), Postives = 187/360 (51.94%), Query Frame = 2
Query:   92 LNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHI----KXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKY---FHELLKSETTEDNHELSLNL-------------FVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYE 1105
            ++  +V  I S  V+ ++   +KEL+ENS+DA A+ + + LK  G   IEV D+G G +  +   +  +H TSK+ +F+D+  + TFGFRGE LSS+CA+S+LSI +++ +  +  G    +D  G++ ++     +QGT +TV N+F  LPVR + +  L  ++K    +   L    L      I     +    + V++   +S  K+ I  V G  + +    F +L  SE  ED  EL+L++             F+ S  D   G +  D +   + F+N RP ++  + + V   Y  +   N +++P ++L ++L +  VDVN+ P+KR++ L     +   ++T+L + ++
Sbjct:   19 IDRKSVHQICSGQVVLNLATAMKELLENSLDAGATSVDVRLKEHGSHSIEVSDNGAGVEPQNFEALTLKHYTSKLKDFSDLSAVETFGFRGEALSSLCALSDLSITTRHISQTA--GTKLDYDHNGKLKSKLPCAREQGTMVTVLNLFSTLPVRHKEF--LRNIKKEFVKLVHVLQGYCLISAGTRITCTNHVSGRRSTVVSTHGSSQIKDNITAVFGPKQVQSLLPFKQLQPSE--EDCTELNLSVVSNSETNPFTITGFI-SKADHGSGRSSSDRQ---FFFINKRPCDLPKVSRVVSEVYHMY---NRHQFPFVMLDISLKRDAVDVNVTPDKRQVFLQQETLLLATLRTSLIKMFD 365          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Nematostella
Match: EDO31419 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXZ4])

HSP 1 Score: 132.88 bits (333), Expect = 4.632e-32
Identity = 102/360 (28.33%), Postives = 185/360 (51.39%), Query Frame = 2
Query:   92 LNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSR----KEAIPFVIGASKFKY---FHELLKSETTEDNHELSLNL-------------FVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYE 1105
            ++  +V  I S  V+ S+   +KEL+ENS+DA A+ + + LK  G   IEV D+G G +  +   +  +H TSK+ +F+D+  + TFG+RGE LSS+CA+S+LSI +++ +  +  G    +D  G++ ++     +QGT +TV N+F  LPVR + +  L  ++K    +   L    L      I   N      +  +++      K+ I  V G  + +    F +L  SE  ED  EL+L++             F+ S  D   G +  D +   + F+N RP ++  + + V   Y  +   N +++P ++L ++L +  VDVN+ P+KR++ L     +   ++T+L + ++
Sbjct:   19 IDRKSVHQICSGQVVLSLATAMKELLENSLDAGATSVDVRLKEHGSHSIEVSDNGAGVEPQNFEALTLKHYTSKLKDFSDLSAVETFGYRGEALSSLCALSDLSITTRHISQTA--GTKLDYDHNGKLKSKLPCAREQGTMVTVLNLFSTLPVRHKEF--LRNIKKEFVKLVHVLQGYCLISAGTRITCSNHVAGKRSTVVSTHGSLQIKDNITAVFGPKQVQSLLPFKQLQPSE--EDCTELNLSVVSNSESNPFTITGFI-SKADHGSGRSSSDRQ---FFFINKRPCDLPKVSRVVSEVYHMY---NRHQFPFVMLDISLKRDAVDVNVTPDKRQVFLQQEKLLLATLRTSLIKMFD 365          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Nematostella
Match: EDO39827 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W4])

HSP 1 Score: 109.383 bits (272), Expect = 1.324e-24
Identity = 91/355 (25.63%), Postives = 174/355 (49.01%), Query Frame = 2
Query:   74 IFKMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKM-----GQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHL--YLSRRNIH-------IKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDY---KENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQ 1081
            I  ++KL+++ V  I++  VI      +KE++EN +DA ++ I + +K  GL  +++ D+GCG   +D+ ++C+R  TSK+S+F D+ +I+T+GFRGE L+SI  +++++I +K    +     ++   K+     G           +GT ITV ++F+N+  R          +K LKS       +   +S+ +IH       +K   +    +    T+S  + I  + G +  +   EL+  +   DN  L   +        K  +T+ +Y   K    LF+N R  + + L +++ T Y  +  +    +P + + L +  S VDVN+ P K ++   +   I + +Q
