Ww domain binding protein 11

Overview
NameWw domain binding protein 11
Smed IDSMED30028613
Length (bp)2379
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ww domain binding protein 11 (SMED30028613) t-SNE clustered cells

Violin plots show distribution of expression levels for Ww domain binding protein 11 (SMED30028613) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ww domain binding protein 11 (SMED30028613) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ww domain binding protein 11 (SMED30028613) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028613

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028613h1SMcG0017272 SmedASXL_012570SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028613h1SMcG0017272 SmedASXL_012570SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30028613h1SMcG0017272 dd_Smed_v4_5026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ww domain binding protein 11 vs. Ensembl Human
Match: WBP11 (WW domain binding protein 11 [Source:HGNC Symbol;Acc:HGNC:16461])

HSP 1 Score: 123.635 bits (309), Expect = 1.548e-28
Identity = 79/145 (54.48%), Postives = 107/145 (73.79%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP 1401
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   ++ +    D  E++P     L+++VL++KRKKL ET++R++ LY KE+ D   EL+ L  EY++KR ++  Y+D VK A+ V    IPLPD+P
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMP 145          
BLAST of Ww domain binding protein 11 vs. Ensembl Human
Match: WBP11 (WW domain binding protein 11 [Source:HGNC Symbol;Acc:HGNC:16461])

HSP 1 Score: 104.76 bits (260), Expect = 5.306e-25
Identity = 72/132 (54.55%), Postives = 99/132 (75.00%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAE 1362
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   ++ +    D  E++P     L+++VL++KRKKL ET++R++ LY KE+ D   EL+ L  EY++KR ++  Y+D VK +E
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKPSE 132          
BLAST of Ww domain binding protein 11 vs. Ensembl Human
Match: WBP11 (WW domain binding protein 11 [Source:HGNC Symbol;Acc:HGNC:16461])

HSP 1 Score: 50.8322 bits (120), Expect = 7.811e-8
Identity = 41/49 (83.67%), Postives = 46/49 (93.88%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKD 1113
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKD 49          
BLAST of Ww domain binding protein 11 vs. Ensembl Fly
Match: CG2685 (gene:FBgn0024998 transcript:FBtr0070499)

HSP 1 Score: 112.079 bits (279), Expect = 1.915e-25
Identity = 77/142 (54.23%), Postives = 104/142 (73.24%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLP 1392
            MGRRS NTTKSGK+MNPTD+ARKEAR+KELKKNKKQR  VR AVLK+KD + +LEE    D  EY+    S L+++VL++KRKKL ET+DR++ LY  ++ +   +L+    EY++KR +   YY+ VK A+ V  ++IPLP
Sbjct:    1 MGRRSINTTKSGKYMNPTDQARKEARKKELKKNKKQRQMVRAAVLKNKDPSQILEEMEKIDEMEYNVLQPSPLNEKVLRDKRKKLKETFDRVMRLYHNDEPEHWADLKRKEVEYEKKRLKKQQYYESVKHAQSVQIDEIPLP 142          

HSP 2 Score: 55.8398 bits (133), Expect = 1.145e-7
Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 1
Query: 2050 GTTTIEAKPQLKNLIGDSTKLVPTQLRIKKATKPNKLSAVSGFKNELVNDRSREHIT--SKDDAYDQFMKEMEGLL 2271
            G  TI AKPQ++NL  D T+ VP+ LR+K+  +  + +      N+  +  S  H    +KDDAY QFM EM+GLL
Sbjct:  478 GVATITAKPQIRNLSADVTRFVPSTLRVKREDQ-RRTARPRHAANDGHHAHSEAHSKPPTKDDAYLQFMNEMQGLL 552          
BLAST of Ww domain binding protein 11 vs. Ensembl Zebrafish
Match: wbp11 (WW domain binding protein 11 [Source:NCBI gene;Acc:402950])

HSP 1 Score: 80.4925 bits (197), Expect = 2.595e-15
Identity = 36/85 (42.35%), Postives = 60/85 (70.59%), Query Frame = 1
Query: 1147 DRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP 1401
            D+ +++P     L+++VL++KRKKL ET++R++ LY +E+ +   EL+ L  EY+ KR ++ LY+D VK AE V  + IPLP++P
Sbjct:    5 DQAQFNPVQQPLLNEKVLRDKRKKLRETFERIVRLYERENPETYKELRKLELEYETKRGQLSLYFDSVKNAESVEVDSIPLPEMP 89          
BLAST of Ww domain binding protein 11 vs. Ensembl Xenopus
Match: wbp11 (WW domain binding protein 11 [Source:NCBI gene;Acc:448171])

