rho GTPase-activating protein 39

Overview
Namerho GTPase-activating protein 39
Smed IDSMED30028609
Length (bp)2446
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of rho GTPase-activating protein 39 (SMED30028609) t-SNE clustered cells

Violin plots show distribution of expression levels for rho GTPase-activating protein 39 (SMED30028609) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of rho GTPase-activating protein 39 (SMED30028609) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for rho GTPase-activating protein 39 (SMED30028609) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028609

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028609SMESG000029199.1 Contig5367GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30028609SMESG000029199.1 dd_Smed_v4_5836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028609SMESG000029199.1 dd_Smed_v4_5836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028609SMESG000029199.1 dd_Smed_v4_5836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028609SMESG000029199.1 dd_Smed_v4_5836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028609SMESG000029199.1 dd_Smed_v4_5836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028609SMESG000029199.1 dd_Smed_v4_5836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028609SMESG000029199.1 dd_Smed_v4_5836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028609SMESG000029199.1 dd_Smed_v4_5836_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of rho GTPase-activating protein 39 vs. Ensembl Human
Match: ARHGAP39 (Rho GTPase activating protein 39 [Source:HGNC Symbol;Acc:HGNC:29351])

HSP 1 Score: 204.142 bits (518), Expect = 6.804e-54
Identity = 146/497 (29.38%), Postives = 248/497 (49.90%), Query Frame = 2
Query:  794 RLSQPVIGLYSDSDIELVLPEQKTYI-SSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK---IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            +L  P I L     ++  L   + Y+  S+S D     +F +S Q S + +   S  FP  +L     +   T++E W+   FNK    L       A +++W+S+SI   ++  + +  +K+ CE FK IQMYMGDR  K     + L +  +G S     +E+++QLC+Q T N   E    GWEL+ ICL FF P        F S+L  Y  +     + + +     + + +C    L+   ++     LK   ++++R AK      +MF S+L+EVM +Q++ +P R+LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        K+ + L+   DP + +S+LK W+R L  PLI  +  ++ +       + + + + +LP +N MVL +LI FLQ+  +  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI + DTS +E V
Sbjct:  624 KLGFPQILLEKSVSVQTNLASPEPYLHPSQSEDLAACAQFESSRQ-SRSGVPSSSCVFPTFTLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACELFKLIQMYMGDRRAKADPLHVALEVATKGWSVQGLRDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPK-----FHSYLEGY-IYRHMDPVNDTKGVAISTYAKYCYH-KLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMGMQRERYPERQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KVPTGLE---DPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYDSPEAAVAV-VHALPRINRMVLCYLIRFLQVFVQPANVAVTKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFMEGV 1082          

HSP 2 Score: 89.7373 bits (221), Expect = 1.123e-17
Identity = 35/92 (38.04%), Postives = 58/92 (63.04%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFADKE 526
            W EIIEP+T+++++ N ++G+C W+PP   + ++  ENQWWEL+D  +   YYYN  T++T W +P   +++ L +LQ +K       A  E
Sbjct:   30 WVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTSENQWWELFDPNTSRFYYYNASTQRTVWHRPQGCDIIPLAKLQTLKQNTESPRASAE 121          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Human
Match: ARHGAP39 (Rho GTPase activating protein 39 [Source:HGNC Symbol;Acc:HGNC:29351])

HSP 1 Score: 195.667 bits (496), Expect = 4.306e-51
Identity = 149/527 (28.27%), Postives = 250/527 (47.44%), Query Frame = 2
Query:  794 RLSQPVIGLYSDSDIELVLPEQKTYI-SSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY------SCFDQKLN------------------------LENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK---IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            +L  P I L     ++  L   + Y+  S+S D     +F +S Q S + +   S  FP  +L     +   T++E W+   FNK    L       A +++W+S+SI   ++  + +  +K+ CE FK IQMYMGDR  K     + L +  +G S     +E+++QLC+Q T N   E    GWEL+ ICL FF P        F S+L  Y         D K+                         +E  +     + + +C    L+   ++     LK   ++++R AK      +MF S+L+EVM +Q++ +P R+LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        K+ + L+   DP + +S+LK W+R L  PLI  +  ++ +       + + + + +LP +N MVL +LI FLQ+  +  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI + DTS +E V
Sbjct:  624 KLGFPQILLEKSVSVQTNLASPEPYLHPSQSEDLAACAQFESSRQ-SRSGVPSSSCVFPTFTLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACELFKLIQMYMGDRRAKADPLHVALEVATKGWSVQGLRDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPK-----FHSYLEGYIYRHMDPVNDTKVTQHIKELLERNTKKKSKLRKKPKPYVEEPDGVAISTYAKYCYH-KLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMGMQRERYPERQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KVPTGLE---DPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYDSPEAAVAV-VHALPRINRMVLCYLIRFLQVFVQPANVAVTKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFMEGV 1113          

HSP 2 Score: 89.7373 bits (221), Expect = 1.139e-17
Identity = 35/92 (38.04%), Postives = 58/92 (63.04%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFADKE 526
            W EIIEP+T+++++ N ++G+C W+PP   + ++  ENQWWEL+D  +   YYYN  T++T W +P   +++ L +LQ +K       A  E
Sbjct:   30 WVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTSENQWWELFDPNTSRFYYYNASTQRTVWHRPQGCDIIPLAKLQTLKQNTESPRASAE 121          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Human
Match: ARHGAP40 (Rho GTPase activating protein 40 [Source:HGNC Symbol;Acc:HGNC:16226])

HSP 1 Score: 55.4546 bits (132), Expect = 3.620e-7
Identity = 61/228 (26.75%), Postives = 102/228 (44.74%), Query Frame = 2
Query: 1493 SLKLLDMSNKVNSLKIDDVRD-AKKTYSCLTMFFS-SLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIA--------KDYSKIL-LKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLF 2143
            SL L++++   + L +D  R  A K  +  T  F   L+ ++E   K+ PS ++P +  AL        G   +GI R+P    ++  L Q +E+ F +  +   + +H ++  D                     +LK + R L TPL+    + E L + A        K   ++L L I  LPE N   LK L+ FL+ +  +E   +  M + N+ T+MAP LF
Sbjct:  176 SLALIELTALCDILGLDLKRSKAGKWKAAETRLFGVPLDSLLEADHKVLPSTQVPLVLQALLS-CLEKRGLDMEGILRVPGSQARVKGLEQKLERDFYAG-LFSWDEVHHNDASD---------------------LLKRFIRKLPTPLL----TAEYLPAFAVVPNIPNLKQRLQVLHLLILILPEPNRNALKALLEFLRKVVAREQ--HNKMTLRNVSTVMAPNLF 374          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Human
Match: ARHGAP40 (Rho GTPase activating protein 40 [Source:HGNC Symbol;Acc:HGNC:16226])

HSP 1 Score: 55.4546 bits (132), Expect = 3.720e-7
Identity = 61/228 (26.75%), Postives = 102/228 (44.74%), Query Frame = 2
Query: 1493 SLKLLDMSNKVNSLKIDDVRD-AKKTYSCLTMFFS-SLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIA--------KDYSKIL-LKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLF 2143
            SL L++++   + L +D  R  A K  +  T  F   L+ ++E   K+ PS ++P +  AL        G   +GI R+P    ++  L Q +E+ F +  +   + +H ++  D                     +LK + R L TPL+    + E L + A        K   ++L L I  LPE N   LK L+ FL+ +  +E   +  M + N+ T+MAP LF
Sbjct:  235 SLALIELTALCDILGLDLKRSKAGKWKAAETRLFGVPLDSLLEADHKVLPSTQVPLVLQALLS-CLEKRGLDMEGILRVPGSQARVKGLEQKLERDFYAG-LFSWDEVHHNDASD---------------------LLKRFIRKLPTPLL----TAEYLPAFAVVPNIPNLKQRLQVLHLLILILPEPNRNALKALLEFLRKVVAREQ--HNKMTLRNVSTVMAPNLF 433          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Human
Match: ARHGAP22 (Rho GTPase activating protein 22 [Source:HGNC Symbol;Acc:HGNC:30320])

HSP 1 Score: 53.1434 bits (126), Expect = 2.135e-6
Identity = 48/199 (24.12%), Postives = 91/199 (45.73%), Query Frame = 2
Query: 1583 MFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTS---IAKDYSKILL----KITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSDIQ 2158
            +F   LEE +  ++K  P  +L  + V    +  R  G   +G+FR+P + N    L + ++ +F               G  PL        D   D   ++S+LK + R L  P++ F + ++ L+    + KD  +  L    ++++LP+ NY +L+++  FL  +    NV    M V+NL T+  P + +  ++
Sbjct:   62 IFGQRLEETVHHERKYGP--RLAPLLVEQCVDFIRERGLTEEGLFRMPGQAN----LVRDLQDSFDC-------------GEKPLF-------DSTTDVHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSNLPQANYNLLRYICKFLDEVQAYSNV--NKMSVQNLATVFGPNILRPQVE 232          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Celegans
Match: Y92H12BL.4 (pep chromosome:WBcel235:I:1376942:1385057:-1 gene:WBGene00022365.1 transcript:Y92H12BL.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y92H12BL.4)

HSP 1 Score: 93.2041 bits (230), Expect = 7.544e-20
Identity = 73/284 (25.70%), Postives = 124/284 (43.66%), Query Frame = 2
Query: 1304 NERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSI-FCSRISLKLLDMSNKVNSLKIDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSD 2152
            NE+   GWEL+ I L F  P    +      FL ++   D   +L  +    F  + I   S++  +L    + +   KI   R          +F +SLEE+M++Q + FP  KLPW+   L E +++  G RT+G+FR+  +  ++      ++                                  HD  + + +LK W R L  PLI        L + A++ ++ +  +  LPE+N +VL  +I  LQ LS++E V  T M   NL  ++AP + + +
Sbjct:  131 NEKKRRGWELLAIVLAFIFPTEA-INEKLNEFLNKH--LDPIFDLPEVSTSYFSQQCIKRLSKVIARLKPSLSTIQETKIHIFRPP--------LFSASLEELMQMQSEKFPELKLPWLLTTLIELLYQSGGRRTEGLFRVAGDPEQLATARGQLDGWLAPKM---------------------------HDANVPAGLLKLWLRQLPVPLILPTLYQRALVA-AENPAEAIRLVDLLPEINRLVLVRVIALLQDLSREEVVAKTKMDTSNLAMVIAPNILRCE 375          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Celegans
Match: Y92H12BM.1 (pep chromosome:WBcel235:I:1385937:1392759:-1 gene:WBGene00022367.1 transcript:Y92H12BM.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y92H12BM.1)

HSP 1 Score: 79.337 bits (194), Expect = 2.516e-16
Identity = 43/142 (30.28%), Postives = 73/142 (51.41%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPST--TNLVSLVQLQVIKNQKNKAFADKEIQTSLENFEERDQLIINDLSTHS---VENIDT-SGYSTYKSNSINHTN 658
            W EI+EP++++ ++ N ++G+C W PP     +   +NQWWEL+D K+   YYYN  +  T W KP+    +++ L +LQ +K         K  +T         + ++N +        +NI   +G  T++SNS N  N
Sbjct:   29 WVEIVEPQSRQTMYANLVTGQCAWEPPHGASVKTTHQNQWWELFDSKTGRYYYYNASSSVTKWQKPTGIDIDIIPLAKLQTLKENTEGGAVSKIRRTCETQTSPSVRRVMNKVMMTGPVFAQNISPETGVVTFRSNSQNSQN 170          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Celegans
Match: Y92H12BM.1 (pep chromosome:WBcel235:I:1385818:1392759:-1 gene:WBGene00022367.1 transcript:Y92H12BM.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y92H12BM.1)

HSP 1 Score: 79.337 bits (194), Expect = 2.516e-16
Identity = 43/142 (30.28%), Postives = 73/142 (51.41%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPST--TNLVSLVQLQVIKNQKNKAFADKEIQTSLENFEERDQLIINDLSTHS---VENIDT-SGYSTYKSNSINHTN 658
            W EI+EP++++ ++ N ++G+C W PP     +   +NQWWEL+D K+   YYYN  +  T W KP+    +++ L +LQ +K         K  +T         + ++N +        +NI   +G  T++SNS N  N
Sbjct:   29 WVEIVEPQSRQTMYANLVTGQCAWEPPHGASVKTTHQNQWWELFDSKTGRYYYYNASSSVTKWQKPTGIDIDIIPLAKLQTLKENTEGGAVSKIRRTCETQTSPSVRRVMNKVMMTGPVFAQNISPETGVVTFRSNSQNSQN 170          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Fly
Match: RhoGAP93B (gene:FBgn0038853 transcript:FBtr0084036)