Sbjct:    4 IPSIRKLDETVVNRIAAGEVIQRPANALKEMIENCLDAKSTSITVTVKSGGLKLLQIQDNGCGIRKEDMHIVCERFTTSKLSKFEDLSSISTYGFRGEALASISHVAHVTITTKTAHSSCAYKASYSDGKLVPPRPGLPAEPKPCAGNKGTQITVEDLFYNVATR----------RKALKSPGEEYSKVVDVVSKYSIHNTGVAFTLKKQGEATADVRTTSTASLHDNIRAIYGTAVAR---ELVDIDC--DNSRLGFYM--------KGCITNANYSVKKLIFLLFINHRLVDSTALRRSLETVYEAYLPKGT--HPFVYMSLQITPSNVDVNVHPTKHEVHFLHEDAIVEAVQ 333          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Nematostella
Match: EDO46831 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP06])

HSP 1 Score: 80.4925 bits (197), Expect = 2.545e-16
Identity = 51/174 (29.31%), Postives = 96/174 (55.17%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACAS--RIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSS---ICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQK 583
            ++ L+      + S   IS++   I ELV N++DA AS   + +++  F   +++V D+G G   D++ ++ QR+CTSK    +D+  ++++GFRGE L+S   IC +  L I++K+++      K +   K   +          GT +T+ +IF NLPVR ++ +S+   ++
Sbjct:    2 IRHLDTGIRSHLRSGVAISTLTQAIDELVTNALDAGASCINVHVDIPSF---RVQVSDNGSGITKDNLEILGQRYCTSKCHSLSDLRKLSSYGFRGEALASIRDICGV--LEIVTKHSSSYKTYCKLFRSGKPLTVTQSCFPRSNTGTTVTIHDIFSNLPVRRKLLSSVLDFER 170          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Medaka
Match: pms1 (PMS1 homolog 1, mismatch repair system component [Source:NCBI gene;Acc:101157983])

HSP 1 Score: 179.874 bits (455), Expect = 1.710e-46
Identity = 119/355 (33.52%), Postives = 192/355 (54.08%), Query Frame = 2
Query:   71 KIF-KMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTY--MKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNN 1120
            +IF  MK L   +V+L+SSS VI+SV  V+KEL+ENS+DA AS I + L+ FGLD+IEV D+G G    D  ++  RH TSKI    D+E + T+GFRGE L SICA++ L + +K   D+  +   +  D  G+I+AQ      QGT++T   +F NLPVR Q Y S    ++ LK +   L    + +  + + L+++  VV      +  + A+   +G S       LL+    ++  E+ L+ F+P    D    T     +  +L+VN+RP ++  + K +R  Y      +   NRYP ++L +T+  S +DVN+ P+K ++ L +   +   ++  L   Y   P++
Sbjct:   78 RIFGAMKLLPPDSVRLLSSSQVITSVVNVVKELLENSLDAGASSIDVKLENFGLDRIEVRDNGHGVKAADASVMAVRHFTSKICSHEDLEHLETYGFRGEALGSICAVAELIVTTKTEEDD--ISTQYTLDPTGKIVAQKPSHLGQGTSVTALKLFKNLPVRRQYYTSTKKCKEELKKVQDLLITYAIIKPELRLSLVHNKVVVWQKTKVADNRSALLATLGPS---VVANLLQCHQQQEEPEIILDGFLPKPGAD-YSSTSSSAPDKTFLYVNNRPVQLKEIMKLLRQHYCAQYLEDAVRNRYPILMLNITVSPSSLDVNLTPDKSQVLLHDKEAVLTAVEALLVSLYGFRPSS 426          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Medaka
Match: pms2 (PMS1 homolog 2, mismatch repair system component [Source:NCBI gene;Acc:101169320])

HSP 1 Score: 151.754 bits (382), Expect = 1.294e-37
Identity = 114/377 (30.24%), Postives = 193/377 (51.19%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDDVPL--ICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNS---------LFVLQK-TLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKY---FHELLKSETTEDNHEL----------SLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNINEELP 1138
            +K ++  +V  I S  V+ S+   +KELVENS+DA A+ I I L+  G+++IEV D+G G  +     +  +H TSK+ +F+D+  + TFGFRGE LSS+CA+S+LS+++    ++S +G   VFD  GQ++ +S    +QGT + +  +FH LPVR + +           + VLQ   + S    L     S R   + +L+ +        + S +E I  + G  + +    F +   SE   + + L          S+  F+ S  D  +G +  D +   + F+N+RP +   + K V   Y  +   N ++YP + L + +    VDVN+ P+KR+I L     +   ++T+L   YE+  N I+  LP