HSP 1 Score: 120.553 bits (301), Expect = 6.589e-28
Identity = 76/145 (52.41%), Postives = 107/145 (73.79%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP 1401
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   ++ +    D  E++P     L+++VL++KRKKL ET++R++ LY KE+ +   EL+ +  +Y+ KR+++  Y+D VK A+ V    IPLPD+P
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPETYKELRKIELDYEHKRSQLSQYFDAVKNAQHVEVESIPLPDLP 145          

HSP 2 Score: 50.447 bits (119), Expect = 9.989e-6
Identity = 32/85 (37.65%), Postives = 44/85 (51.76%), Query Frame = 1
Query: 2053 TTTIEAKPQLKNLIGDSTKLVPTQLRIKKATKPNKLSAVSGFKNELVNDRSRE------------HITSKDDAYDQFMKEMEGLL 2271
            T TI AKPQ+ N   + T+ VPT LR+++    NK S  +    +   D +R              + +KDD Y+ FMKEMEGLL
Sbjct:  463 TATISAKPQITNPKAEVTRFVPTALRVRRE---NKGSVAAAAPKKPEEDIARPVSKAGPKPGAQMPVQTKDDMYEAFMKEMEGLL 544          
BLAST of Ww domain binding protein 11 vs. Ensembl Xenopus
Match: wbp11 (WW domain binding protein 11 [Source:NCBI gene;Acc:448171])

HSP 1 Score: 120.553 bits (301), Expect = 1.291e-27
Identity = 76/145 (52.41%), Postives = 107/145 (73.79%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP 1401
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   ++ +    D  E++P     L+++VL++KRKKL ET++R++ LY KE+ +   EL+ +  +Y+ KR+++  Y+D VK A+ V    IPLPD+P
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPETYKELRKIELDYEHKRSQLSQYFDAVKNAQHVEVESIPLPDLP 145          
BLAST of Ww domain binding protein 11 vs. Ensembl Mouse
Match: Wbp11 (WW domain binding protein 11 [Source:MGI Symbol;Acc:MGI:1891823])

HSP 1 Score: 123.25 bits (308), Expect = 1.270e-28
Identity = 79/145 (54.48%), Postives = 107/145 (73.79%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP 1401
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   ++ +    D  E++P     L+++VL++KRKKL ET++R++ LY KE+ D   EL+ L  EY++KR ++  Y+D VK A+ V    IPLPD+P
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMP 145          
BLAST of Ww domain binding protein 11 vs. Ensembl Mouse
Match: Wbp11 (WW domain binding protein 11 [Source:MGI Symbol;Acc:MGI:1891823])