HSP 1 Score: 173.326 bits (438), Expect = 5.138e-44
Identity = 123/434 (28.34%), Postives = 219/434 (50.46%), Query Frame = 2
Query:  989 IDQGTVTNMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALT-PKAYRKKVCENFKQIQMYMGDREFKLSK--DALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY----------SCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLKIDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            I++    N+ + S+ +F K  S +  ++SWT+++IS  +LAL+  KA +K   E FK +Q+YM DR+ ++    +++ + I    +      +E+++QLC+Q T NP  +    GWEL+ ICL +  P        F+  L+ Y          +CF  +++   +        ++ C R+               +D+V  A++     +MF ++L EVM++QK+ FP RKLPWIQ  LSE +   +G +T+GIFR+ ++V+++  +   +++        D+          P     L D    H P   +S+LK W+R L+ PLI     ++ + +   D +K +  +  LPE+N +VL +LIHFLQ  +  E V  T M   NL  + AP   +    D +++    +  M  +++LI + DT+ + N+
Sbjct:  928 IEKFAADNLNLHSKGIFRKKAS-VRDMLSWTAEAISRPMLALSRDKADKKTAIELFKLVQIYMADRKARIGMTLNSVAIEIISASLPQQQLRDELYVQLCRQTTENPKRDSLIRGWELMAICLSYVPPSPT-----FQPTLLNYVNRHRDPSFATCF-MEVSKWPIHVQISHYATVCCRRLDRIGSSGRRMAKKPTVDEVEQARQQILRNSMFGNTLSEVMDLQKEKFPFRKLPWIQTTLSEHVLLLNGKQTEGIFRVSADVDEVGCMKNRLDR-------WDV----------PDYKNTLVDA---HTP---ASLLKLWYRELYDPLIPDAYYEDCVNTEDPDKAKEI--VNKLPEINQLVLTYLIHFLQQFAIPEVVSCTKMDSSNLAMVFAPNCLRCTSEDPKVILENARKEMSFMRTLIQHMDTTHVANL 1329          

HSP 2 Score: 85.5001 bits (210), Expect = 1.287e-16
Identity = 33/81 (40.74%), Postives = 54/81 (66.67%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPDQY--QQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK 493
            W EIIEP+TK+ ++ N  +G+C W+PP+    ++   +QWWEL+D  +   YYYN  T++T W +PS  +++ L +LQ +K
Sbjct:   10 WVEIIEPRTKEHMYANLTTGECVWDPPEDVPIKRTDSSQWWELFDTNTQRFYYYNAATQKTVWHRPSKCDIIPLAKLQTLK 90          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Zebrafish
Match: zgc:92107 (zgc:92107 [Source:ZFIN;Acc:ZDB-GENE-041114-4])

HSP 1 Score: 190.274 bits (482), Expect = 1.430e-49
Identity = 134/449 (29.84%), Postives = 213/449 (47.44%), Query Frame = 2
Query: 1010 NMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY---SCFDQKLNL------------------------ENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK--IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLT------SIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            ++ + ++ LF +  S +A ++SW   SI   +L    +  RK+ CE FK +Q YMGDR  +L +    L I  +        +E+++QL +Q T N        GWEL+ +CL FF P       C+    IQ       D+K+                          E  EA    + + +C R   K+     K    K  +++V  +++     ++F SSLEEVME Q +LFP RKLPW+QV LS+ +    G +T+GIFR+P ++++++AL   +++                        +I  +L    DP + +S++K W+R L  PLI       P+T      S   D +  +  + SLPELN +VL + IHFLQ+ ++  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI++ DTS IE V
Sbjct:  654 HLNMHTQGLFRRKVS-IANMLSWNRGSIKKPMLMTNDRTVRKEACEMFKLVQAYMGDRPSRLDRRHAALLIVTKCWGMQGLRDELYVQLVRQTTGNTSPRSLAAGWELMAVCLAFFAPSPKFC--CYLEGYIQRHIEPTNDKKITQFILDQQDSKKKNSKSRKKRKQNSDEEAEALPISTYAKYCYRKLQKVAITGGKKGLRKPSLEEVDHSRRAILTPSLFGSSLEEVMERQSELFPDRKLPWVQVQLSQYVLALGGAQTEGIFRVPGDIDEVNALKLQVDQW-----------------------RIPENLS---DPNVPASLMKLWYRELEEPLI-------PMTFYKQCVSNYDDPAAAISVVQSLPELNRLVLSYFIHFLQVFAQPSNVSVTKMDVNNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRMLIVHLDTSFIEGV 1066          

HSP 2 Score: 70.0922 bits (170), Expect = 9.979e-12
Identity = 29/81 (35.80%), Postives = 45/81 (55.56%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPDQY--QQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK 493
            W EI+EP+ ++ ++VN  +G C W PP     +    NQWWEL+D  +   YY+N     T W +P   +++ L  LQ +K
Sbjct:    8 WVEILEPRLREYMYVNLTTGICGWEPPKNVLIRPADHNQWWELFDRVTGRYYYFNSAGSITVWHRPQGADIIPLSSLQAMK 88          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Zebrafish
Match: zgc:92107 (zgc:92107 [Source:ZFIN;Acc:ZDB-GENE-041114-4])

HSP 1 Score: 189.889 bits (481), Expect = 2.099e-49
Identity = 134/449 (29.84%), Postives = 213/449 (47.44%), Query Frame = 2
Query: 1010 NMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY---SCFDQKLNL------------------------ENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK--IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLT------SIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            ++ + ++ LF +  S +A ++SW   SI   +L    +  RK+ CE FK +Q YMGDR  +L +    L I  +        +E+++QL +Q T N        GWEL+ +CL FF P       C+    IQ       D+K+                          E  EA    + + +C R   K+     K    K  +++V  +++     ++F SSLEEVME Q +LFP RKLPW+QV LS+ +    G +T+GIFR+P ++++++AL   +++                        +I  +L    DP + +S++K W+R L  PLI       P+T      S   D +  +  + SLPELN +VL + IHFLQ+ ++  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI++ DTS IE V
Sbjct:  665 HLNMHTQGLFRRKVS-IANMLSWNRGSIKKPMLMTNDRTVRKEACEMFKLVQAYMGDRPSRLDRRHAALLIVTKCWGMQGLRDELYVQLVRQTTGNTSPRSLAAGWELMAVCLAFFAPSPKFC--CYLEGYIQRHIEPTNDKKITQFILDQQDSKKKNSKSRKKRKQNSDEEAEALPISTYAKYCYRKLQKVAITGGKKGLRKPSLEEVDHSRRAILTPSLFGSSLEEVMERQSELFPDRKLPWVQVQLSQYVLALGGAQTEGIFRVPGDIDEVNALKLQVDQW-----------------------RIPENLS---DPNVPASLMKLWYRELEEPLI-------PMTFYKQCVSNYDDPAAAISVVQSLPELNRLVLSYFIHFLQVFAQPSNVSVTKMDVNNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRMLIVHLDTSFIEGV 1077          

HSP 2 Score: 70.8626 bits (172), Expect = 4.609e-12
Identity = 29/86 (33.72%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  242 VINNGWFEIIEPKTKKKVFVNTLSGKCQWNPPDQY--QQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK 493
            ++++ W EI+EP+ ++ ++VN  +G C W PP     +    NQWWEL+D  +   YY+N     T W +P   +++ L  LQ +K
Sbjct:   14 LLSDDWVEILEPRLREYMYVNLTTGICGWEPPKNVLIRPADHNQWWELFDRVTGRYYYFNSAGSITVWHRPQGADIIPLSSLQAMK 99          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Zebrafish
Match: zgc:92107 (zgc:92107 [Source:ZFIN;Acc:ZDB-GENE-041114-4])

HSP 1 Score: 189.889 bits (481), Expect = 2.099e-49
Identity = 134/449 (29.84%), Postives = 213/449 (47.44%), Query Frame = 2
Query: 1010 NMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY---SCFDQKLNL------------------------ENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK--IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLT------SIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            ++ + ++ LF +  S +A ++SW   SI   +L    +  RK+ CE FK +Q YMGDR  +L +    L I  +        +E+++QL +Q T N        GWEL+ +CL FF P       C+    IQ       D+K+                          E  EA    + + +C R   K+     K    K  +++V  +++     ++F SSLEEVME Q +LFP RKLPW+QV LS+ +    G +T+GIFR+P ++++++AL   +++                        +I  +L    DP + +S++K W+R L  PLI       P+T      S   D +  +  + SLPELN +VL + IHFLQ+ ++  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI++ DTS IE V
Sbjct:  665 HLNMHTQGLFRRKVS-IANMLSWNRGSIKKPMLMTNDRTVRKEACEMFKLVQAYMGDRPSRLDRRHAALLIVTKCWGMQGLRDELYVQLVRQTTGNTSPRSLAAGWELMAVCLAFFAPSPKFC--CYLEGYIQRHIEPTNDKKITQFILDQQDSKKKNSKSRKKRKQNSDEEAEALPISTYAKYCYRKLQKVAITGGKKGLRKPSLEEVDHSRRAILTPSLFGSSLEEVMERQSELFPDRKLPWVQVQLSQYVLALGGAQTEGIFRVPGDIDEVNALKLQVDQW-----------------------RIPENLS---DPNVPASLMKLWYRELEEPLI-------PMTFYKQCVSNYDDPAAAISVVQSLPELNRLVLSYFIHFLQVFAQPSNVSVTKMDVNNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRMLIVHLDTSFIEGV 1077          

HSP 2 Score: 70.8626 bits (172), Expect = 4.609e-12
Identity = 29/86 (33.72%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  242 VINNGWFEIIEPKTKKKVFVNTLSGKCQWNPPDQY--QQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK 493
            ++++ W EI+EP+ ++ ++VN  +G C W PP     +    NQWWEL+D  +   YY+N     T W +P   +++ L  LQ +K
Sbjct:   14 LLSDDWVEILEPRLREYMYVNLTTGICGWEPPKNVLIRPADHNQWWELFDRVTGRYYYFNSAGSITVWHRPQGADIIPLSSLQAMK 99          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Zebrafish
Match: arhgap39 (Rho GTPase activating protein 39 [Source:ZFIN;Acc:ZDB-GENE-041014-247])

HSP 1 Score: 187.578 bits (475), Expect = 8.492e-49
Identity = 138/497 (27.77%), Postives = 244/497 (49.09%), Query Frame = 2
Query:  794 RLSQPVIGLYSDSDIELVLPEQKTYI-SSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK---IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            RL+ P   L     ++  L   + Y+  S+S D     +F  S        S     FP  +L     +   T++E W+   FNK    L       A +++W+S+ I   ++  + +  +++  + FK IQ YMGDR  K    A+ L +  RG S     +E+++QLC+Q T N   +    GWEL+ ICL FF P +    N  + ++  Y   D    L + +     S + +C R  L+   +S     LK   ++++  A+      +MF SSLEEVM +QK+ +P ++LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        K+ + L+   DP + +S+LK W+R L  P+I  +  ++ + +     + + + + +LP +N +VL +LI FLQ+ ++  +V  T M V NL  +MAP   +    D +++    +  M  ++ LI + DTS ++ V
Sbjct:  479 RLAFPQTLLEKSLSVQTNLASPEPYLHPSQSEDLGACSQFEASRNARNMMPSASCGIFPEFTLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSEPIKKPMIMTSDRTVKREAVDLFKLIQTYMGDRRAKADPLAVALEVAVRGWSCQGLRDELYIQLCRQTTENFRYDSLQRGWELMAICLAFF-PPTPRFHNYLEGYI--YRHMDP---LNDTKGVAISSYAKYCYR-KLQKAALSGAKKGLKKPSVEEIAYARNAIFRPSMFGSSLEEVMAMQKERYPDQQLPWVQTRLSEEVLGLNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KVPTGLE---DPHIPASLLKLWYRELEEPVIPHEFYEQCVMNYDSPAAAVNV-VLNLPHINKLVLCYLIRFLQVFAQPASVSMTKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFIRVLIQHLDTSFMDGV 938          

HSP 2 Score: 88.5817 bits (218), Expect = 1.716e-17
Identity = 39/127 (30.71%), Postives = 73/127 (57.48%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFAD------KEIQTSLENFEERDQLIINDLSTHSVENIDT 613
            W EIIEP+T+++++ N L+G+C W+ P   + ++  ++QWWEL+D K+   YYYN  T++T W +P + +++ L +LQ +K   N   A       +   ++  + E+ D+   N+ +T   +   T
Sbjct:   14 WVEIIEPRTRERMYANLLTGECVWDAPAGVRIKRSGQDQWWELFDSKTSRFYYYNASTQRTVWHRPHSCDIIPLAKLQTLKQNTNTPLASADSSPARSAVSTTSSQEQEDKSCTNNTNTEDADRSAT 140          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Zebrafish
Match: arhgap39 (Rho GTPase activating protein 39 [Source:ZFIN;Acc:ZDB-GENE-041014-247])