Sbjct:   13 IKAIDKHSVHQICSGQVVLSLATAVKELVENSVDAGATNIDIKLRDCGVEQIEVSDNGKGVKEANFEGLTLKHHTSKLRDFSDLIHVETFGFRGEALSSLCALSDLSVIT--CHESSQVGTKLVFDHKGQLVQKSPHPRQQGTTVALQQLFHTLPVRHKEFQRNIKKEYAKMIHVLQAYCIISAGVRLTCSNQSGRGKRVTVLSTSG-------SQSMRENIGAIFGPKQLQSLLPFQQTSPSENVLEEYGLKEAELPEQLFSIAGFI-SRSDHGVGRSATDRQ---FFFINNRPCDPLKITKVVNEVYHSY---NRHQYPFVALNIAVASECVDVNVTPDKRQIFLQEEKVLLATLKTSLINMYEAGVNKISLNLP 373          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Medaka
Match: mlh1 (mutL homolog 1 [Source:NCBI gene;Acc:111948792])

HSP 1 Score: 107.071 bits (266), Expect = 1.552e-23
Identity = 93/349 (26.65%), Postives = 157/349 (44.99%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHL--YLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENC---------YLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNL 1090
            +++L+++ V  I++  VI      +KE++EN +DA A+ I + +K  GL  +++ D+G G   DD+ ++C+R  TSK+  F D+ +I T+GFRGE L+SI  +++++I +K TAD     +    D   +          QGT I V ++F+N+  R          +K LKS       +   +SR  IH    +         +   R   +P    AS       +         + +S  L      D KL      Y  N           LF+N R  E S L KAV T Y  +  +    +P + L L +    VDVN+ P K ++   +   + + +Q ++
Sbjct:    5 IRRLDETVVNRIAAGEVIQRPANAVKEMIENCLDAKATNIQVTVKDGGLKLLQIQDNGTGIRKDDMEIVCERFTTSKLQTFEDLSSIATYGFRGEALASISHVAHVTITTK-TADAKCAYRASYRDGKPR-GPPKPCAGNQGTQIMVEDLFYNVSTR----------RKALKSPADEYSRIVEVVSRYAIHNSGKSLTVKKQGETVADVR--TLP---NASVVDNIRSVF-------GNAVSRELIQVGCEDPKLAFKMSGYISNANYSVKKYVFILFINHRLVESSALKKAVETVYAAYLPKKT--HPFLYLSLEISPQNVDVNVHPTKHEVHFLHEDSVIESVQKHI 327          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Medaka
Match: mlh3 (mutL homolog 3 [Source:NCBI gene;Acc:101166595])

HSP 1 Score: 80.1073 bits (196), Expect = 6.590e-15
Identity = 50/157 (31.85%), Postives = 87/157 (55.41%), Query Frame = 2
Query:  116 ISSSYVISSVECVIKELVENSIDACAS--RIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNL-SILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLF 571
            + S   I S++  ++ELV NSIDA A+   + ++L+ F   K++VID+G G   +++  +  R+ TSK     D++ + + GFRGE L+SI +++ L  I S++ A    L K +   +   +     V    GT + V N FHN+PVR +  +++ 
Sbjct:   26 LRSGVAIPSLQQCVEELVLNSIDAGATCVGVRMDLEAF---KVQVIDNGAGMNTENMQRVGNRYHTSKCGSLEDLDNVKSHGFRGEALASIVSMATLVEISSRSRASAKTLVKLFKDGRGVDVFEAETVRPSAGTTVIVCNFFHNMPVRRRRLDAVL 179          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Planmine SMEST
Match: SMESG000066771.1 (SMESG000066771.1)

HSP 1 Score: 1408.28 bits (3644), Expect = 0.000e+0
Identity = 728/737 (98.78%), Postives = 733/737 (99.46%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNINEELPVANDGYNINKLPLSCELPTTYLRTIRPSNLNEISDIFSSTDASLTEENESNKTFQTDQNEIPSTKESRFEFNQDFALGKSNEIIDHPVRNVNLKRAISDINKEIKDKRSKMENNSQKLPELNFINQVPISKSTKESSSNVKCLVHLCLDSLDXXXXXXXXXXXXXXXLRIVASWDSFVICYEFRSSEDQKLHETQDLVFFRKEQFIFTSIYFVNISGMQIPAFKLSSPYLIGSNHGDLVENLLKLPVQLIYNRITGDKFNVISCPHLIKNGYRIHHIKNNDNNCFEITTKPEFIDENVLVDEIRLILAQSSDSPNIIRTRAGRQWIYSASLSEAKLKIDDEIKKLTEKRLNEFFKCCMSNINRCRLSERLDEHLPELFRVSLNKC 2293
            MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNS LGKNWVFDKMGQIMA SAVTCKQGT ITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKLLNDNNVVLNLPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHE+SLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLR+FYESLPNN+NEELPVAN+GYNINKLPLSCELPTTYLRTIRPSNLNEISDIFSSTDASLTEENESNKTFQTDQNEI STKESRFEFNQDFALGKSNEIIDHPVRNVNLKRAISDINKEIKDKR+KMENNSQKLPELNFINQVPISKSTKESSSNVKCLVHLCLDSLDNKSRSVRNVMNVNNNLRIVASWDSFVICYEFRSSEDQKLHETQDLVFFRKEQFIFTSIYFVNISGMQIPAFKLSSPYLIGSNHGDLVENLLKLPVQLIYNRITGDKFNVISCPHLIKNGYRIHHIKNNDNNCFEITTKPEFIDENVLVDEIRLILAQSSDSPNIIRTRAGRQWIYSASLSEAKLKIDDEIKKLTEKRLNEFFKCCMSNINRCRLSERLDEHLPELFRVSLNKC
Sbjct:    1 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSALGKNWVFDKMGQIMAHSAVTCKQGTTITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKLLNDNNVVLNLPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHEMSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRKFYESLPNNVNEELPVANNGYNINKLPLSCELPTTYLRTIRPSNLNEISDIFSSTDASLTEENESNKTFQTDQNEIHSTKESRFEFNQDFALGKSNEIIDHPVRNVNLKRAISDINKEIKDKRTKMENNSQKLPELNFINQVPISKSTKESSSNVKCLVHLCLDSLDNKSRSVRNVMNVNNNLRIVASWDSFVICYEFRSSEDQKLHETQDLVFFRKEQFIFTSIYFVNISGMQIPAFKLSSPYLIGSNHGDLVENLLKLPVQLIYNRITGDKFNVISCPHLIKNGYRIHHIKNNDNNCFEITTKPEFIDENVLVDEIRLILAQSSDSPNIIRTRAGRQWIYSASLSEAKLKIDDEIKKLTEKRLNEFFKCCMSNINRCRLSERLDEHLPELFRVSLNKC 737          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Planmine SMEST
Match: SMESG000066771.1 (SMESG000066771.1)

HSP 1 Score: 1096.26 bits (2834), Expect = 0.000e+0
Identity = 576/585 (98.46%), Postives = 581/585 (99.32%), Query Frame = 2
Query:   83 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNINEELPVANDGYNINKLPLSCELPTTYLRTIRPSNLNEISDIFSSTDASLTEENESNKTFQTDQNEIPSTKESRFEFNQDFALGKSNEIIDHPVRNVNLKRAISDINKEIKDKRSKMENNSQKLPELNFINQVPISKSTKESSSNVKCLVHLCLDSLDXXXXXXXXXXXXXXXLRIVASWDSFVICYEFRSSEDQKLHETQDLVFFRKEQFIFTSIYFVNISGMQIPAFKLSSPYLIGS 1837
            MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNS LGKNWVFDKMGQIMA SAVTCKQGT ITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKLLNDNNVVLNLPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHE+SLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLR+FYESLPNN+NEELPVAN+GYNINKLPLSCELPTTYLRTIRPSNLNEISDIFSSTDASLTEENESNKTFQTDQNEI STKESRFEFNQDFALGKSNEIIDHPVRNVNLKRAISDINKEIKDKR+KMENNSQKLPELNFINQVPISKSTKESSSNVKCLVHLCLDSLDNKSRSVRNVMNVNNNLRIVASWDSFVICYEFRSSEDQKLHETQDLVFFRKEQFIFTSIYFVNISGMQIPAFKLSSPYLIGS
Sbjct:    1 MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFDDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSALGKNWVFDKMGQIMAHSAVTCKQGTTITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKLLNDNNVVLNLPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHEMSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRKFYESLPNNVNEELPVANNGYNINKLPLSCELPTTYLRTIRPSNLNEISDIFSSTDASLTEENESNKTFQTDQNEIHSTKESRFEFNQDFALGKSNEIIDHPVRNVNLKRAISDINKEIKDKRTKMENNSQKLPELNFINQVPISKSTKESSSNVKCLVHLCLDSLDNKSRSVRNVMNVNNNLRIVASWDSFVICYEFRSSEDQKLHETQDLVFFRKEQFIFTSIYFVNISGMQIPAFKLSSPYLIGS 585          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Planmine SMEST
Match: SMESG000004803.1 (SMESG000004803.1)

HSP 1 Score: 127.487 bits (319), Expect = 3.385e-30
Identity = 111/369 (30.08%), Postives = 185/369 (50.14%), Query Frame = 2
Query:  143 VECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGFD--DVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHI---KXXXXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDN-HELSLNLFVPSSVD--DKLGLT----------HCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQI---------TDFIQTNLRQFYESLPNNINEELPVA-NDGYNIN 1165