HSP 1 Score: 106.301 bits (264), Expect = 1.022e-25
Identity = 72/131 (54.96%), Postives = 99/131 (75.57%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLA 1359
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   ++ +    D  E++P     L+++VL++KRKKL ET++R++ LY KE+ D   EL+ L  EY++KR ++  Y+D VKL+
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKLS 131          
BLAST of Ww domain binding protein 11 vs. UniProt/SwissProt
Match: sp|Q6P0D5|WBP11_DANRE (WW domain-binding protein 11 OS=Danio rerio OX=7955 GN=wbp11 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.371e-28
Identity = 79/152 (51.97%), Postives = 110/152 (72.37%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIPSETQLIM 1422
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   ++ +    D  E++P     L+++VL++KRKKL ET++R++ LY +E+ +   EL+ L  EY+ KR ++ LY+D VK AE V  + IPLP++P     I+
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPRQIIRDMEKLDEMEFNPVQQPLLNEKVLRDKRKKLRETFERIVRLYERENPETYKELRKLELEYETKRGQLSLYFDSVKNAESVEVDSIPLPEMPHAPSSIL 152          
BLAST of Ww domain binding protein 11 vs. UniProt/SwissProt
Match: sp|Q9Y2W2|WBP11_HUMAN (WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.572e-28
Identity = 79/145 (54.48%), Postives = 107/145 (73.79%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP 1401
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   ++ +    D  E++P     L+++VL++KRKKL ET++R++ LY KE+ D   EL+ L  EY++KR ++  Y+D VK A+ V    IPLPD+P
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMP 145          
BLAST of Ww domain binding protein 11 vs. UniProt/SwissProt
Match: sp|Q923D5|WBP11_MOUSE (WW domain-binding protein 11 OS=Mus musculus OX=10090 GN=Wbp11 PE=1 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 1.006e-27
Identity = 79/145 (54.48%), Postives = 107/145 (73.79%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP 1401
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   ++ +    D  E++P     L+++VL++KRKKL ET++R++ LY KE+ D   EL+ L  EY++KR ++  Y+D VK A+ V    IPLPD+P
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMP 145          
BLAST of Ww domain binding protein 11 vs. UniProt/SwissProt
Match: sp|Q5PQQ2|WBP11_RAT (WW domain-binding protein 11 OS=Rattus norvegicus OX=10116 GN=Wbp11 PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.061e-27
Identity = 79/145 (54.48%), Postives = 107/145 (73.79%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP 1401
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   ++ +    D  E++P     L+++VL++KRKKL ET++R++ LY KE+ D   EL+ L  EY++KR ++  Y+D VK A+ V    IPLPD+P
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMP 145          
BLAST of Ww domain binding protein 11 vs. TrEMBL
Match: A0A183KUV1 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS18843 PE=4 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 3.557e-50
Identity = 108/154 (70.13%), Postives = 133/154 (86.36%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP-SETQLIMS 1425
            MGRRS NTTKSGKFMNPTD+ARKEAR++ELKKNKKQRMAVR AVLKSKD   LLEE T+YD+QEYDP   + LS+RV+QEKR+KLLET+DR++MLYRKED++ A  LQA R +YD++R+EM+LYY+QVKLAE+V A++IPLP +P S+  LI S
Sbjct:    1 MGRRSVNTTKSGKFMNPTDQARKEARKRELKKNKKQRMAVRHAVLKSKDPLQLLEETTLYDKQEYDPSVQAQLSERVIQEKRRKLLETFDRLVMLYRKEDAEYANRLQAARQDYDKRRHEMMLYYEQVKLAERVKASEIPLPKLPQSQMGLITS 154          
BLAST of Ww domain binding protein 11 vs. TrEMBL
Match: A0A3P7LWA6 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS12961 PE=4 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 5.450e-50
Identity = 102/145 (70.34%), Postives = 132/145 (91.03%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP 1401
            MGRRS NTTKSGK+MNPTD+ARKEAR+KELKKNKKQRMAVRQAVLK+KDA  LLEEA++YD+QEYDP   ++L++RVLQEKRK++L+T+DR+++LYRK+D + A  LQA R EYD++R+EM+L+Y+QVKLAE+V A++IPLPD+P
Sbjct:    1 MGRRSVNTTKSGKYMNPTDQARKEARKKELKKNKKQRMAVRQAVLKAKDATQLLEEASMYDKQEYDPNVQASLNERVLQEKRKRVLDTFDRLVVLYRKDDPEYAARLQAARTEYDKRRHEMMLFYEQVKLAERVKASEIPLPDLP 145          
BLAST of Ww domain binding protein 11 vs. TrEMBL
Match: A0A183S6A2 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 2.252e-49
Identity = 104/154 (67.53%), Postives = 133/154 (86.36%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP-SETQLIMS 1425
            MGRRS NTTKSGKFMNPTD+ARKEAR++ELKKNKKQRMAVR AVL++KD   LLEE T+YD+QEYDP   + LS+RV+QEKR+KLLET+DR+++LYRKE+++ A  LQA R +YD++R+EM+LYY+QVKLAE+V A++IPLP +P S+  LI S
Sbjct:    1 MGRRSVNTTKSGKFMNPTDQARKEARKRELKKNKKQRMAVRYAVLRAKDPLQLLEETTLYDKQEYDPSVQAQLSERVIQEKRRKLLETFDRLVILYRKENAEYANRLQAARQDYDKRRHEMMLYYEQVKLAERVKASEIPLPKLPQSQMGLITS 154          
BLAST of Ww domain binding protein 11 vs. TrEMBL
Match: A0A430QD53 (WW domain-binding protein 11 OS=Schistosoma bovis OX=6184 GN=DC041_0007494 PE=4 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.771e-49
Identity = 108/154 (70.13%), Postives = 133/154 (86.36%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP-SETQLIMS 1425
            MGRRS NTTKSGKFMNPTD+ARKEAR++ELKKNKKQRMAVR AVLKSKD   LLEE T+YD+QEYDP   + LS+RV+QEKR+KLLET+DR++MLYRKED++ A  LQA R +YD++R+EM+LYY+QVKLAE+V A++IPLP +P S+  LI S
Sbjct:    1 MGRRSVNTTKSGKFMNPTDQARKEARKRELKKNKKQRMAVRHAVLKSKDPLQLLEETTLYDKQEYDPSVQAQLSERVIQEKRRKLLETFDRLVMLYRKEDAEYANRLQAARQDYDKRRHEMMLYYEQVKLAERVKASEIPLPKLPQSQMGLITS 154          