HSP 1 Score: 177.563 bits (449), Expect = 1.281e-45
Identity = 138/510 (27.06%), Postives = 246/510 (48.24%), Query Frame = 2
Query:  794 RLSQPVIGLYSDSDIELVLPEQKTYI-SSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY-----SCFDQKLNLENLEAGDF------KSRSIFCSRISLK--LLDMSNKVNSLK---IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            RL+ P   L     ++  L   + Y+  S+S D     +F  S        S     FP  +L     +   T++E W+   FNK    L       A +++W+S+ I   ++  + +  +++  + FK IQ YMGDR  K    A+ L +  RG S     +E+++QLC+Q T N   +    GWEL+ ICL FF P +    N  + ++ ++           L   N   G +       ++ I  SRI+     + +   V  LK   ++++  A+      +MF SSLEEVM +QK+ +P ++LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        K+ + L+   DP + +S+LK W+R L  P+I  +  ++ + +     + + + + +LP +N +VL +LI FLQ+ ++  +V  T M V NL  +MAP   +    D +++    +  M  ++ LI + DTS ++ V
Sbjct:  441 RLAFPQTLLEKSLSVQTNLASPEPYLHPSQSEDLGACSQFEASRNARNMMPSASCGIFPEFTLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSEPIKKPMIMTSDRTVKREAVDLFKLIQTYMGDRRAKADPLAVALEVAVRGWSCQGLRDELYIQLCRQTTENFRYDSLQRGWELMAICLAFF-PPTPRFHNYLEGYIYRHMDPLNDTKGTTLFTANKHRGKYLKVYFGDAKCICKSRITHISFFICVCVCVCGLKKPSVEEIAYARNAIFRPSMFGSSLEEVMAMQKERYPDQQLPWVQTRLSEEVLGLNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KVPTGLE---DPHIPASLLKLWYRELEEPVIPHEFYEQCVMNYDSPAAAVNV-VLNLPHINKLVLCYLIRFLQVFAQPASVSMTKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFIRVLIQHLDTSFMDGV 919          

HSP 2 Score: 88.5817 bits (218), Expect = 1.783e-17
Identity = 39/127 (30.71%), Postives = 73/127 (57.48%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFAD------KEIQTSLENFEERDQLIINDLSTHSVENIDT 613
            W EIIEP+T+++++ N L+G+C W+ P   + ++  ++QWWEL+D K+   YYYN  T++T W +P + +++ L +LQ +K   N   A       +   ++  + E+ D+   N+ +T   +   T
Sbjct:   14 WVEIIEPRTRERMYANLLTGECVWDAPAGVRIKRSGQDQWWELFDSKTSRFYYYNASTQRTVWHRPHSCDIIPLAKLQTLKQNTNTPLASADSSPARSAVSTTSSQEQEDKSCTNNTNTEDADRSAT 140          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Xenopus
Match: lrmda (leucine rich melanocyte differentiation associated [Source:Xenbase;Acc:XB-GENE-954850])

HSP 1 Score: 192.2 bits (487), Expect = 4.633e-50
Identity = 129/464 (27.80%), Postives = 230/464 (49.57%), Query Frame = 2
Query:  962 FPRHSLINAIDQGTVT-----NMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENL--EAGDFKSRSI-------------------------FCSRISLKLLDMSNKVNSLK--IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            FP  +L   + Q ++      N+ + ++ +F +  S ++ ++SW   SI   +L  + +  +K+ CE FK +Q+YMGDR+ +  ++ + L +  +  S     +E++MQL +Q T N       YGWEL+ I L FF P S + Q+  + ++ ++      LN+     E  + K++ I                         +C R   K+     K    K  I+++  A+      ++F SSLEE+ME Q++++P R+LPW+Q  LS+ +    G +T+GIFR+P ++++++AL   +E+                        +I  +L+   DP + +S+LK W+R L  PLI      + +++     + + + +  LP+LN +VL +LIHFLQI S+  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI++ DTS +  V
Sbjct:  568 FPYTTLRKPLSQTSMVDWATKNLNMHTQGIFRRRIS-ISNMLSWNGGSIKKPMLITSNRVIKKEACEMFKLVQVYMGDRQARTDRNQVALVLVTKCWSMQGLRDELYMQLVRQTTNNMTYRSLAYGWELMAISLGFFSP-SPKFQSYLEGYIYKHLEEANDLNITQRIHEVQELKTKKITKSRKKRKQNGDEEEEGLPISTYAKYCYRKLQKVAITGGKKGLRKPTIEEIEQARSAILTPSLFGSSLEEIMERQREVYPDRQLPWVQTQLSQAVLALGGEQTEGIFRVPGDIDEVNALKVQVEQW-----------------------RIPDNLE---DPTVPASLLKLWYRELEEPLIPQQFYKQCISNYENPDAAVSV-VHQLPDLNRLVLGYLIHFLQIFSQPSNVGTTKMDVNNLAMVMAPNCLRCQSDDPRIIFENTRKEMSFLRMLIVHLDTSFVRGV 1002          

HSP 2 Score: 70.4774 bits (171), Expect = 9.461e-12
Identity = 30/69 (43.48%), Postives = 43/69 (62.32%), Query Frame = 2
Query:  293 VFVNTLSGKCQWNPP--DQYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK 493
            ++VN  +G+C W PP     +Q  +NQWWEL+D +S   YYYN Q  QT W +P   ++V L +LQ +K
Sbjct:    1 MYVNLATGECGWEPPLDVPIRQSDKNQWWELFDQQSGRFYYYNAQNHQTVWHRPLQCDIVPLAKLQAVK 69          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Xenopus
Match: lrmda (leucine rich melanocyte differentiation associated [Source:Xenbase;Acc:XB-GENE-954850])

HSP 1 Score: 191.815 bits (486), Expect = 5.868e-50
Identity = 129/464 (27.80%), Postives = 230/464 (49.57%), Query Frame = 2
Query:  962 FPRHSLINAIDQGTVT-----NMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENL--EAGDFKSRSI-------------------------FCSRISLKLLDMSNKVNSLK--IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            FP  +L   + Q ++      N+ + ++ +F +  S ++ ++SW   SI   +L  + +  +K+ CE FK +Q+YMGDR+ +  ++ + L +  +  S     +E++MQL +Q T N       YGWEL+ I L FF P S + Q+  + ++ ++      LN+     E  + K++ I                         +C R   K+     K    K  I+++  A+      ++F SSLEE+ME Q++++P R+LPW+Q  LS+ +    G +T+GIFR+P ++++++AL   +E+                        +I  +L+   DP + +S+LK W+R L  PLI      + +++     + + + +  LP+LN +VL +LIHFLQI S+  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI++ DTS +  V
Sbjct:  586 FPYTTLRKPLSQTSMVDWATKNLNMHTQGIFRRRIS-ISNMLSWNGGSIKKPMLITSNRVIKKEACEMFKLVQVYMGDRQARTDRNQVALVLVTKCWSMQGLRDELYMQLVRQTTNNMTYRSLAYGWELMAISLGFFSP-SPKFQSYLEGYIYKHLEEANDLNITQRIHEVQELKTKKITKSRKKRKQNGDEEEEGLPISTYAKYCYRKLQKVAITGGKKGLRKPTIEEIEQARSAILTPSLFGSSLEEIMERQREVYPDRQLPWVQTQLSQAVLALGGEQTEGIFRVPGDIDEVNALKVQVEQW-----------------------RIPDNLE---DPTVPASLLKLWYRELEEPLIPQQFYKQCISNYENPDAAVSV-VHQLPDLNRLVLGYLIHFLQIFSQPSNVGTTKMDVNNLAMVMAPNCLRCQSDDPRIIFENTRKEMSFLRMLIVHLDTSFVRGV 1020          

HSP 2 Score: 87.8113 bits (216), Expect = 4.119e-17
Identity = 36/81 (44.44%), Postives = 54/81 (66.67%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPP--DQYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK 493
            W EIIEP+++++++VN  +G+C W PP     +Q  +NQWWEL+D +S   YYYN Q  QT W +P   ++V L +LQ +K
Sbjct:    7 WVEIIEPRSQERMYVNLATGECGWEPPLDVPIRQSDKNQWWELFDQQSGRFYYYNAQNHQTVWHRPLQCDIVPLAKLQAVK 87          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Xenopus
Match: gpr180 (G protein-coupled receptor 180 [Source:Xenbase;Acc:XB-GENE-1007249])

HSP 1 Score: 97.4413 bits (241), Expect = 3.163e-20
Identity = 64/186 (34.41%), Postives = 94/186 (50.54%), Query Frame = 2
Query:  875 SKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY 1411
            S+S D     +F NS  +  N +   S  FP  +L     +   T++E W+   FNK    L       A ++SW+S+SI   ++  + +  +K+ CE FK IQMYMGDR  K  + ++ L I  +G S     +E+++QLC+Q T N   E    GWEL+ ICL FF P        F S+L  Y
Sbjct:  451 SQSEDLGACAQFENSRHM-RNMMPSSSCVFPTFTLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLSWSSESIKKPMIMTSDRNVKKEACEIFKLIQMYMGDRRAKSDQLSVALEIATKGWSMQGLRDELYIQLCRQTTENFRYESLALGWELMTICLAFFPPTPK-----FHSYLEGY 627          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Xenopus
Match: ARHGAP24 (Rho GTPase activating protein 24 [Source:NCBI gene;Acc:100488856])

HSP 1 Score: 55.4546 bits (132), Expect = 3.187e-7
Identity = 50/214 (23.36%), Postives = 95/214 (44.39%), Query Frame = 2
Query: 1583 MFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSK--------ILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSDIQLLQPAMQLLQSLII 2200
            +F   LE+ +  +K+ + +   P + V    +  R  G   +G+FR+P + N +  L  A +   K +                         D   D   ++S+LK + R L  P+I F K ++ ++S AK  SK        ++ ++ SLP +NY +LK++  FL  +     V    M V+NL T+ +P + +  +   Q  M +++  ++
Sbjct:  132 IFGQKLEDTVRYEKR-YGTHLAPML-VEQCVDFIRQQGLTEEGLFRMPGQANLVKELQDAFDCGEKPS------------------------FDSNTDIHTVASLLKLYLRELPEPVIPFSKYEDFISS-AKHLSKEEESGMAELVKQVRSLPPVNYNLLKYICRFLDEVQSHSGV--NKMSVQNLATVFSPNILRPKV---QDPMTIMEGTVV 313          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Xenopus
Match: ARHGAP40 (Rho GTPase activating protein 40 [Source:NCBI gene;Acc:100493159])

HSP 1 Score: 51.9878 bits (123), Expect = 3.588e-6
Identity = 64/213 (30.05%), Postives = 92/213 (43.19%), Query Frame = 2
Query: 1532 LKIDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRC---DGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFD-----KSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTN-MPVENLVTLMAPTLF 2143
            LK + V+  K   S L  F  +L  ++   +KL P  K+P I  A    IF C   +G   QGI RI     +I  L Q +EK F        + L S +   P            HD    S +LK + R L  PL+         + + +  + +    + L I  LPE N   LK L+ FLQ ++  E    TN M + N+ T++AP LF
Sbjct:  307 LKRNKVQKRKSAESQL--FGVALPSLLIQDQKLVPDTKVPLILQA----IFTCIEKNGMEIQGILRISGSQARIKNLQQRLEKDF-------YDGLFSWDDVHP------------HD---ASGLLKLFLRELPAPLLTTQYLPAFTAVQNIVDLKQRLQALNLLILILPEPNRSTLKALLEFLQKVAAMEK---TNLMSLWNVSTILAPNLF 488          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Mouse
Match: Arhgap39 (Rho GTPase activating protein 39 [Source:MGI Symbol;Acc:MGI:107858])

HSP 1 Score: 206.453 bits (524), Expect = 8.662e-55
Identity = 145/482 (30.08%), Postives = 244/482 (50.62%), Query Frame = 2
Query:  842 LVLPEQKTYISSKSVDEDENKEFNNSLQLSTNKISFDSNN--FPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK---IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            L  PE   +  S+S D     +F +S Q   N+ +  S++  FP  +L     +   T++E W+   FNK    L       A +++W+S+SI   ++  + +  +K+ CE FK IQMYMGDR  K     + L I  +G S+    +E+++QLC+Q T N   E    GWEL+ ICL FF P        F S+L  Y  +     + + +     + + +C    L+   ++     LK   ++++R AK      +MF S+L+EVM +QK+ +P R+LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        K+ + L+   DP + +S+LK W+R L  PLI  +  ++ +       + + + + +LP +N MVL +LI FLQ+  +  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI + DTS +E V
Sbjct:  635 LASPEPHLH-PSQSEDLGACAQFESSRQ---NRSAMPSSSCVFPTFTLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACEIFKLIQMYMGDRRAKADPLHVALEIATKGWSAQGLRDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPK-----FHSYLEGY-IYRHMDPVNDTKGVAISTYAKYCYH-KLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMSMQKERYPDRQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KVPTGLE---DPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYESPEAAVAV-VHALPRINRMVLCYLIRFLQVFVQPANVAITKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFMEGV 1075          

HSP 2 Score: 86.6557 bits (213), Expect = 6.928e-17
Identity = 39/117 (33.33%), Postives = 67/117 (57.26%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK-----------NQKNKAFADKEIQTSLE-NFEERDQ 565
            W EIIEP+T+++++ N ++G+C W+PP   + ++  E+QWWEL+D  +   YYY+  +++T W +P   +++ L +LQ +K           N   +   D    +SLE   EER Q
Sbjct:   30 WVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTSEDQWWELFDPNTSRFYYYSAASQRTVWHRPQNCDIIPLAKLQTLKQNTESPRASADNSPGRGSRDGSTGSSLEPELEERTQ 146          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Mouse
Match: Arhgap39 (Rho GTPase activating protein 39 [Source:MGI Symbol;Acc:MGI:107858])