            +   IKEL+ENS+DA + +I I LK FG D IEV+D+G G    +      R+ TSK+  F D+  + TFGFRGE L+S+C + ++ I + N+   S+ G    FD+ G+I++ ++V  ++GT +++ NIFH LPVR + +  L  L++        +    L    + I   K+  +  V+L+        E I  V G ++     EL    TTE N ++  L+ F  S V   +K+ L+                  +L+VN RP E+  + + +   Y      N    P+ V+ ++LPK  VDVNI+P+KR + L N  ++         + F+++   Q Y S+   ++E +    N+ Y +N
Sbjct:    1 MAAAIKELIENSLDADSGKIEIRLKNFGADIIEVLDNGTGISPHEFDKFTSRNTTSKLENFDDLNNLETFGFRGEALNSLCFLGDVEIHT-NSLTTSI-GSLLKFDQYGKIISLNSVARQKGTTVSIRNIFHTLPVRRKQF--LGNLKREFDKALNYITSYCLICEGVQISCCKIDKNKQVILSTRGIGGISENIKSVFGQNQLNGMIEL----TTEHNINQDILDEFNISKVANLEKIELSGWISQPTEVFKSSNSSKQFLYVNRRPCELPKVKRLIAECYRVMNKTN---NPTFVISISLPKETVDVNIEPDKRILLLDNQSEVFAVIKASILSCFLKSGYSQEYRSINQTLSESVNSKFNNNYTLN 358          
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Planmine SMEST
Match: SMESG000011828.1 (SMESG000011828.1)

HSP 1 Score: 118.242 bits (295), Expect = 3.416e-27
Identity = 93/342 (27.19%), Postives = 167/342 (48.83%), Query Frame = 2
Query:   71 KIFKMKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLDKIEVIDDGCGF--DDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICAISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFHNLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKXX---XXXXXXXXXPMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDKLGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVLYLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQ 1081
            +I ++KKL+D+ +  I++  +I      IKEL+ENS+DA +++I I++K+ GL  I++ D+G G   +D P++C++  TSK+ EF D+ TI+TFGFRGE L+S+  ++++ I SK    +S       F     +          GT + V ++F+N+P+R     S       +  + +N   L   + +I +K +     ++  + +   +S ++ +  + G        EL K   T D     L+ F+   +       + + K    LF+N R      L K++   Y     +  + YP   L+L LP   +DVN+ P K ++   +   I   IQ
Sbjct:    3 EIKRIKKLDDNVINKIAAGEIIQRPANAIKELLENSLDANSTQIIISVKQGGLGVIQIQDNGSGICKEDFPILCEKFTTSKLQEFHDLLTISTFGFRGEALASVTHVAHVQITSKTI--DSPCAYKAEFSNSKLLKPPKPCAGNTGTIVRVEDLFYNIPIRKASLKSAREEYSKIIEVVSNYAILNAHKCSITLKKIDDNATSSPDVRIVAETSIEDCVVELFGG-------ELSKQLLTIDLKNDKLDFFLSGRISKP---NYNNRKFRFILFINQRLVHCDLLKKSIENVYGNLLPK--HTYPFAFLHLQLPSKNIDVNVHPTKFEVHFLHQELIVASIQ 330          
The following BLAST results are available for this feature:
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PMS12.457e-4632.29PMS1 homolog 1, mismatch repair system component [... [more]
PMS14.801e-4632.20PMS1 homolog 1, mismatch repair system component [... [more]
PMS16.274e-4230.84PMS1 homolog 1, mismatch repair system component [... [more]
PMS16.274e-4230.84PMS1 homolog 1, mismatch repair system component [... [more]
PMS17.801e-4230.84PMS1 homolog 1, mismatch repair system component [... [more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pms-28.934e-3125.20PMS (Post Meiotic Segregation) family [Source:Uni... [more]
mlh-15.221e-2335.67MLH (MutL Homolog) family [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Mlh11.381e-3127.70gene:FBgn0011659 transcript:FBtr0088790[more]
Pms21.751e-3028.45gene:FBgn0011660 transcript:FBtr0087388[more]
Mlh11.938e-3027.70gene:FBgn0011659 transcript:FBtr0331379[more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pms13.109e-4733.15PMS1 homolog 1, mismatch repair system component [... [more]