HSP 2 Score: 69.707 bits (169), Expect = 9.284e-9
Identity = 36/75 (48.00%), Postives = 48/75 (64.00%), Query Frame = 1
Query: 2056 TTIEAKPQLKNLIGDSTKLVPTQLRIKKATKPNKLSAVSGFKNELVNDRSR---EHITSKDDAYDQFMKEMEGLL 2271
            TTIEAKPQLKNLIGD+T+ VPT L++++  +      V+           R      TSKDDAY++FM+EMEGL+
Sbjct:  312 TTIEAKPQLKNLIGDATRFVPTALKVRRIVRDTNGRLVTTGGGTAAYGTGRINSGSATSKDDAYEEFMREMEGLI 386          
BLAST of Ww domain binding protein 11 vs. TrEMBL
Match: C1LFR3 (WW domain-binding protein OS=Schistosoma japonicum OX=6182 GN=WBP-11 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 5.618e-49
Identity = 107/154 (69.48%), Postives = 134/154 (87.01%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP-SETQLIMS 1425
            MGRRS NTTKSGKFMNPTD+ARKEAR++ELKKNKKQRMAVR AVLKSKD   LLEE T+YD+QEYDP   + LS+RV+QEKR+KLLET+DR+++LYRKED++ A+ LQA R +YD++R+EM+LYY+QVKLAE+V A++IPLP +P S+  LI S
Sbjct:    1 MGRRSVNTTKSGKFMNPTDQARKEARKRELKKNKKQRMAVRHAVLKSKDPLQLLEETTLYDKQEYDPSVQAQLSERVIQEKRRKLLETFDRLVVLYRKEDAEYASRLQAARQDYDKRRHEMMLYYEQVKLAERVKASEIPLPKLPQSQIGLITS 154          

HSP 2 Score: 68.9366 bits (167), Expect = 1.912e-8
Identity = 41/91 (45.05%), Postives = 54/91 (59.34%), Query Frame = 1
Query: 2056 TTIEAKPQLKNLIGDSTKLVPTQLRIKK---------ATKPNKLSAV-SGFKNELVNDR---------SREHITSKDDAYDQFMKEMEGLL 2271
            TTIEAKPQLKNLIGD+T+ VPT L++++          T     SA  +G  +  V DR         +    TSKDDAY++FM+EMEGL+
Sbjct:  334 TTIEAKPQLKNLIGDATRFVPTALKVRRTVRDTSGRLVTTGGGASAYGTGKHSNAVYDRVAKSASTGINSGSTTSKDDAYEEFMREMEGLI 424          
BLAST of Ww domain binding protein 11 vs. Ensembl Cavefish
Match: wbp11 (WW domain binding protein 11 [Source:NCBI gene;Acc:402950])

HSP 1 Score: 127.487 bits (319), Expect = 7.329e-30
Identity = 79/145 (54.48%), Postives = 108/145 (74.48%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP 1401
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   ++ +    D  E++P     L+D+VL++KRKKL ET++R++ LY +E+ D   EL+ L  +Y+ KR ++ LY+D VK AE V  + IPLP++P
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPRQIIRDMEKLDEMEFNPVQQPLLNDKVLRDKRKKLRETFERIVRLYERENPDTYKELRKLELDYETKRGQLSLYFDSVKNAESVEVDSIPLPEMP 145          
BLAST of Ww domain binding protein 11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007358.1 (pep scaffold:Pmarinus_7.0:GL476419:187538:197955:-1 gene:ENSPMAG00000006626.1 transcript:ENSPMAT00000007358.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 1.788e-26
Identity = 76/145 (52.41%), Postives = 106/145 (73.10%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP 1401
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   +L +    D  E+    +  L+++VL++KRKKL ET DR++ LY K++ ++  +L++   EY++KR +M  YY+ VK A+ V    IPLP++P
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRTAVLKMKDPKQILRDMEKLDELEFSAIQTPILNEKVLRDKRKKLQETLDRILHLYEKDNPEQYKDLRSAEIEYNQKRLQMCNYYEAVKNAQHVEIESIPLPEMP 145          

HSP 2 Score: 51.9878 bits (123), Expect = 4.805e-7
Identity = 31/79 (39.24%), Postives = 40/79 (50.63%), Query Frame = 1
Query: 2056 TTIEAKPQLKNLIGDSTKLVPTQLRIKKATKPNKLS-------AVSGFKNELVNDRSREHITSKDDAYDQFMKEMEGLL 2271
             TI AKPQ+ N   D T+ +PT LR+K+  K            A    +   V   S   + +KDD Y+ FMKEMEGLL
Sbjct:  556 ATISAKPQITNPKADVTRFMPTSLRVKREAKGRGAQRRADEDIAQRPLQKSSVASVSTATMATKDDMYESFMKEMEGLL 634          
BLAST of Ww domain binding protein 11 vs. Ensembl Medaka
Match: wbp11 (WW domain binding protein 11 [Source:NCBI gene;Acc:101175484])