HSP 1 Score: 206.453 bits (524), Expect = 9.376e-55
Identity = 145/482 (30.08%), Postives = 244/482 (50.62%), Query Frame = 2
Query:  842 LVLPEQKTYISSKSVDEDENKEFNNSLQLSTNKISFDSNN--FPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK---IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            L  PE   +  S+S D     +F +S Q   N+ +  S++  FP  +L     +   T++E W+   FNK    L       A +++W+S+SI   ++  + +  +K+ CE FK IQMYMGDR  K     + L I  +G S+    +E+++QLC+Q T N   E    GWEL+ ICL FF P        F S+L  Y  +     + + +     + + +C    L+   ++     LK   ++++R AK      +MF S+L+EVM +QK+ +P R+LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        K+ + L+   DP + +S+LK W+R L  PLI  +  ++ +       + + + + +LP +N MVL +LI FLQ+  +  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI + DTS +E V
Sbjct:  637 LASPEPHLH-PSQSEDLGACAQFESSRQ---NRSAMPSSSCVFPTFTLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACEIFKLIQMYMGDRRAKADPLHVALEIATKGWSAQGLRDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPK-----FHSYLEGY-IYRHMDPVNDTKGVAISTYAKYCYH-KLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMSMQKERYPDRQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KVPTGLE---DPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYESPEAAVAV-VHALPRINRMVLCYLIRFLQVFVQPANVAITKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFMEGV 1077          

HSP 2 Score: 86.6557 bits (213), Expect = 6.994e-17
Identity = 39/117 (33.33%), Postives = 67/117 (57.26%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK-----------NQKNKAFADKEIQTSLE-NFEERDQ 565
            W EIIEP+T+++++ N ++G+C W+PP   + ++  E+QWWEL+D  +   YYY+  +++T W +P   +++ L +LQ +K           N   +   D    +SLE   EER Q
Sbjct:   32 WVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTSEDQWWELFDPNTSRFYYYSAASQRTVWHRPQNCDIIPLAKLQTLKQNTESPRASADNSPGRGSRDGSTGSSLEPELEERTQ 148          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Mouse
Match: Arhgap39 (Rho GTPase activating protein 39 [Source:MGI Symbol;Acc:MGI:107858])

HSP 1 Score: 197.593 bits (501), Expect = 6.788e-52
Identity = 148/512 (28.91%), Postives = 246/512 (48.05%), Query Frame = 2
Query:  842 LVLPEQKTYISSKSVDEDENKEFNNSLQLSTNKISFDSNN--FPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY------SCFDQKLN------------------------LENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK---IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            L  PE   +  S+S D     +F +S Q   N+ +  S++  FP  +L     +   T++E W+   FNK    L       A +++W+S+SI   ++  + +  +K+ CE FK IQMYMGDR  K     + L I  +G S+    +E+++QLC+Q T N   E    GWEL+ ICL FF P        F S+L  Y         D K+                         +E  +     + + +C    L+   ++     LK   ++++R AK      +MF S+L+EVM +QK+ +P R+LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        K+ + L+   DP + +S+LK W+R L  PLI  +  ++ +       + + + + +LP +N MVL +LI FLQ+  +  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI + DTS +E V
Sbjct:  635 LASPEPHLH-PSQSEDLGACAQFESSRQ---NRSAMPSSSCVFPTFTLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACEIFKLIQMYMGDRRAKADPLHVALEIATKGWSAQGLRDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPK-----FHSYLEGYIYRHMDPVNDTKVTQHIKELLERNSKKKSKLRKKPKPYVEEPDGVAISTYAKYCYH-KLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMSMQKERYPDRQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KVPTGLE---DPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYESPEAAVAV-VHALPRINRMVLCYLIRFLQVFVQPANVAITKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFMEGV 1106          

HSP 2 Score: 86.6557 bits (213), Expect = 7.459e-17
Identity = 39/117 (33.33%), Postives = 67/117 (57.26%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK-----------NQKNKAFADKEIQTSLE-NFEERDQ 565
            W EIIEP+T+++++ N ++G+C W+PP   + ++  E+QWWEL+D  +   YYY+  +++T W +P   +++ L +LQ +K           N   +   D    +SLE   EER Q
Sbjct:   30 WVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTSEDQWWELFDPNTSRFYYYSAASQRTVWHRPQNCDIIPLAKLQTLKQNTESPRASADNSPGRGSRDGSTGSSLEPELEERTQ 146          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Mouse
Match: Arhgap39 (Rho GTPase activating protein 39 [Source:MGI Symbol;Acc:MGI:107858])

HSP 1 Score: 197.593 bits (501), Expect = 7.878e-52
Identity = 148/512 (28.91%), Postives = 246/512 (48.05%), Query Frame = 2
Query:  842 LVLPEQKTYISSKSVDEDENKEFNNSLQLSTNKISFDSNN--FPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY------SCFDQKLN------------------------LENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK---IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            L  PE   +  S+S D     +F +S Q   N+ +  S++  FP  +L     +   T++E W+   FNK    L       A +++W+S+SI   ++  + +  +K+ CE FK IQMYMGDR  K     + L I  +G S+    +E+++QLC+Q T N   E    GWEL+ ICL FF P        F S+L  Y         D K+                         +E  +     + + +C    L+   ++     LK   ++++R AK      +MF S+L+EVM +QK+ +P R+LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        K+ + L+   DP + +S+LK W+R L  PLI  +  ++ +       + + + + +LP +N MVL +LI FLQ+  +  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI + DTS +E V
Sbjct:  637 LASPEPHLH-PSQSEDLGACAQFESSRQ---NRSAMPSSSCVFPTFTLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACEIFKLIQMYMGDRRAKADPLHVALEIATKGWSAQGLRDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPK-----FHSYLEGYIYRHMDPVNDTKVTQHIKELLERNSKKKSKLRKKPKPYVEEPDGVAISTYAKYCYH-KLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMSMQKERYPDRQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KVPTGLE---DPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYESPEAAVAV-VHALPRINRMVLCYLIRFLQVFVQPANVAITKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFMEGV 1108          

HSP 2 Score: 86.6557 bits (213), Expect = 7.466e-17
Identity = 39/117 (33.33%), Postives = 67/117 (57.26%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK-----------NQKNKAFADKEIQTSLE-NFEERDQ 565
            W EIIEP+T+++++ N ++G+C W+PP   + ++  E+QWWEL+D  +   YYY+  +++T W +P   +++ L +LQ +K           N   +   D    +SLE   EER Q
Sbjct:   32 WVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTSEDQWWELFDPNTSRFYYYSAASQRTVWHRPQNCDIIPLAKLQTLKQNTESPRASADNSPGRGSRDGSTGSSLEPELEERTQ 148          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Mouse
Match: Arhgap39 (Rho GTPase activating protein 39 [Source:MGI Symbol;Acc:MGI:107858])

HSP 1 Score: 80.8777 bits (198), Expect = 1.039e-17
Identity = 30/81 (37.04%), Postives = 56/81 (69.14%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK 493
            W EIIEP+T+++++ N ++G+C W+PP   + ++  E+QWWEL+D  +   YYY+  +++T W +P   +++ L +LQ +K
Sbjct:   30 WVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTSEDQWWELFDPNTSRFYYYSAASQRTVWHRPQNCDIIPLAKLQTLK 110          
BLAST of rho GTPase-activating protein 39 vs. UniProt/SwissProt
Match: sp|Q9C0H5|RHG39_HUMAN (Rho GTPase-activating protein 39 OS=Homo sapiens OX=9606 GN=ARHGAP39 PE=1 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 3.268e-53
Identity = 146/497 (29.38%), Postives = 248/497 (49.90%), Query Frame = 2
Query:  794 RLSQPVIGLYSDSDIELVLPEQKTYI-SSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK---IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            +L  P I L     ++  L   + Y+  S+S D     +F +S Q S + +   S  FP  +L     +   T++E W+   FNK    L       A +++W+S+SI   ++  + +  +K+ CE FK IQMYMGDR  K     + L +  +G S     +E+++QLC+Q T N   E    GWEL+ ICL FF P        F S+L  Y  +     + + +     + + +C    L+   ++     LK   ++++R AK      +MF S+L+EVM +Q++ +P R+LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        K+ + L+   DP + +S+LK W+R L  PLI  +  ++ +       + + + + +LP +N MVL +LI FLQ+  +  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI + DTS +E V
Sbjct:  624 KLGFPQILLEKSVSVQTNLASPEPYLHPSQSEDLAACAQFESSRQ-SRSGVPSSSCVFPTFTLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACELFKLIQMYMGDRRAKADPLHVALEVATKGWSVQGLRDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPK-----FHSYLEGY-IYRHMDPVNDTKGVAISTYAKYCYH-KLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMGMQRERYPERQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KVPTGLE---DPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYDSPEAAVAV-VHALPRINRMVLCYLIRFLQVFVQPANVAVTKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFMEGV 1082          

HSP 2 Score: 89.7373 bits (221), Expect = 5.392e-17
Identity = 35/92 (38.04%), Postives = 58/92 (63.04%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFADKE 526
            W EIIEP+T+++++ N ++G+C W+PP   + ++  ENQWWEL+D  +   YYYN  T++T W +P   +++ L +LQ +K       A  E
Sbjct:   30 WVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTSENQWWELFDPNTSRFYYYNASTQRTVWHRPQGCDIIPLAKLQTLKQNTESPRASAE 121          
BLAST of rho GTPase-activating protein 39 vs. UniProt/SwissProt
Match: sp|P59281|RHG39_MOUSE (Rho GTPase-activating protein 39 OS=Mus musculus OX=10090 GN=Arhgap39 PE=1 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 4.748e-51
Identity = 148/512 (28.91%), Postives = 246/512 (48.05%), Query Frame = 2
Query:  842 LVLPEQKTYISSKSVDEDENKEFNNSLQLSTNKISFDSNN--FPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY------SCFDQKLN------------------------LENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK---IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            L  PE   +  S+S D     +F +S Q   N+ +  S++  FP  +L     +   T++E W+   FNK    L       A +++W+S+SI   ++  + +  +K+ CE FK IQMYMGDR  K     + L I  +G S+    +E+++QLC+Q T N   E    GWEL+ ICL FF P        F S+L  Y         D K+                         +E  +     + + +C    L+   ++     LK   ++++R AK      +MF S+L+EVM +QK+ +P R+LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        K+ + L+   DP + +S+LK W+R L  PLI  +  ++ +       + + + + +LP +N MVL +LI FLQ+  +  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI + DTS +E V
Sbjct:  635 LASPEPHLH-PSQSEDLGACAQFESSRQ---NRSAMPSSSCVFPTFTLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACEIFKLIQMYMGDRRAKADPLHVALEIATKGWSAQGLRDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPK-----FHSYLEGYIYRHMDPVNDTKVTQHIKELLERNSKKKSKLRKKPKPYVEEPDGVAISTYAKYCYH-KLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMSMQKERYPDRQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KVPTGLE---DPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYESPEAAVAV-VHALPRINRMVLCYLIRFLQVFVQPANVAITKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFMEGV 1106          