pms13.109e-4733.15PMS1 homolog 1, mismatch repair system component [... [more]
pms13.560e-4733.15PMS1 homolog 1, mismatch repair system component [... [more]
pms23.657e-3127.69PMS1 homolog 2, mismatch repair system component [... [more]
pms27.100e-3127.69PMS1 homolog 2, mismatch repair system component [... [more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col2a14.500e-4834.29collagen, type II, alpha 1 [Source:Xenbase;Acc:XB-... [more]
col2a15.093e-4834.29collagen, type II, alpha 1 [Source:Xenbase;Acc:XB-... [more]
col2a13.666e-4734.83collagen, type II, alpha 1 [Source:Xenbase;Acc:XB-... [more]
col2a15.420e-4734.83collagen, type II, alpha 1 [Source:Xenbase;Acc:XB-... [more]
col2a17.436e-4734.83collagen, type II, alpha 1 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pms13.055e-4430.84PMS1 homolog 1, mismatch repair system component [... [more]
Pms11.352e-4330.84PMS1 homolog 1, mismatch repair system component [... [more]
Pms24.749e-3829.27PMS1 homolog2, mismatch repair system component [S... [more]
Pms22.319e-2940.13PMS1 homolog2, mismatch repair system component [S... [more]
Pms11.884e-2843.41PMS1 homolog 1, mismatch repair system component [... [more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P54277|PMS1_HUMAN2.306e-4532.20PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=... [more]
sp|P14242|PMS1_YEAST1.543e-3931.40DNA mismatch repair protein PMS1 OS=Saccharomyces ... [more]
sp|B0BA28|MUTL_CHLTB2.408e-3730.17DNA mismatch repair protein MutL OS=Chlamydia trac... [more]
sp|B0B8E9|MUTL_CHLT22.408e-3730.17DNA mismatch repair protein MutL OS=Chlamydia trac... [more]
sp|O84579|MUTL_CHLTR2.570e-3730.65DNA mismatch repair protein MutL OS=Chlamydia trac... [more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6K6X22.083e-4932.77DNA_mis_repair domain-containing protein (Fragment... [more]
A0A218UNH39.892e-4935.13PMS1 1 OS=Lonchura striata domestica OX=299123 GN=... [more]
A7RHM21.253e-4732.45Predicted protein (Fragment) OS=Nematostella vecte... [more]
A0A2I4DAP61.780e-4733.14PMS1 protein homolog 1-like OS=Austrofundulus limn... [more]
A0A444U8P82.451e-4732.39PMS1 protein-like 1 OS=Acipenser ruthenus OX=7906 ... [more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pms11.908e-4431.88PMS1 homolog 1, mismatch repair system component [... [more]
pms22.719e-3527.03PMS1 homolog 2, mismatch repair system component [... [more]
mlh13.888e-2627.92mutL homolog 1, colon cancer, nonpolyposis type 2 ... [more]
mlh31.229e-1533.33mutL homolog 3 [Source:NCBI gene;Acc:103038515][more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pms13.267e-4634.01PMS1 homolog 1, mismatch repair system component [... [more]
mlh19.860e-2828.29mutL homolog 1, colon cancer, nonpolyposis type 2 ... [more]
mlh35.181e-1432.45mutL homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
mlh35.371e-1432.45mutL homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
mlh36.788e-1432.45mutL homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
PMS12.222e-4131.40ATP-binding protein required for mismatch repair; ... [more]
MLH15.039e-2434.55Protein required for mismatch repair in mitosis an... [more]
MLH27.508e-2134.03Protein involved in mismatch repair and meiotic re... [more]