HSP 1 Score: 125.176 bits (313), Expect = 2.717e-29
Identity = 79/145 (54.48%), Postives = 108/145 (74.48%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIP 1401
            MGRRST++TKSGKFMNPTD+ARKEAR++ELKKNKKQRM VR AVLK KD   ++ +    D  E++P     L+++VL++KRKKL ET++R+I LY +E+ +   EL+ L  +Y+ KR ++ LY+D VK AE V  + IPLPD+P
Sbjct:    1 MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPRQIIRDMEKLDEMEFNPVQQPLLNEKVLRDKRKKLRETFERIIHLYERENPETYKELRKLELDYETKRGQLALYFDSVKNAESVEVDSIPLPDMP 145          
BLAST of Ww domain binding protein 11 vs. Planmine SMEST
Match: SMESG000036897.1 (SMESG000036897.1)

HSP 1 Score: 586.26 bits (1510), Expect = 0.000e+0
Identity = 430/435 (98.85%), Postives = 432/435 (99.31%), Query Frame = 1
Query:  967 MGRRSTNTTKSGKFMNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIPSETQLIMSSYXXXXXXXXXXXXXXHPXXXXXXXXXXXTVPTKSILKKXXXXXXXXXXXXXXALHRKPCAPPPGTPXXXXXXXXXXXXXXXPQADGIDKKKIRFVDDDQYDPSTDVEKNTRLTVKKAVALMECNHQLPQMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHPAPTSITMPPQIFSQSMKMPRHITAAVXXXXXXXXXXXXXXXXMGTTTIEAKPQLKNLIGDSTKLVPTQLRIKKATKPNKLSAVSGFKNELVNDRSREHITSKDDAYDQFMKEMEGLL 2271
            MGRRSTNTTKSGKFMNPTDRARKEARRKELKKNKKQRMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIPSETQLIMSSYPGNIPLPPGLNIPPHPAVMAAAALASATVPTKSILKKQPDQQIPGPPPGLPALHRKPCAPPPGTPDELSEAESEEDESSAPQADG+DKKKIRFVDDDQYDPSTDVEKNTRLTVKKAVAL+E NHQLPQMHIMPPPGFIPPNRIPVPTGIPPPIPVIGAPGFHPAPTSITMPPQIFSQSMKMPR ITAAVNQSNAKKSSESNKKPSMGTTTIEAKPQLKNLIGDSTKLVPTQLRIKKATKPNKL AVSGFKNELVNDRSREHITSKDDAYDQFMKEMEGLL
Sbjct:    1 MGRRSTNTTKSGKFMNPTDRARKEARRKELKKNKKQRMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIPSETQLIMSSYPGNIPLPPGLNIPPHPAVMAAAALASATVPTKSILKKQPDQQIPGPPPGLPALHRKPCAPPPGTPDELSEAESEEDESSAPQADGMDKKKIRFVDDDQYDPSTDVEKNTRLTVKKAVALIESNHQLPQMHIMPPPGFIPPNRIPVPTGIPPPIPVIGAPGFHPAPTSITMPPQIFSQSMKMPRPITAAVNQSNAKKSSESNKKPSMGTTTIEAKPQLKNLIGDSTKLVPTQLRIKKATKPNKLPAVSGFKNELVNDRSREHITSKDDAYDQFMKEMEGLL 435          
BLAST of Ww domain binding protein 11 vs. Planmine SMEST
Match: SMESG000036897.1 (SMESG000036897.1)