HSP 2 Score: 86.6557 bits (213), Expect = 5.218e-16
Identity = 39/117 (33.33%), Postives = 67/117 (57.26%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK-----------NQKNKAFADKEIQTSLE-NFEERDQ 565
            W EIIEP+T+++++ N ++G+C W+PP   + ++  E+QWWEL+D  +   YYY+  +++T W +P   +++ L +LQ +K           N   +   D    +SLE   EER Q
Sbjct:   30 WVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTSEDQWWELFDPNTSRFYYYSAASQRTVWHRPQNCDIIPLAKLQTLKQNTESPRASADNSPGRGSRDGSTGSSLEPELEERTQ 146          
BLAST of rho GTPase-activating protein 39 vs. UniProt/SwissProt
Match: sp|Q54QF4|MGP4_DICDI (Mental retardation GTPase activating protein homolog 4 OS=Dictyostelium discoideum OX=44689 GN=mgp4 PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.181e-10
Identity = 54/198 (27.27%), Postives = 93/198 (46.97%), Query Frame = 2
Query: 1583 MFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCD---GCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLI---YFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSDIQ 2158
            +F   +EE+M  QK  FP+  +P+I V L   I + D   G +T+GIFRIP   ++++AL + I +  +     D+  +H                        ++S+LK W R +  PLI    +DKS E      +   + ++    LP  N  ++ +L  FL  L + +NV  + M ++N+  + AP+  + D Q
Sbjct:  319 VFKIPIEEIMFKQKSKFPNLDIPYILVLLVNLIKKLDNGMGMKTEGIFRIPGHTSEVNALKKLINEQGEYQFPPDLYSIHP-----------------------IASLLKLWLREMPQPLIPNYVYDKSLE-----CQSIEEFIVFFKFLPASNQKIITYLAGFLNELVQPDNVVTSKMNLDNVAMVFAPSFLRCDSQ 488          
BLAST of rho GTPase-activating protein 39 vs. UniProt/SwissProt
Match: sp|P47808|MYSH_ACACA (High molecular weight form of myosin-1 OS=Acanthamoeba castellanii OX=5755 PE=3 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 4.019e-9
Identity = 42/138 (30.43%), Postives = 68/138 (49.28%), Query Frame = 2
Query: 1064 GLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLN-LENLEAGDFKSRS 1474
            G+  WT   I  SL  L   A  K     FK +  +MGDR      +AL   + ++ +++    NE++ Q+ KQ+T NP  +    GW+L+  CL+ F P S E  NC + FL      D+ +  L + + GD ++ +
Sbjct: 1257 GMFKWTKSPIPTSLTTLDQLAV-KSATRLFKNVLGFMGDRPLPYP-NALAQDLLEQCLAAPELRNEVYCQIIKQLTENPSPQSVTKGWQLMRCCLQTF-PPSEEFANCLEMFLAAKGKDDKYIEMLHDTQYGDKRTSA 1391          
BLAST of rho GTPase-activating protein 39 vs. UniProt/SwissProt
Match: sp|Q55GP8|GACO_DICDI (Rho GTPase-activating protein gacO OS=Dictyostelium discoideum OX=44689 GN=gacO PE=3 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 4.660e-8
Identity = 56/197 (28.43%), Postives = 95/197 (48.22%), Query Frame = 2
Query: 1583 MFFSSLEEVMEIQK---KLFPSR-KLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAI-EKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAK-DYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSDI 2155
            +F ++L ++ME Q+    L PS    P I   L+E I   +G  T+GIFRI     +++ L + I E  F                           LD + DP +L+ +LK W R L  P+I  +  ++ + S +K + S+I   I+ +P+ N  VL  LI FL+ +S+     Y+ M ++N+  + +P L +S +
Sbjct:  494 IFNNTLSQIMENQRDAQSLSPSSLPYPLILKLLTESIMSLNGPYTEGIFRITGSGTEVNRLKKQINEHDF--------------------------SLDTQ-DPHVLAGLLKLWLRELVHPIIPSELYNDAIKSRSKEEVSRI---ISLIPDQNKEVLNFLIPFLKNVSQPHYAQYSKMDIDNVAMVFSPGLLRSTV 660          
BLAST of rho GTPase-activating protein 39 vs. TrEMBL
Match: A0A1W2W6J8 (rho GTPase-activating protein 39 OS=Ciona intestinalis OX=7719 GN=LOC100185268 PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 1.266e-68
Identity = 198/745 (26.58%), Postives = 349/745 (46.85%), Query Frame = 2
Query:  239 IVINNGWFEIIEPKTKKKVFVNTLSGKCQWNPPDQY--QQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQ--KNKAFAD-----KEIQTSLENFEERDQLIINDLSTHSVENIDTSGYSTYKSNSINHTNGEILSNTYDSKANHSNHKESSSTLPATRKFIPRTNPNY---------------TRHSQTLRLSQPVIGL-----------------YSD--SDIELVLPEQKT------YISSKSVDEDENKEF----NNSL--QLSTNKISF--DSNNFPRHSLINAID-------QGTVTNMEIWSRNLFN-------KSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFK-LSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK--IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            +V+   W EI+EP+TK++++ N +SG+C W PP     +   ++QWWELYD KSC  YY+N   ++T W +P   ++V L +LQ IK Q  +N    D     K  +T+         +  N+ ++   +N+  S  +       + T+G  +  + DS+ + + + E  ++         RTNP Y               +R + +  +S     L                 YSD  S +   +PE  T      +  SKS D   + +     N SL  +   +++S    S +FP+HS     D          V+NME ++++  N       +    +  ++SWT  +I   ++    K  +K  CE FK IQ YMGD++ K + K  + L +  +G   +   +EI++QLC+Q T NP  E    G ELI +CL FF P +      F S+L  Y C    L++++    +    +    +   K++    K    K  +D+V  ++++    +MF ++L+EVME+Q   +P+ +LPWI   LSE++    G +T+GIFR+P ++++++ L   I++    ++++                          DP +  S+LK W+R L  PLI  +  D  + S       + + + SLP++N + L +LI FLQI ++ E+   T M   NL  +MAP   +   +D +++    +  M  +++L+ + DTS ++ V
Sbjct:    2 MVLGLEWVEIVEPRTKERMYANLVSGECLWEPPPDVNVKHSSDDQWWELYDQKSCRFYYFNASLQKTVWHRPKDADIVPLAKLQTIKEQTSQNSVRRDDNKLVKHRRTTGSRGSTGKHVARNESTSSDSDNLSASQRAQDIHKRRHRTSGGKVRRSGDSQISATGNSEQVTSFS-------RTNPTYENVTLPVRTNSLKDDSRTANSSLVSDEQGSLDSSETRPKQAKLLPDSEYSDDISPLNSTMPELSTSHTPLMHARSKSHDAVNDGDVLLRHNESLTDRNENDRMSSLSKSQSFPQHSAPAKKDFRASKKRPSDVSNMESFAKSNLNVHKRGLLRKKITIHTMLSWTRDTIKKPMIMTKDKHTKKDACETFKLIQAYMGDKKVKKIEKFEIALDVITKGWQGTGLRDEIYIQLCRQTTGNPKPESMERGLELIGMCLAFFPPSTK-----FYSYLEGYIC--THLDMQDSAGVNVSHYAEVSFKRLEKIIQTGAKRGQKKPTLDEVVQSQRSIFNPSMFGNTLDEVMELQMDKYPNHRLPWILTTLSEQVLTLGGNKTEGIFRVPGDIDEVNMLKVQIDQWNVPDTLR--------------------------DPHVPGSLLKLWYRELAEPLIPAEFYDACVESYNNPNDAVNV-VYSLPDINRLCLTYLIRFLQIFAQHEHSKVTKMDANNLAMVMAPNCLRCESNDPRIIFENTRKEMSYIRTLVQHLDTSSLDGV 705          
BLAST of rho GTPase-activating protein 39 vs. TrEMBL
Match: A0A151NWN8 (Rho GTPase-activating protein 39-like isoform B OS=Alligator mississippiensis OX=8496 GN=ARHGAP39 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 9.473e-67
Identity = 193/683 (28.26%), Postives = 324/683 (47.44%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFADKEIQTSLENFEERDQLIINDLSTHS----VENIDTSGYSTYKSNSINHTNGEILSNTYDSKANHSNHKESSSTLPATRKFIPRTNPNYTRHSQTLRLSQPVIGLYSDSD-IELVLPEQKTYISSKSVD---EDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVT-----NMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK--IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEK-AFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            W EIIEP++ ++++VN  +G+C W PP   + +Q  + QWWEL+D  +   YYYN  T+QT W +P   ++V L QLQ +K            Q+     + R  L  +  +TH     ++ +D    S+ K                DS    + H +    LP T K       +  +   T+R  +     Y   D +E  +  Q + +SS +     + E  E N+  + S    S     FP  +L   I Q ++      N+ + ++ +F +  S ++ ++SW+  SI   +L  + +  +K+ CE FK +Q+YMGDR+  +  + + L    +  S     +E+++QL +Q T N   +    GWEL+ I L FF P        F+S+L  Y       +  +L    +     +C R   K+     K    K  I+++  A+ T    ++F SSLEE+M +QK+++P  KLPWIQ  LS+++    G +T+GIFR+P ++++++AL   +++ +  SN             C               DP + +S+LK W+R L  PLI     +E + S     + + + +  LP+LN  VL +LIHFLQI ++  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI++ DTS IE +
Sbjct:    7 WVEIIEPRSHERMYVNLTTGECGWEPPPNLKVRQSDQKQWWELFDQSNNRFYYYNAITQQTVWHRPQDCDIVPLAQLQAMKQNS---------QSDSREHQHRVTLSSDGRNTHIQMPLLQEMDRVKDSSTKKRP-------------DSGRETTAHWQP---LPGT-KSATLVKVSSLKQQDTVRQKR----TYEKMDSLEKTVTSQTSLVSSNTTGTSSQPETIESNSKQENSRQPDSCMGYQFPCIALPEPIPQSSMVDWASKNLNMHTQGIFRRRIS-ISNMLSWSGDSIKKPMLITSNRTIKKEACEMFKLVQIYMGDRQTHMDHNHVALVTITKCWSIQGLRDELYIQLIRQTTDNTCYQSLARGWELMAISLAFFSPSPK-----FQSYLEGYIYCHLDSDRYSLPISTYAR---YCYRKLQKVAVTGGKKGLQKPTIEEIAHARNTIVTPSLFGSSLEEIMLLQKEIYPGNKLPWIQTQLSQQVLALGGEQTEGIFRVPGDIDEVNALKLQVDQWSIPSN-------------CS--------------DPSIPASLLKLWYRELEEPLIPQRFYEECIGSYENPDAAVTV-VQFLPDLNKFVLYYLIHFLQIFAQPYNVGKTKMDVNNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRMLIVHLDTSFIEGM 622          
BLAST of rho GTPase-activating protein 39 vs. TrEMBL
Match: A0A151NW29 (Rho GTPase-activating protein 39-like isoform A OS=Alligator mississippiensis OX=8496 GN=ARHGAP39 PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 2.888e-64
Identity = 196/711 (27.57%), Postives = 328/711 (46.13%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFADKEIQTSLENFEERDQLIINDLSTHS----VENIDTSGYSTYKSNSINHTNGEILSNTYDSKANHSNHKESSSTLPATRKFIPRTNPNYTRHSQTLRLSQPVIGLYSDSD-IELVLPEQKTYISSKSVD---EDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVT-----NMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFD----------------------------QKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK--IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEK-AFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            W EIIEP++ ++++VN  +G+C W PP   + +Q  + QWWEL+D  +   YYYN  T+QT W +P   ++V L QLQ +K            Q+     + R  L  +  +TH     ++ +D    S+ K                DS    + H +    LP T K       +  +   T+R  +     Y   D +E  +  Q + +SS +     + E  E N+  + S    S     FP  +L   I Q ++      N+ + ++ +F +  S ++ ++SW+  SI   +L  + +  +K+ CE FK +Q+YMGDR+  +  + + L    +  S     +E+++QL +Q T N   +    GWEL+ I L FF P S + Q+  + ++  Y   D                            Q  N E L    +     +C R   K+     K    K  I+++  A+ T    ++F SSLEE+M +QK+++P  KLPWIQ  LS+++    G +T+GIFR+P ++++++AL   +++ +  SN             C               DP + +S+LK W+R L  PLI     +E + S     + + + +  LP+LN  VL +LIHFLQI ++  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI++ DTS IE +
Sbjct:    7 WVEIIEPRSHERMYVNLTTGECGWEPPPNLKVRQSDQKQWWELFDQSNNRFYYYNAITQQTVWHRPQDCDIVPLAQLQAMKQNS---------QSDSREHQHRVTLSSDGRNTHIQMPLLQEMDRVKDSSTKKRP-------------DSGRETTAHWQP---LPGT-KSATLVKVSSLKQQDTVRQKR----TYEKMDSLEKTVTSQTSLVSSNTTGTSSQPETIESNSKQENSRQPDSCMGYQFPCIALPEPIPQSSMVDWASKNLNMHTQGIFRRRIS-ISNMLSWSGDSIKKPMLITSNRTIKKEACEMFKLVQIYMGDRQTHMDHNHVALVTITKCWSIQGLRDELYIQLIRQTTDNTCYQSLARGWELMAISLAFFSP-SPKFQSYLEGYI--YCHLDSDRYIVQRIKKLLDLKNKKNSKSRKKRKQNTNDEGLPISTYAR---YCYRKLQKVAVTGGKKGLQKPTIEEIAHARNTIVTPSLFGSSLEEIMLLQKEIYPGNKLPWIQTQLSQQVLALGGEQTEGIFRVPGDIDEVNALKLQVDQWSIPSN-------------CS--------------DPSIPASLLKLWYRELEEPLIPQRFYEECIGSYENPDAAVTV-VQFLPDLNKFVLYYLIHFLQIFAQPYNVGKTKMDVNNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRMLIVHLDTSFIEGM 652          
BLAST of rho GTPase-activating protein 39 vs. TrEMBL
Match: A0A1I8A562 (Uncharacterized protein OS=Steinernema glaseri OX=37863 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.097e-62
Identity = 186/677 (27.47%), Postives = 304/677 (44.90%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK--------NQKNKAFADKEIQTSLENFEER--DQLIINDLSTHSVENIDTSGYSTYKSNSINHTNGEILSNTYDSKANHSNHKESSSTLPATRKFIPRTNPNYTRHSQTLRLSQPVIGLYSDSDIELVLPEQKTYISSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLKIDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            W EI EP+TK ++F N  +G+C W PP     +++ ENQWWEL+D KS   YYYN  T  T W KP+  +++ L +LQ++K        +Q   +    E QTS     +R  D  + +   + SV+ +D  G     +  I   +G I      S+ +HSN     STLP++  +      N+   S+        +     S +  V P       S S           S   S+ +  F S     H L N   Q  + N ++               + SWT +SI   L     K  +K     FK +QMYMGDR+ K S D + ++IC++ +  +   +E+F QL KQ+T N   E    GWEL+ I L F  P+S E +    SF+  +S  D  L+   +    F  +   C +   +    S       ++ V++++        F +S++E+M++Q   +P R++PWI+  L + I    G  T+G+FR+P++  ++      +++                             L +  D  + +++LK W R L TPLI  D   +   S+     + L  +  LP  + MVL  L+  LQ+LS++ENV +T M V NL  +MAP + +    D  ++    +  M  L++LI + D S + +V
Sbjct:   32 WVEIEEPRTKDRMFANLTTGECAWEPPPGVPVKRMKENQWWELFDTKSKRFYYYNATTMTTVWQKPNNCDIIPLAKLQLLKENTEMDFYSQSRGSKVSSETQTSPSRLRKRLEDLQLGDSRPSVSVDALDDEGVF---AQEIGPESGVITKKP--SQYSHSN----PSTLPSSNIYS-----NFDLCSE--------LSTSPMSSMGTVRPPVPQCFPSPSSSHTMPSARGRSTSSSSEQRQFSSVARAEHDLHNTSFQSGIGNGDV--------------PVDSWTKESIKQPLSKNLDKNSKKDAVALFKLVQMYMGDRKAKSSADKIAVSICEQALHKAELGDELFAQLTKQLTENERTESLRKGWELLAITLSFVSPKSEEAKQSLLSFVEMHS--DALLDTPEVAVSQFAQQ---CLKRLQRGAPASGARPKPTMELVQESRIHIFSPPQFSASIDELMDLQADRWPGRQVPWIETTLIDLIVASGGPTTEGLFRVPADPEQLQTARLRLDRWL---------------------------LPVVRDAHVPAALLKMWLRQLPTPLIP-DSIYQRCLSVCDQPEECLKTVELLPASHKMVLAKLLWLLQVLSREENVRHTKMDVSNLAMVMAPNILRCGSEDPNVIFLNTRKEMTFLKTLISHCDCSHMSSV 639          
BLAST of rho GTPase-activating protein 39 vs. TrEMBL
Match: A0A1A7WEE2 (Rho GTPase activating protein 39 OS=Iconisemion striatum OX=60296 GN=ARHGAP39 PE=4 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 9.025e-55
Identity = 153/522 (29.31%), Postives = 252/522 (48.28%), Query Frame = 2
Query:  731 PATRKF-----IPRTNPNYTRHSQTLRLSQPVIGLYSDSDIELVLPEQKTYI-SSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLK--LLDMSNKVNSLKIDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            P  R F     + ++  ++ +HS   RL  P   L     ++  L   + Y+  S+S D     +F  S        S     FP  SL     +   T++E W+   FNK    L       A +++W+S+ I   ++  T +A +K+  + FK IQMYMGDR  K    ++ L +  RG S+    +E+++QLC+Q T N   +    GWEL+ ICL FF P        F ++L  Y C      L + +     S + +C R   K  L      +    ++++  A+      +MF SSLEEVM +QK+ +P R+LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        KI + L+   DP + +S+LK W+R L  PLI  +  +E + S     + I + +  LP +N +VL +LI FLQ+ ++  NVP T M V NL  +MAP   +    D +++    +  M  ++ LI   DTS ++ +
Sbjct:   52 PVVRAFSEDEALAQSEGHHWKHSTFDRLGFPQALLEKSLSVQTNLASPEPYLHPSQSEDLGACAQFEASRNARNMMPSASCGIFPEFSLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSEPIKKPMIVTTDRAVKKEAVDIFKLIQMYMGDRRSKADPLSVALEVVVRGWSNQGLRDELYIQLCRQTTENFRYDSLERGWELMAICLAFFPPTPR-----FHAYLEGYICRHMD-PLNDTKGVAISSYAKYCYRKLTKGALTGAKKGLQKPCLEEINHARNAIFHPSMFSSSLEEVMALQKERYPDRQLPWVQTRLSEEVLGLNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KIPTGLE---DPHIPASLLKLWYRELEEPLIPHEFYEECINSYDNPEAAISV-VLGLPHINKLVLCYLIRFLQVFAQPANVPITKMDVNNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFIRVLIQRLDTSFMDGI 537          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Cavefish
Match: arhgap39 (Rho GTPase activating protein 39 [Source:ZFIN;Acc:ZDB-GENE-041014-247])