MLH36.240e-1431.18Protein involved in DNA mismatch repair and meioti... [more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO490031.732e-5132.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340142.140e-3228.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314194.632e-3228.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398271.324e-2425.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468312.545e-1629.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pms11.710e-4633.52PMS1 homolog 1, mismatch repair system component [... [more]
pms21.294e-3730.24PMS1 homolog 2, mismatch repair system component [... [more]
mlh11.552e-2326.65mutL homolog 1 [Source:NCBI gene;Acc:111948792][more]
mlh36.590e-1531.85mutL homolog 3 [Source:NCBI gene;Acc:101166595][more]
back to top
BLAST of PMS1 protein-like protein 1 DNA mismatch repair protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000066771.10.000e+098.78SMESG000066771.1[more]
SMESG000066771.10.000e+098.46SMESG000066771.1[more]
SMESG000004803.13.385e-3030.08SMESG000004803.1[more]
SMESG000011828.13.416e-2727.19SMESG000011828.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028625 ID=SMED30028625|Name=PMS1 protein-like protein 1 DNA mismatch repair protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2335bp
GGAAAGTGTGAATTTATATAATACATTAAATCTCGTTTTTTGATAACAAT
AGTTTTTGTAAAACTATTTTAAAATTTTCAAAATGAAAAAATTAAATGAT
TCCACTGTTAAACTAATATCAAGTAGTTATGTTATATCATCAGTTGAATG
TGTAATAAAAGAATTGGTTGAAAATTCAATAGATGCTTGCGCTAGTCGAA
TATTTATTAATTTAAAAAGATTTGGTTTAGATAAAATAGAAGTTATCGAT
GACGGTTGTGGGTTTGATGATGTTCCATTAATATGTCAAAGGCATTGTAC
ATCGAAAATTTCCGAATTTACCGATATTGAAACCATTAATACCTTTGGTT
TTCGAGGAGAGGTCTTATCATCTATCTGTGCCATATCAAATCTATCTATA
CTATCTAAAAATACTGCAGATAATTCGGTCCTCGGTAAAAATTGGGTGTT
TGATAAAATGGGACAAATAATGGCACAGTCTGCTGTCACATGCAAACAGG
GAACCGCAATAACAGTATCAAACATATTTCACAACCTCCCTGTTCGTTGT
CAAATGTATAATTCTTTGTTTGTCTTACAAAAAACCTTGAAATCGATCAC
CACGAACCTTCACCACTTGTATCTATCCAGAAGAAACATACATATTAAAT
TATTAAATGATAATAATGTTGTTTTAAATCTTCCAATGACCTCTTCAAGA
AAGGAAGCGATTCCCTTTGTGATTGGTGCTAGTAAATTCAAGTATTTTCA
TGAATTGCTGAAATCAGAGACTACAGAAGACAATCATGAATTGTCTTTGA
ATCTTTTCGTCCCTAGTTCTGTAGATGATAAATTAGGTCTAACTCACTGT
GACTACAAGGAAAATTGCTATTTATTTGTGAATGATCGGCCAGCTGAAGT
GTCTTTTTTATTTAAAGCAGTTCGAACGACTTATATGAAATTTACAAACC
AAAACCTCAACAGATACCCCTCTATGGTTTTATATCTGACCTTGCCAAAA
TCATGGGTCGATGTGAATATTGATCCGGAAAAAAGAAAAATTAAACTTAG
TAATACGCTTCAAATTACTGATTTTATCCAGACAAATTTGAGACAATTTT
ATGAATCACTTCCCAATAATATTAATGAGGAACTACCAGTAGCAAATGAC
GGTTATAACATAAATAAATTACCCTTATCCTGTGAACTTCCAACAACTTA
TCTCCGTACAATTAGACCTTCTAATTTAAACGAGATTTCTGATATATTTT
CATCTACGGATGCTTCCTTAACTGAAGAAAACGAAAGCAATAAAACCTTC
CAAACAGATCAAAATGAAATCCCTTCAACCAAAGAGAGTCGTTTTGAATT
TAATCAAGATTTTGCTTTGGGAAAATCCAATGAAATTATTGATCACCCAG
TGAGAAATGTAAATTTAAAAAGAGCAATCTCAGATATTAACAAGGAAATA
AAAGATAAAAGATCAAAAATGGAGAATAATTCCCAAAAATTACCTGAACT
CAACTTTATTAACCAAGTCCCTATTTCGAAGTCAACCAAAGAATCATCTT
CAAATGTTAAATGTCTTGTTCATTTATGCTTAGATTCTTTGGACAATAAA
TCAAGATCAGTTAGAAATGTAATGAATGTAAACAACAATTTGAGAATAGT
AGCTTCTTGGGATTCCTTTGTAATATGTTACGAATTCCGTAGTTCAGAGG
ATCAGAAGCTCCATGAGACGCAAGATTTGGTGTTTTTTAGAAAAGAACAA
TTCATTTTTACTAGCATATATTTTGTGAATATTTCCGGAATGCAAATTCC
CGCTTTTAAATTGTCTTCTCCTTATTTAATAGGCAGCAATCATGGAGATC
TTGTTGAAAATCTGTTGAAATTGCCAGTTCAGTTAATTTACAACAGAATC