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 416/421 (98.81%), Postives = 418/421 (99.29%), Query Frame = 1
Query: 1009 MNPTDXXXXXXXXXXXXXXXXXXMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIPSETQLIMSSYXXXXXXXXXXXXXXHPXXXXXXXXXXXTVPTKSILKKXXXXXXXXXXXXXXALHRKPCAPPPGTPXXXXXXXXXXXXXXXPQADGIDKKKIRFVDDDQYDPSTDVEKNTRLTVKKAVALMECNHQLPQMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHPAPTSITMPPQIFSQSMKMPRHITAAVXXXXXXXXXXXXXXXXMGTTTIEAKPQLKNLIGDSTKLVPTQLRIKKATKPNKLSAVSGFKNELVNDRSREHITSKDDAYDQFMKEMEGLL 2271
            MNPTDRARKEARRKELKKNKKQRMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIPSETQLIMSSYPGNIPLPPGLNIPPHPAVMAAAALASATVPTKSILKKQPDQQIPGPPPGLPALHRKPCAPPPGTPDELSEAESEEDESSAPQADG+DKKKIRFVDDDQYDPSTDVEKNTRLTVKKAVAL+E NHQLPQMHIMPPPGFIPPNRIPVPTGIPPPIPVIGAPGFHPAPTSITMPPQIFSQSMKMPR ITAAVNQSNAKKSSESNKKPSMGTTTIEAKPQLKNLIGDSTKLVPTQLRIKKATKPNKL AVSGFKNELVNDRSREHITSKDDAYDQFMKEMEGLL
Sbjct:    1 MNPTDRARKEARRKELKKNKKQRMAVRQAVLKSKDAAMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKEDSDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIPSETQLIMSSYPGNIPLPPGLNIPPHPAVMAAAALASATVPTKSILKKQPDQQIPGPPPGLPALHRKPCAPPPGTPDELSEAESEEDESSAPQADGMDKKKIRFVDDDQYDPSTDVEKNTRLTVKKAVALIESNHQLPQMHIMPPPGFIPPNRIPVPTGIPPPIPVIGAPGFHPAPTSITMPPQIFSQSMKMPRPITAAVNQSNAKKSSESNKKPSMGTTTIEAKPQLKNLIGDSTKLVPTQLRIKKATKPNKLPAVSGFKNELVNDRSREHITSKDDAYDQFMKEMEGLL 421          
BLAST of Ww domain binding protein 11 vs. Planmine SMEST
Match: SMESG000003625.1 (SMESG000003625.1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.350e-16
Identity = 59/178 (33.15%), Postives = 77/178 (43.26%), Query Frame = -1
Query:  415 NDFSEAVGHRCIVAFNDIPILDN-CPINHFNDLSKMSQYFRIRCHICGRYFTKRGFRRHYNNHLNN-----------------------------------------XXXXXXXXXXXXXXPANGD-VQPPVWVQQMLANINARFTAMDGRFTNIDDRLNPINVQLAAHNVDIAALKD 819
            ++F  A  H CIV  + IP+ +N C +NH+  +  M    RIRC+IC RYF KRGFR HYN+H NN                                            +         HPANG+   PP W  QM+ANI A           I+++L  IN QLAAHN  I  L++
Sbjct:    5 DEFLNACNHHCIVEEDQIPVENNNCQVNHYEVIMNMGNNLRIRCNICCRYFKKRGFRSHYNHHFNNPPIEVPSIIPGDENEPPHGQPPGGNEDAPLPAADGQNPANGEDENEHQPAADGQHPANGENAPPPAWAHQMIANIAA-----------INEQLAAINEQLAAHNEAILDLQN 171          
BLAST of Ww domain binding protein 11 vs. Planmine SMEST
Match: SMESG000032557.1 (SMESG000032557.1)

HSP 1 Score: 56.6102 bits (135), Expect = 9.067e-9
Identity = 33/66 (50.00%), Postives = 40/66 (60.61%), Query Frame = -1
Query:  388 QMLANINARFTAMDGRFTNIDDRLNPINVQLAAHN------------VD--IAALKDAVHGILHPN 543
            QM+A  N RFTA+DGRFT ID R + I+ +  A +            VD  I AL+DAVHGILHPN
Sbjct:    2 QMIAQFNDRFTAIDGRFTAIDARFDAIDARFTAIDGRSTAIDGRFTAVDEAITALQDAVHGILHPN 67          
BLAST of Ww domain binding protein 11 vs. Planmine SMEST
Match: SMESG000032557.1 (SMESG000032557.1)