HSP 1 Score: 180.644 bits (457), Expect = 1.095e-46
Identity = 137/497 (27.57%), Postives = 239/497 (48.09%), Query Frame = 2
Query:  794 RLSQPVIGLYSDSDIELVLPEQKTYI-SSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK---IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            RL+ P   L     ++  L   + Y+  S+S D     +F  S        S     FP  SL     +   T++E W+   FNK    L       A +++W+S+ I   ++  T +  ++   E FK IQ YMGDR  K    ++ L +  RG S+    +E+++QLC+Q T N   +    GWEL+ ICL FF P +    N  + ++ ++      ++  N       S + +C R  L+   ++     LK   ++++  A+      +MF SSLEEVM +QK+ +P  +LPW+Q  LSEE+   +G +T+GIF +P ++++++AL   +++                        K+ + L+  H PL L      W+R L  P+I  +  +E +++     + + + + +LP +N +VL +LI FLQ+ ++  NV  T M V NL  +MAP   +    D +++    +  M  ++ LI + DTS ++ V
Sbjct:  428 RLAFPQTLLEKSLSVQTNLASPEPYLHPSQSEDLGACSQFEASRNARNMMPSASCGVFPEFSLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSEPIKKPMIVTTDRTVKRDAVELFKLIQTYMGDRRAKNEPLSVALEVAVRGWSNQGLRDELYIQLCRQTTENFRYDSLQRGWELMAICLAFF-PPTPRFHNYLEGYIYRH------MDPLNDTKVAISSYAKYCYR-KLQKAALTGAKKGLKKPCLEEIAYARSAIFSPSMFGSSLEEVMAMQKERYPDHQLPWVQTRLSEEVLGLNGDQTEGIF-VPGDIDEVNALKMQVDQW-----------------------KVPTGLEDPHIPLKL------WYRELEEPVIPHEYYEECISNYDSPEAAVSV-VHNLPHINKLVLCYLIRFLQVFAQPANVAVTKMDVSNLAMVMAPNCLRCLSDDPRIIFENTRKEMSFIRVLIQHLDTSFMDEV 882          

HSP 2 Score: 84.7297 bits (208), Expect = 2.193e-16
Identity = 35/91 (38.46%), Postives = 60/91 (65.93%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK-NQKNKAFAD 520
            W EI+EP+T+++++ N L+G+C W+ P   + ++  E+QWWEL+D  +   YYYN  T++T W +P   +++ L +LQ +K N  + A AD
Sbjct:    7 WVEILEPRTRERMYANLLTGECVWDAPAGVRIKRSGEDQWWELFDSNTSRFYYYNASTQRTVWHRPHACDIIPLAKLQTLKQNTDSPASAD 97          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Cavefish
Match: zgc:92107 (zgc:92107 [Source:ZFIN;Acc:ZDB-GENE-041114-4])

HSP 1 Score: 175.637 bits (444), Expect = 5.660e-45
Identity = 130/437 (29.75%), Postives = 206/437 (47.14%), Query Frame = 2
Query: 1010 NMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY---SCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKV-----------NSLKIDDVRDAKKTYSCLTM--FFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYF-------DKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            ++ + ++ LF +  S +A ++SW   SI   +L  + +  RK+ CE FK +Q YMGDR  +L +    L I  +        +E+++QL +Q T N        GWEL+ + L FF P       C+    IQ       D+KL    L+  DFK ++    +   +  D   +              LK   V   KK     T+     S  EVME Q +LFP RKLPW+QV LS+ I    G +T+GIFR+P ++++++AL   +++                        +I  +L    DP + +S++K W+R L  PLI            D+P+ +I+         + SLP+LN +VL + IHFLQ+ ++  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI++ DTS IE +
Sbjct:  593 HLNLHTQGLFRRRVS-IANMLSWNRGSIKKPMLVTSDRTVRKEACEMFKLVQAYMGDRPSRLDRRHAALLIVTKCWGMQGLRDELYVQLVRQTTGNTSPRSLAAGWELMAVSLAFFAPSPKFC--CYLEGYIQRHMDPTSDKKLTQFILDQQDFKKKNSKSRKKRKQNTDEEEEALPISTYAKFCYRKLKKVAVTGGKKGLRKPTLEEVDHSRREVMERQSELFPDRKLPWVQVQLSQYILALGGAQTEGIFRVPGDIDEVNALKLQVDQW-----------------------RIPENLS---DPNVPASLMKLWYRELEEPLIPMSFYKQCISNCDDPVAAIS--------VVQSLPDLNRLVLFYFIHFLQVFAQPANVSVTKMDVNNLAMVMAPNCLRCQSDDPRIIFENTRKEMAFLRMLIVHLDTSFIEGI 992          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Cavefish
Match: si:ch211-218g4.2 (rho GTPase-activating protein 39-like [Source:NCBI gene;Acc:103028561])

HSP 1 Score: 174.866 bits (442), Expect = 1.462e-44
Identity = 125/454 (27.53%), Postives = 216/454 (47.58%), Query Frame = 2
Query: 1010 NMEIWSRNLFN-------KSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY--SCFDQKLNLENLEAGDF--------------------------KSRSIFCSRISLKLLDMSNKVNSLK--IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLI---YFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            +ME W+   FN       +    +A ++SW   SI   +L  + +  +K+ CE FK +Q+YMGDR  +L +    L +  +   +    +E+++QL +Q T N        GWEL+ I L FF P S + +   + ++ ++     D+K+    +E  D                            + + +C R   K+     K    K  +D++   +      ++F S+LEE+ME Q KLFP R+LPW+QV LS+ +    G +T+GIFR+P ++++++AL   +++                        KI  +L    DP + +S+LK W+R L  P+I   ++ +      S  +D    +  + SLPELN +VL + IHFLQ+ ++  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI++ DTS ++ +
Sbjct:  691 DMEDWASKNFNMHTQGLFRRRVSIANMLSWNGGSIKKPMLITSERTVKKEACEMFKLVQVYMGDRPARLDRRHTALLVVTKCWGTQGLRDELYVQLVRQTTDNSSLCSLEAGWELMAISLAFFSP-SPKFRRYLEGYIQRHLEPSNDKKILQRIMEQQDIKNKKNSKSRKKRKQNNEEEEEQGLPISTYAKYCYRKLQKVAVTGGKKGLRKPTLDEIDHGRNAIVTPSLFGSALEEIMERQSKLFPQRRLPWVQVQLSQCVLNLGGAQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KIPDNLS---DPNVPASLLKLWYRELEEPVIPQNFYTQ----CISHYEDPEAAINVVQSLPELNRLVLCYFIHFLQVFAQPVNVSKTKMDVNNLAMVMAPNCLRCQSDDPRIIFENTRKEMSFLRILIVHLDTSFVKGL 1113          

HSP 2 Score: 78.9518 bits (193), Expect = 1.652e-14
Identity = 45/133 (33.83%), Postives = 73/133 (54.89%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPDQY--QQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFADKEIQTSLENFEERDQLIINDLS-THSV-ENIDTSGYSTYKSNS 643
            W EI+EP+++++++VN L+G+C W PP     +Q   NQWWEL+D  +   YYYN  +RQT W +P   ++V L QLQ +K         +    +  + E R   +   +S T S+ + +++SG  T  S  
Sbjct:    8 WVEIVEPRSRERMYVNLLTGECGWEPPLGLPIRQADGNQWWELFDNNNNRFYYYNATSRQTVWHRPQGCDIVPLAQLQAMKKSSESELKGQGRPMTPGSGEGRTTPLPGMVSPTLSISQELESSGRETPTSKG 140          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Cavefish
Match: si:ch211-218g4.2 (rho GTPase-activating protein 39-like [Source:NCBI gene;Acc:103028561])

HSP 1 Score: 174.481 bits (441), Expect = 1.595e-44
Identity = 125/454 (27.53%), Postives = 216/454 (47.58%), Query Frame = 2
Query: 1010 NMEIWSRNLFN-------KSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY--SCFDQKLNLENLEAGDF--------------------------KSRSIFCSRISLKLLDMSNKVNSLK--IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLI---YFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            +ME W+   FN       +    +A ++SW   SI   +L  + +  +K+ CE FK +Q+YMGDR  +L +    L +  +   +    +E+++QL +Q T N        GWEL+ I L FF P S + +   + ++ ++     D+K+    +E  D                            + + +C R   K+     K    K  +D++   +      ++F S+LEE+ME Q KLFP R+LPW+QV LS+ +    G +T+GIFR+P ++++++AL   +++                        KI  +L    DP + +S+LK W+R L  P+I   ++ +      S  +D    +  + SLPELN +VL + IHFLQ+ ++  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI++ DTS ++ +
Sbjct:  670 DMEDWASKNFNMHTQGLFRRRVSIANMLSWNGGSIKKPMLITSERTVKKEACEMFKLVQVYMGDRPARLDRRHTALLVVTKCWGTQGLRDELYVQLVRQTTDNSSLCSLEAGWELMAISLAFFSP-SPKFRRYLEGYIQRHLEPSNDKKILQRIMEQQDIKNKKNSKSRKKRKQNNEEEEEQGLPISTYAKYCYRKLQKVAVTGGKKGLRKPTLDEIDHGRNAIVTPSLFGSALEEIMERQSKLFPQRRLPWVQVQLSQCVLNLGGAQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KIPDNLS---DPNVPASLLKLWYRELEEPVIPQNFYTQ----CISHYEDPEAAINVVQSLPELNRLVLCYFIHFLQVFAQPVNVSKTKMDVNNLAMVMAPNCLRCQSDDPRIIFENTRKEMSFLRILIVHLDTSFVKGL 1092          