ACCGGAGACAAATTCAATGTTATCAGTTGTCCGCATTTAATTAAAAATGG
CTACCGAATTCACCACATTAAAAACAATGACAATAATTGTTTCGAAATCA
CTACAAAACCGGAATTCATCGATGAGAATGTTCTGGTTGACGAGATTCGC
CTAATACTCGCGCAATCATCTGATTCGCCGAATATTATTCGCACCCGCGC
CGGTCGGCAATGGATTTACTCAGCATCTCTAAGTGAAGCCAAATTGAAAA
TAGATGATGAAATTAAGAAACTAACGGAAAAACGGCTTAATGAATTCTTT
AAATGTTGCATGTCAAATATTAATAGATGTAGATTATCCGAAAGATTAGA
TGAGCATCTTCCTGAATTATTTAGAGTTAGCTTGAATAAATGTTAGAATT
CTATTTTATAAATTTATCTAACAGATGTTTTCATC
back to top

protein sequence of SMED30028625-orf-1

>SMED30028625-orf-1 ID=SMED30028625-orf-1|Name=SMED30028625-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=738bp
MKKLNDSTVKLISSSYVISSVECVIKELVENSIDACASRIFINLKRFGLD
KIEVIDDGCGFDDVPLICQRHCTSKISEFTDIETINTFGFRGEVLSSICA
ISNLSILSKNTADNSVLGKNWVFDKMGQIMAQSAVTCKQGTAITVSNIFH
NLPVRCQMYNSLFVLQKTLKSITTNLHHLYLSRRNIHIKLLNDNNVVLNL
PMTSSRKEAIPFVIGASKFKYFHELLKSETTEDNHELSLNLFVPSSVDDK
LGLTHCDYKENCYLFVNDRPAEVSFLFKAVRTTYMKFTNQNLNRYPSMVL
YLTLPKSWVDVNIDPEKRKIKLSNTLQITDFIQTNLRQFYESLPNNINEE
LPVANDGYNINKLPLSCELPTTYLRTIRPSNLNEISDIFSSTDASLTEEN
ESNKTFQTDQNEIPSTKESRFEFNQDFALGKSNEIIDHPVRNVNLKRAIS
DINKEIKDKRSKMENNSQKLPELNFINQVPISKSTKESSSNVKCLVHLCL
DSLDNKSRSVRNVMNVNNNLRIVASWDSFVICYEFRSSEDQKLHETQDLV
FFRKEQFIFTSIYFVNISGMQIPAFKLSSPYLIGSNHGDLVENLLKLPVQ
LIYNRITGDKFNVISCPHLIKNGYRIHHIKNNDNNCFEITTKPEFIDENV
LVDEIRLILAQSSDSPNIIRTRAGRQWIYSASLSEAKLKIDDEIKKLTEK
RLNEFFKCCMSNINRCRLSERLDEHLPELFRVSLNKC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005524ATP binding
GO:0030983mismatched DNA binding
GO:0005515protein binding
GO:0016887ATPase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000421tail
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036890HATPase_C_sf
IPR031263PMS1_hom
IPR038973MutL/Mlh/Pms
IPR013507DNA_mismatch_S5_2-like
IPR014721Ribosomal_S5_D2-typ_fold_subgr
IPR003594HATPase_C
IPR020568Ribosomal_S5_D2-typ_fold
Vocabulary: biological process
TermDefinition
GO:0006298mismatch repair
GO:0000710meiotic mismatch repair
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0032300mismatch repair complex
GO:0032389MutLalpha complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 442..469
NoneNo IPR availableCDDcd16926HATPase_MutL-MLH-PMS-likecoord: 24..198
e-value: 5.34211E-58
score: 193.037
NoneNo IPR availableCDDcd00782MutL_Transcoord: 263..340
e-value: 3.29697E-16
score: 73.3445
IPR013507DNA mismatch repair protein, S5 domain 2-likeSMARTSM01340DNA_mis_repair_2coord: 213..341
e-value: 3.6E-11
score: 53.1
IPR013507DNA mismatch repair protein, S5 domain 2-likePFAMPF01119DNA_mis_repaircoord: 226..340
e-value: 4.9E-17
score: 61.7
IPR036890Histidine kinase/HSP90-like ATPase superfamilyGENE3DG3DSA:3.30.565.10coord: 1..214
e-value: 9.1E-57
score: 194.0
IPR036890Histidine kinase/HSP90-like ATPase superfamilySUPERFAMILYSSF55874ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinasecoord: 3..215
IPR014721Ribosomal protein S5 domain 2-type fold, subgroupGENE3DG3DSA:3.30.230.10coord: 215..348
e-value: 1.3E-18
score: 68.8
IPR031263PMS1 protein homologue 1PANTHERPTHR10073:SF43PMS1 PROTEIN HOMOLOG 1-RELATEDcoord: 1..502
IPR038973DNA mismatch repair protein MutL/Mlh/PmsPANTHERPTHR10073DNA MISMATCH REPAIR PROTEIN MLH, PMS, MUTLcoord: 1..502
IPR020568Ribosomal protein S5 domain 2-type foldSUPERFAMILYSSF54211Ribosomal protein S5 domain 2-likecoord: 192..341