HSP 1 Score: 54.6842 bits (130), Expect = 4.354e-8
Identity = 27/47 (57.45%), Postives = 33/47 (70.21%), Query Frame = -1
Query:  388 INARFTAMDGRFTNIDDRLNPINVQLAAHNVDIAALKDAVHGILHPN 528
            I+ARF A+D RFT ID R   I+ +  A +  I AL+DAVHGILHPN
Sbjct:   19 IDARFDAIDARFTAIDGRSTAIDGRFTAVDEAITALQDAVHGILHPN 65          
The following BLAST results are available for this feature:
BLAST of Ww domain binding protein 11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
WBP111.548e-2854.48WW domain binding protein 11 [Source:HGNC Symbol;A... [more]
WBP115.306e-2554.55WW domain binding protein 11 [Source:HGNC Symbol;A... [more]
WBP117.811e-883.67WW domain binding protein 11 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Ww domain binding protein 11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ww domain binding protein 11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG26851.915e-2554.23gene:FBgn0024998 transcript:FBtr0070499[more]
back to top
BLAST of Ww domain binding protein 11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wbp112.595e-1542.35WW domain binding protein 11 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Ww domain binding protein 11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wbp116.589e-2852.41WW domain binding protein 11 [Source:NCBI gene;Acc... [more]
wbp111.291e-2752.41WW domain binding protein 11 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Ww domain binding protein 11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Wbp111.270e-2854.48WW domain binding protein 11 [Source:MGI Symbol;Ac... [more]
Wbp111.022e-2554.96WW domain binding protein 11 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Ww domain binding protein 11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q6P0D5|WBP11_DANRE2.371e-2851.97WW domain-binding protein 11 OS=Danio rerio OX=795... [more]
sp|Q9Y2W2|WBP11_HUMAN8.572e-2854.48WW domain-binding protein 11 OS=Homo sapiens OX=96... [more]
sp|Q923D5|WBP11_MOUSE1.006e-2754.48WW domain-binding protein 11 OS=Mus musculus OX=10... [more]
sp|Q5PQQ2|WBP11_RAT1.061e-2754.48WW domain-binding protein 11 OS=Rattus norvegicus ... [more]
back to top
BLAST of Ww domain binding protein 11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183KUV13.557e-5070.13Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A3P7LWA65.450e-5070.34Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A183S6A22.252e-4967.53Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A430QD532.771e-4970.13WW domain-binding protein 11 OS=Schistosoma bovis ... [more]
C1LFR35.618e-4969.48WW domain-binding protein OS=Schistosoma japonicum... [more]
back to top
BLAST of Ww domain binding protein 11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wbp117.329e-3054.48WW domain binding protein 11 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Ww domain binding protein 11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007358.11.788e-2652.41pep scaffold:Pmarinus_7.0:GL476419:187538:197955:-... [more]
back to top
BLAST of Ww domain binding protein 11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ww domain binding protein 11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ww domain binding protein 11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wbp112.717e-2954.48WW domain binding protein 11 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Ww domain binding protein 11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036897.10.000e+098.85SMESG000036897.1[more]
SMESG000036897.10.000e+098.81SMESG000036897.1[more]
SMESG000003625.11.350e-1633.15SMESG000003625.1[more]
SMESG000032557.19.067e-950.00SMESG000032557.1[more]
SMESG000032557.14.354e-857.45SMESG000032557.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028613 ID=SMED30028613|Name=Ww domain binding protein 11|organism=Schmidtea mediterranea sexual|type=transcript|length=2379bp
TAATAATAATAATAATAATAATGAGTATTAGTAGTAGTCCCAGAATTTCG
GCAATGCAAAAAAATATTCTCTCACAAGGCTTTTATAATGATAATAAAAT
ACATCAACCCAACTATTAATACAATTGATTTCTCTGAAAAAATTCACCAA
AACCAATAATAAACTGAATAGTAAGAATTAAAAAGTAGAACAACTTAAAT
TTTCAACGAATCCACTACTAGAGATTCATTTCAATTTTACAGTTATTTTC
CAAAAATATTTCATTAAACAAAATATATTCTCTCGGAGAAGTGTTAACGA
ATAAAATCTGCCTCTTCTAAAGTGAATTGAAAGGTTCTGAAATTTCTGCA
AAAAGATAATCTATTTCGGATTGGAATACAATTTTCAATTGGGATGTAAA
ATCCCGTGAACAGCATCTTTCAATGCTGCAATATCTACGTTATGAGCAGC
AAGCTGCACATTAATAGGATTTAATCTGTCGTCGATATTAGTAAATCTGC
CGTCCATAGCCGTAAATCTGGCGTTAATATTCGCCAACATTTGTTGCACC
CAAACTGGTGGTTGCACATCGCCATTTGCTGGATGTGGGGGCCCAGGGAT
AATCACAGGCCCATCAACCGGTGGGTTATTGAGATGATTATTGTAGTGGC
GCCTAAAGCCACGTTTTGTAAAATACCTGCCACAAATGTGGCAGCGTATT
CTAAAATATTGAGACATCTTGCTCAAATCATTAAAATGATTTATGGGACA
ATTGTCCAAAATCGGTATATCATTAAACGCCACAATACACCTGTGGCCAA
CAGCTTCTGAAAAATCATTTATATTCATTTTATATTTAAAATTAAATATT
TTAATATTTTAATCCAAGATATTAATAATTATTTGTTACTGGCTTATTTG
ATATTTAATTATTTGATATAGATTATAAATATATATTTTCTAAGTAAAAT
TATTAAAAATTAAATAATGGGTCGGCGTTCAACTAACACCACTAAAAGTG
GTAAGTTCATGAATCCTACCGACAGAGCTCGCAAAGAAGCTCGAAGAAAA
GAATTAAAGAAAAATAAAAAGCAAAGAATGGCAGTTCGTCAAGCTGTCCT
AAAATCCAAAGACGCTGCAATGCTATTAGAAGAAGCTACAATTTATGATA
GACAAGAATATGACCCAAAATCTAGTTCGACATTAAGTGATCGTGTTTTG
CAAGAAAAACGCAAAAAGTTGTTAGAAACTTATGATAGAATGATCATGTT
ATATCGTAAAGAAGATTCTGATAAAGCAACGGAGTTACAAGCACTTCGAA
ATGAATATGATAGGAAAAGAAACGAAATGATTTTGTATTATGACCAGGTG
AAATTAGCAGAAAAGGTCAATGCTAATGACATTCCGTTACCAGATATCCC
ATCTGAAACTCAATTAATTATGTCCTCTTATCCCGGTAACATTCCGTTAC
CGCCGGGACTTAATATCCCTCCCCACCCAGCAGTGATGGCGGCTGCCGCA
TTGGCATCAGCGACAGTGCCAACAAAGAGTATATTAAAGAAGCAACCTGA
CCAACAGATTCCTGGACCGCCGCCCGGTTTGCCTGCATTGCATAGGAAAC
CCTGTGCTCCTCCGCCCGGTACACCAGACGAATTGAGTGAAGCTGAGTCA
GAAGAAGACGAATCTAGTGCACCACAAGCTGATGGAATAGACAAAAAGAA
AATCAGATTTGTTGACGATGACCAATATGATCCCAGCACTGATGTGGAGA
AGAATACTCGCCTCACTGTGAAAAAGGCTGTCGCTCTCATGGAGTGTAAT
CATCAGTTGCCCCAGATGCACATAATGCCCCCGCCCGGATTCATCCCACC
CAATAGGATTCCCGTGCCAACCGGAATCCCACCACCAATACCAGTCATCG
GAGCTCCCGGATTCCATCCAGCTCCAACCTCAATCACCATGCCGCCGCAG
ATATTCTCTCAGTCTATGAAAATGCCGAGGCATATAACCGCTGCAGTCAA
CCAATCGAACGCAAAAAAATCCTCAGAATCCAATAAAAAACCGTCCATGG
GAACGACAACAATTGAAGCGAAACCGCAATTGAAAAATTTGATAGGAGAT
TCAACAAAATTGGTACCGACTCAGTTACGAATCAAGAAAGCTACGAAACC
GAATAAATTGTCCGCCGTTTCGGGATTCAAGAATGAGCTGGTTAATGACA
GGTCAAGGGAACACATAACCAGCAAGGACGACGCTTACGATCAATTCATG
AAGGAGATGGAAGGACTTTTGTAGATATTGTCTTTTCAATACAATTCTGT
TGCCTCGCCTTAGTTTTAGTTGTTGTTTATTATTGCATTTTGTCGGTAAG
CACAAGTAAAAATAAAAGAAATTGAAGTA
back to top