HSP 2 Score: 78.9518 bits (193), Expect = 1.584e-14
Identity = 45/133 (33.83%), Postives = 73/133 (54.89%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPDQY--QQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFADKEIQTSLENFEERDQLIINDLS-THSV-ENIDTSGYSTYKSNS 643
            W EI+EP+++++++VN L+G+C W PP     +Q   NQWWEL+D  +   YYYN  +RQT W +P   ++V L QLQ +K         +    +  + E R   +   +S T S+ + +++SG  T  S  
Sbjct:    8 WVEIVEPRSRERMYVNLLTGECGWEPPLGLPIRQADGNQWWELFDNNNNRFYYYNATSRQTVWHRPQGCDIVPLAQLQAMKKSSESELKGQGRPMTPGSGEGRTTPLPGMVSPTLSISQELESSGRETPTSKG 140          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Cavefish
Match: arhgap25 (Rho GTPase activating protein 25 [Source:ZFIN;Acc:ZDB-GENE-060526-210])

HSP 1 Score: 59.3066 bits (142), Expect = 1.299e-8
Identity = 51/200 (25.50%), Postives = 90/200 (45.00%), Query Frame = 2
Query: 1580 TMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLI----YFDKSDEPL---TSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSDIQ 2158
             +F   L +++  +KKL P R +P + V    E  +  G   +GIFR+P + N++    +A +   + +   D + +H+                       + S+LK + R L  P++    Y D  D  L    + A    K+  +I+ LP++NY +L ++  FL     Q++     M VENL T+M   LFK  ++
Sbjct:  109 AVFGKGLADILAYEKKLGP-RSVPML-VEKCAEFIKEHGLDEEGIFRLPGQENQVKHFREAFDAGERPSFPSDTD-VHT-----------------------VGSLLKLYLRELPEPVVPWTQYQDFLDSSLMLDATTAAGREKLEKQISLLPKVNYNLLSYICRFL--FEVQQHSKVNKMSVENLATVMGVNLFKPQVE 280          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Sea Lamprey
Match: arhgap39 (Rho GTPase activating protein 39 [Source:ZFIN;Acc:ZDB-GENE-041014-247])

HSP 1 Score: 159.073 bits (401), Expect = 2.846e-40
Identity = 89/292 (30.48%), Postives = 153/292 (52.40%), Query Frame = 2
Query: 1067 LMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLKIDDVRDAKKTYSCL--TMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLI 1936
            L+SW+ ++I   L+    +   K+ CE F+ +QMYMGDR  +L + A+ L + +RG S     +E+F+QLCKQ T N   E    GWEL+ ICL FF P S +     + ++  Y   D   + + +    +   + +C R  L+ + ++     LK  ++ + ++  + +     F SLEE+M +Q++ FP ++LPW+Q  LS ++    G +T+GIFR+P ++++++AL   +++                         I SDL    DP + +S+LK W+R L  PLI
Sbjct:  711 LLSWSGEAIRKPLIVTADRTIMKEACEVFRLVQMYMGDRRCRLERAAVALEVARRGWSLQGLRDELFVQLCKQTTENLRPESLTRGWELLAICLAFF-PPSPKFHTYLEGYI--YRHLDPAHDQKGIPISTY---AQYCYR-KLQKVAVTGGKKGLKKPNLEEVQQARNAIFTPSLFGSLEEIMALQRQRFPEQRLPWVQSGLSLKVLELQGTQTEGIFRVPGDIDEVNALKLKVDQW-----------------------TIPSDLT---DPHVPASLLKLWYRELEEPLI 969          

HSP 2 Score: 85.1149 bits (209), Expect = 3.398e-17
Identity = 31/82 (37.80%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKN 496
            W EIIEP+T++ ++ N ++G+C W+PP   + ++  +NQWWEL+D  +   YYYN  +++T W +P   +++ L +LQ +K 
Sbjct:   27 WVEIIEPRTREHMYANLVTGECVWDPPADAKIKRTHDNQWWELFDPNTARFYYYNASSQRTVWHRPQHCDIIPLAKLQTLKQ 108          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Sea Lamprey
Match: arhgap18 (Rho GTPase activating protein 18 [Source:ZFIN;Acc:ZDB-GENE-070502-1])

HSP 1 Score: 52.7582 bits (125), Expect = 2.882e-7
Identity = 64/234 (27.35%), Postives = 103/234 (44.02%), Query Frame = 2
Query: 1496 LKLLDMSNKVNSLKIDDVRD--AKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLP-WIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFD-----KSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLF-KSDIQLLQP 2170
            + L++++   ++L ID  R+   K       +F   L  ++E  +K+ P  K+P ++Q  L+       G  T+GIFRIP   ++I +L Q +E  F   ++       + +   P            HD    +S+LK + R L  PL+  +      S E +    +    + L I  LP  N  VLK ++  L  L   E    T M + N+  +MAP LF  S   LLQP
Sbjct:  231 VALIELAAFFDALHIDFTRNRPVKVRAKDSRLFGVPLSTLLEQDQKISPGVKVPLFLQELLTH--LEQTGLDTEGIFRIPGSSSRIKSLRQELEAGFYDGAV-------TWDDVRP------------HDA---ASLLKLFIRELPAPLLTAEYLTAFTSVEKIEIRKQRIRALNLLIILLPAANRDVLKAILELL--LKVSEASTATRMDLWNVSLIMAPNLFMSSGSALLQP 438          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Nematostella
Match: EDO35782 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKK0])

HSP 1 Score: 113.235 bits (282), Expect = 4.593e-28
Identity = 78/248 (31.45%), Postives = 121/248 (48.79%), Query Frame = 2
Query: 1541 DDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDK-----------SDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSDIQLLQPA-------MQLLQSLIINWDTSDIENV 2230
            DD++ A+      +MF ++LE++M+ Q+  FPS KLPWI   L+E +   DG RT+GIFR+P ++++++AL   +++    +++                           DP + +S+LK WFR L+ PLI  +            S E       D +     I SLPE+N +VL +LI FLQI S  E    T M V NL  + AP   ++    LQ         M  +++L+ N DTS +E V
Sbjct:   32 DDIQQAEYHVFHPSMFGATLEDIMQRQESDFPSLKLPWILTTLAEAVLHHDGARTEGIFRVPGDIDEVNALKLRLDRYEPPDNVS--------------------------DPHVPASLLKLWFRELNDPLIPAEALIFLLFVTLTFSTEKCIMNCDDATVATALILSLPEINRLVLSYLIRFLQIFSLMEVSSLTKMDVNNLAMVWAPNCLRNPSDNLQEVWENTRREMTFVRTLLWNLDTSYMEGV 253          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Nematostella
Match: EDO35783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKK1])

HSP 1 Score: 87.8113 bits (216), Expect = 2.755e-20
Identity = 46/141 (32.62%), Postives = 78/141 (55.32%), Query Frame = 2
Query: 1025 SRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKL-SKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY-SCFDQKLNLE 1441
            ++ LF +    LA +MSW+   I   L+ ++ +  +K   + FK I  YMGDR  ++ +   + L IC RG  +    +EI++Q+CKQ T N ++E    GWEL+ ICL  F P S +  +  + ++ ++ +C D  L +E
Sbjct:    6 TKGLFRRKRVSLASMMSWSKVPIKKPLILMSDRQLKKDAVDVFKLILGYMGDRPIRVKTTRDIALDICTRGWETPLIRDEIYLQICKQTTDNGNSESLRRGWELMSICLTLF-PPSTKFHSYLEGYITRHLNCEDDNLEVE 145          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Nematostella
Match: EDO35784 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKK2])

HSP 1 Score: 86.2705 bits (212), Expect = 3.408e-19
Identity = 37/89 (41.57%), Postives = 55/89 (61.80%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPD--QYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFA 517
            W EIIEP+TK+ ++ N  +G+C W PP   + ++  E  WWELYD K+   YYYN  T+ T W KP   +++ L +LQ +K ++ K  A
Sbjct:   52 WVEIIEPRTKEPMYANLKTGQCLWEPPGGVKVKKADETHWWELYDPKTRRYYYYNACTQTTVWHKPKDCDIIPLAKLQSMKAKEKKRLA 140          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Medaka
Match: arhgap39 (Rho GTPase activating protein 39 [Source:NCBI gene;Acc:101155916])

HSP 1 Score: 195.282 bits (495), Expect = 2.062e-51
Identity = 142/496 (28.63%), Postives = 236/496 (47.58%), Query Frame = 2
Query:  794 RLSQPVIGLYSDSDIELVLPEQKTYI-SSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLK--LLDMSNKVNSLKIDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            RL  P   L     ++  L   + Y+  S+S D     +F  S        S     FP  SL     +   T++E W+   FNK    L       A +++W+S+ I   ++  + +  +K+  E FK +Q +MGDR  K    A+ L +  RG S+    +E+++QLC+Q T N   +    GWEL+ ICL FF P        F ++L  Y C      L + +     S +  C R  +K  L      +    ++++R A+      +MF SSLEEVM +QK  +P  +LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        KI + L+   DP + +S+LK W+R L  PLI  +  +E +       + + + +  LP +N +VL +LI FLQ+ ++  NV  T M V NL  +MAP   +    D +++    +  M  ++ LI   DTS ++ +
Sbjct:  533 RLGFPQALLEKSLSVQTSLASPEPYLHPSQSEDLGACAQFEASRNARNMMPSASCGIFPEFSLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSEPIKKPMIVTSDRTVKKEAVEIFKLVQTFMGDRRSKADPLAVALEVVVRGWSNQGLRDELYIQLCRQTTENFRYDSLERGWELMAICLAFFPPTPR-----FHAYLEGYICRHMD-PLNDTKGVAISSYAKHCYRKLMKAALTGAKKGLQKPSLEEIRHARNAIFHPSMFGSSLEEVMALQKDRYPDHQLPWVQTRLSEEVLGLNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KIPTGLE---DPHIPASLLKLWYRELEEPLIPHEFYNECIRHYDNPEAAVNV-VLGLPHINKLVLCYLIRFLQVFAQPANVAITKMDVNNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFIRVLIQRLDTSFMDGI 992          

HSP 2 Score: 88.5817 bits (218), Expect = 1.446e-17
Identity = 33/85 (38.82%), Postives = 56/85 (65.88%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPDQY--QQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKN 505
            W EIIEP+T+++++ N L+G+C W+PP     ++  ENQWWEL+D  +   YYYN  +++T W +P   +++ L +LQ +K   +
Sbjct:    7 WVEIIEPRTRERMYANLLTGECVWDPPQGVCIKRTGENQWWELFDPNTSRFYYYNASSQRTVWHRPQGCDIIPLAKLQTLKQHTD 91          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Medaka
Match: zgc:92107 (rho GTPase-activating protein 39 [Source:NCBI gene;Acc:101156731])

HSP 1 Score: 195.667 bits (496), Expect = 2.342e-51
Identity = 136/454 (29.96%), Postives = 217/454 (47.80%), Query Frame = 2
Query: 1010 NMEIWS--------RNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQY------SCFDQKL------------------------NLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK--IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
             ME W+        + LF +  S +A ++SW   SI   +L  + +A RK+ CE FK +Q YMGDR  +L +    L I  +        +E+++QL +Q T N        GWEL+ + L FF P        F+ +L  Y         D+KL                        N E  E     + + FC R  LK+     K    K  ++++  +++     ++F SSLEEVME Q +LFP RKLPW+QV LS+ +    G +T+GIFR+P ++++++AL   +++                        +I  +L    DP + +S++K W+R L  PLI  D  ++ +++     + I + +  LPELN +VL + IHFLQ+ ++  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI++ DTS IE V
Sbjct:  682 GMEDWASKHLNMHTQGLFRRRVS-IANMLSWNRGSIKKPMLVTSNRAIRKEACEMFKLVQAYMGDRPSRLDRRHCALLIVTKCWDMPGLRDELYVQLVRQTTANASPRSLAAGWELMAVSLAFFAPSPK-----FRCYLEGYIQRHTEPSSDKKLTQFILEQQEMKMKKNSKSRKKRKQNTEEDEGLSISTYAKFCHRKLLKVAITGGKKGLRKPTLEEIDHSRRAIITPSLFGSSLEEVMERQNELFPDRKLPWVQVQLSQYVLALGGAQTEGIFRVPGDIDEVNALKLQVDQW-----------------------RIPENLS---DPNVPASLMKLWYRELEEPLIPMDFYNQCISNCDDPVAAITV-VQLLPELNRLVLCYFIHFLQVFAQPSNVAITKMDVNNLAMVMAPNCLRCHSDDPRIIFENTRKEMSFLRMLIVHLDTSFIEGV 1102          