protein sequence of SMED30028613-orf-1

>SMED30028613-orf-1 ID=SMED30028613-orf-1|Name=SMED30028613-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=148bp
MNINDFSEAVGHRCIVAFNDIPILDNCPINHFNDLSKMSQYFRIRCHICG
RYFTKRGFRRHYNNHLNNPPVDGPVIIPGPPHPANGDVQPPVWVQQMLAN
INARFTAMDGRFTNIDDRLNPINVQLAAHNVDIAALKDAVHGILHPN*
back to top

protein sequence of SMED30028613-orf-2

>SMED30028613-orf-2 ID=SMED30028613-orf-2|Name=SMED30028613-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=436bp
MGRRSTNTTKSGKFMNPTDRARKEARRKELKKNKKQRMAVRQAVLKSKDA
AMLLEEATIYDRQEYDPKSSSTLSDRVLQEKRKKLLETYDRMIMLYRKED
SDKATELQALRNEYDRKRNEMILYYDQVKLAEKVNANDIPLPDIPSETQL
IMSSYPGNIPLPPGLNIPPHPAVMAAAALASATVPTKSILKKQPDQQIPG
PPPGLPALHRKPCAPPPGTPDELSEAESEEDESSAPQADGIDKKKIRFVD
DDQYDPSTDVEKNTRLTVKKAVALMECNHQLPQMHIMPPPGFIPPNRIPV
PTGIPPPIPVIGAPGFHPAPTSITMPPQIFSQSMKMPRHITAAVNQSNAK
KSSESNKKPSMGTTTIEAKPQLKNLIGDSTKLVPTQLRIKKATKPNKLSA
VSGFKNELVNDRSREHITSKDDAYDQFMKEMEGLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR019007WW_dom-bd_prot_11
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 107..127
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 215..260
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..41
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 343..369
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 236..260
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..15
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 27..41
IPR019007WW domain binding protein 11PFAMPF09429Wbp11coord: 12..92
e-value: 5.7E-17
score: 61.9
IPR019007WW domain binding protein 11PANTHERPTHR13361FAMILY NOT NAMEDcoord: 3..435