HSP 2 Score: 87.0409 bits (214), Expect = 4.271e-17
Identity = 44/140 (31.43%), Postives = 75/140 (53.57%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPDQY--QQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK-----------NQKNK--------AFADKEIQTSLENFEERDQLIINDLSTHSVENIDT 613
            W EI+EP+++++++VN  +G+C W+PP     +Q   NQWWEL+D  S   YYYN    +T W +P   ++V L QLQ +K           ++K++        +   +E+QT L   E+   + +  + T S EN ++
Sbjct:    4 WVEILEPRSRERMYVNLTTGECGWDPPSGVPVRQADGNQWWELFDTHSGRFYYYNSTGPRTVWHRPQGADIVPLSQLQAMKRCNEAKRVGGGDEKHRHGTIGSIGSPGSQEMQTPLP--EQESDVPVTRVQTPSAENANS 141          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Medaka
Match: zgc:92107 (rho GTPase-activating protein 39 [Source:NCBI gene;Acc:101156731])

HSP 1 Score: 192.586 bits (488), Expect = 2.247e-50
Identity = 135/457 (29.54%), Postives = 218/457 (47.70%), Query Frame = 2
Query: 1010 NMEIWS--------RNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHP----------------ESVEMQNCFKSFLIQYSCF---DQKL--------------NLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLK--IDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
             ME W+        + LF +  S +A ++SW   SI   +L  + +A RK+ CE FK +Q YMGDR  +L +    L I  +        +E+++QL +Q T N        GWEL+ + L FF P                E    + C     +Q + F    Q++              N E  E     + + FC R  LK+     K    K  ++++  +++     ++F SSLEEVME Q +LFP RKLPW+QV LS+ +    G +T+GIFR+P ++++++AL   +++                        +I  +L    DP + +S++K W+R L  PLI  D  ++ +++     + I + +  LPELN +VL + IHFLQ+ ++  NV  T M V NL  +MAP   +    D +++    +  M  L+ LI++ DTS IE V
Sbjct:  707 GMEDWASKHLNMHTQGLFRRRVS-IANMLSWNRGSIKKPMLVTSNRAIRKEACEMFKLVQAYMGDRPSRLDRRHCALLIVTKCWDMPGLRDELYVQLVRQTTANASPRSLAAGWELMAVSLAFFAPSPKFRCYLEGYIQRHTEPSSDKKCESQTELQVTQFILEQQEMKMKKNSKSRKKRKQNTEEDEGLSISTYAKFCHRKLLKVAITGGKKGLRKPTLEEIDHSRRAIITPSLFGSSLEEVMERQNELFPDRKLPWVQVQLSQYVLALGGAQTEGIFRVPGDIDEVNALKLQVDQW-----------------------RIPENLS---DPNVPASLMKLWYRELEEPLIPMDFYNQCISNCDDPVAAITV-VQLLPELNRLVLCYFIHFLQVFAQPSNVAITKMDVNNLAMVMAPNCLRCHSDDPRIIFENTRKEMSFLRMLIVHLDTSFIEGV 1135          

HSP 2 Score: 87.0409 bits (214), Expect = 4.115e-17
Identity = 44/140 (31.43%), Postives = 75/140 (53.57%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPPDQY--QQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIK-----------NQKNK--------AFADKEIQTSLENFEERDQLIINDLSTHSVENIDT 613
            W EI+EP+++++++VN  +G+C W+PP     +Q   NQWWEL+D  S   YYYN    +T W +P   ++V L QLQ +K           ++K++        +   +E+QT L   E+   + +  + T S EN ++
Sbjct:    8 WVEILEPRSRERMYVNLTTGECGWDPPSGVPVRQADGNQWWELFDTHSGRFYYYNSTGPRTVWHRPQGADIVPLSQLQAMKRCNEAKRVGGGDEKHRHGTIGSIGSPGSQEMQTPLP--EQESDVPVTRVQTPSAENANS 145          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Medaka
Match: arhgap39 (Rho GTPase activating protein 39 [Source:NCBI gene;Acc:101155916])

HSP 1 Score: 191.43 bits (485), Expect = 4.084e-50
Identity = 143/510 (28.04%), Postives = 238/510 (46.67%), Query Frame = 2
Query:  794 RLSQPVIGLYSDSDIELVLPEQKTYI-SSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQL-------AGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSC--FDQKLNLENLEAGD------------FKSRSIFCSRISLK--LLDMSNKVNSLKIDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFK---SDIQLL----QPAMQLLQSLIINWDTSDIENV 2230
            RL  P   L     ++  L   + Y+  S+S D     +F  S        S     FP  SL     +   T++E W+   FNK    L       A +++W+S+ I   ++  + +  +K+  E FK +Q +MGDR  K    A+ L +  RG S+    +E+++QLC+Q T N   +    GWEL+ ICL FF P        F ++L  Y C   D   + +  + G               S +  C R  +K  L      +    ++++R A+      +MF SSLEEVM +QK  +P  +LPW+Q  LSEE+   +G +T+GIFR+P ++++++AL   +++                        KI + L+   DP + +S+LK W+R L  PLI  +  +E +       + + + +  LP +N +VL +LI FLQ+ ++  NV  T M V NL  +MAP   +    D +++    +  M  ++ LI   DTS ++ +
Sbjct:  525 RLGFPQALLEKSLSVQTSLASPEPYLHPSQSEDLGACAQFEASRNARNMMPSASCGIFPEFSLRKPSSE---TDIENWASKHFNKHTQGLFRRKVSIANMLAWSSEPIKKPMIVTSDRTVKKEAVEIFKLVQTFMGDRRSKADPLAVALEVVVRGWSNQGLRDELYIQLCRQTTENFRYDSLERGWELMAICLAFFPPTPR-----FHAYLEGYICRHMDPLNDTKGCQCGSDDLIYFVVLGVAISSYAKHCYRKLMKAALTGAKKGLQKPSLEEIRHARNAIFHPSMFGSSLEEVMALQKDRYPDHQLPWVQTRLSEEVLGLNGDQTEGIFRVPGDIDEVNALKLQVDQW-----------------------KIPTGLE---DPHIPASLLKLWYRELEEPLIPHEFYNECIRHYDNPEAAVNV-VLGLPHINKLVLCYLIRFLQVFAQPANVAITKMDVNNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFIRVLIQRLDTSFMDGI 999          

HSP 2 Score: 69.3218 bits (168), Expect = 1.278e-11
Identity = 26/73 (35.62%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  293 VFVNTLSGKCQWNPPDQY--QQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKN 505
            ++ N L+G+C W+PP     ++  ENQWWEL+D  +   YYYN  +++T W +P   +++ L +LQ +K   +
Sbjct:    1 MYANLLTGECVWDPPQGVCIKRTGENQWWELFDPNTSRFYYYNASSQRTVWHRPQGCDIIPLAKLQTLKQHTD 73          
BLAST of rho GTPase-activating protein 39 vs. Ensembl Medaka
Match: arhgap24 (Rho GTPase activating protein 24 [Source:NCBI gene;Acc:101171426])

HSP 1 Score: 56.225 bits (134), Expect = 1.198e-7
Identity = 50/199 (25.13%), Postives = 83/199 (41.71%), Query Frame = 2
Query: 1583 MFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTS---IAKD----YSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSDIQ 2158
            +F   LEE +  +++     KL  + V    +  R  G R +G+FR+P + N +  L  A +   K +                         D   D   ++S+LK + R L  P+I F K +E L     I KD      ++   +  LP +NY +LK++  FL  +     V    M V+NL T+  P + +  I+
Sbjct:  170 IFGQKLEETVRYERRF--GNKLAPMLVEQCVDFIRQWGLREEGLFRLPGQANLVKELQDAFDCGEKPS------------------------FDGNTDVHTVASLLKLYLRELPEPVIPFHKYEEFLACSKLIGKDDEMGVKQLKTLVEGLPPVNYNLLKYISRFLDEVQSYSGV--NKMSVQNLATVFGPNIMRPKIE 340          
BLAST of rho GTPase-activating protein 39 vs. Planmine SMEST
Match: SMESG000029199.1 (SMESG000029199.1)

HSP 1 Score: 1361.67 bits (3523), Expect = 0.000e+0
Identity = 663/667 (99.40%), Postives = 663/667 (99.40%), Query Frame = 2
Query:  233 MNIVINNGWFEIIEPKTKKKVFVNTLSGKCQWNPPDQYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFADKEIQTSLENFEERDQLIINDLSTHSVENIDTSGYSTYKSNSINHTNGEILSNTYDSKANHSNHKESSSTLPATRKFIPRTNPNYTRHSQTLRLSQPVIGLYSDSDIELVLPEQKTYISSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLKIDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSDIQLLQPAMQLLQSLIINWDTSDIENVR 2233
            MNIVINNGWFEIIEPKTKKKVFVNTLSGKCQWNPPDQYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAF DKEIQTSLENFEE DQL INDLSTHSVENIDTSGYSTYKSNSINHTNGEILSNTYDSKANHSNHKESSSTLP TRKFIPRTNPNYTRHSQTLRLSQPVIGLYSDSDIELVLPEQKTYISSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLKIDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSDIQLLQPAMQLLQSLIINWDTSDIENVR
Sbjct:    1 MNIVINNGWFEIIEPKTKKKVFVNTLSGKCQWNPPDQYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFEDKEIQTSLENFEECDQLTINDLSTHSVENIDTSGYSTYKSNSINHTNGEILSNTYDSKANHSNHKESSSTLPVTRKFIPRTNPNYTRHSQTLRLSQPVIGLYSDSDIELVLPEQKTYISSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLINAIDQGTVTNMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLKIDDVRDAKKTYSCLTMFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSDIQLLQPAMQLLQSLIINWDTSDIENVR 667          
BLAST of rho GTPase-activating protein 39 vs. Planmine SMEST
Match: SMESG000060019.1 (SMESG000060019.1)

HSP 1 Score: 159.458 bits (402), Expect = 5.337e-40
Identity = 124/422 (29.38%), Postives = 193/422 (45.73%), Query Frame = 2
Query: 1022 WSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVN-SLKID---------------------------------------DVRDAKKTYSCLTM---FFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAK-DYSKILLKI-TSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSD 2152
            W+  LF K D     L++W   SI   LL  T K  + + C++FKQIQ YMGDR+ K S   LV +I Q+G++     +EIFMQ+CKQ T NP +  T  GWEL+  CL +F P  +     F+ +L  Y       +L+N  + +F +           L  +S++ N ++++D                                       D  D   +  CL +   F  +L+E+M  Q   FP R+LPWI V L EEI+  +G +T+GIFRI ++ + + A+   ++                   CD L +  L+  + EH P   +  +K W   L  PL+        L SI++   ++  L++   L  L+   L +L+ FLQ+LS  +NV    M   NL   +AP +F+ D
Sbjct:  464 WNSELFRK-DQPATKLLNWCKDSIQKPLLVSTDKILKSEACQSFKQIQGYMGDRKSKHSPSELVNSIMQKGLNYYPLRDEIFMQICKQTTNNPDDLSTLRGWELLRTCLSYFAPSPM-----FRPYLEGYVL----RHLDNSHSNEFPTPQQIQQAAEKTLQILSHQTNTTIRMDSNIQFQYQQQQQQQMMMMANMQTMSGQKNHLPLHLFESGDNSDDSASQRCLPLSSHFGYTLDEIMRAQYLRFPERELPWILVTLCEEIWNRNGNQTEGIFRISADSSAVQAMCTVLDL------------------CDNLSDNQLT--NGEHSPHTPACCVKRWLDSLLEPLV-----PPSLCSISQAGRARSPLEVYQCLTRLHQATLMYLVRFLQLLSLDDNVRLNRMGPWNLAVALAPNVFQLD 850          

HSP 2 Score: 53.5286 bits (127), Expect = 6.812e-7
Identity = 29/90 (32.22%), Postives = 46/90 (51.11%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPP------DQYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNK 508
            W E+ EP   + VF++  +G      P      D Y    +  WWEL D KS   YY+N   +QT+W+KP + +++    +Q+  N K+K
Sbjct:   10 WVELHEPFNNQPVFISLSTGITSEKRPLNVDIKDAY----DFDWWELLDSKSNRFYYFNTNNKQTTWIKPQSNSIIPFGNVQI--NSKDK 93          
BLAST of rho GTPase-activating protein 39 vs. Planmine SMEST
Match: SMESG000060019.1 (SMESG000060019.1)

HSP 1 Score: 159.073 bits (401), Expect = 6.671e-40
Identity = 124/422 (29.38%), Postives = 193/422 (45.73%), Query Frame = 2
Query: 1022 WSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVN-SLKID---------------------------------------DVRDAKKTYSCLTM---FFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAK-DYSKILLKI-TSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSD 2152
            W+  LF K D     L++W   SI   LL  T K  + + C++FKQIQ YMGDR+ K S   LV +I Q+G++     +EIFMQ+CKQ T NP +  T  GWEL+  CL +F P  +     F+ +L  Y       +L+N  + +F +           L  +S++ N ++++D                                       D  D   +  CL +   F  +L+E+M  Q   FP R+LPWI V L EEI+  +G +T+GIFRI ++ + + A+   ++                   CD L +  L+  + EH P   +  +K W   L  PL+        L SI++   ++  L++   L  L+   L +L+ FLQ+LS  +NV    M   NL   +AP +F+ D
Sbjct:  447 WNSELFRK-DQPATKLLNWCKDSIQKPLLVSTDKILKSEACQSFKQIQGYMGDRKSKHSPSELVNSIMQKGLNYYPLRDEIFMQICKQTTNNPDDLSTLRGWELLRTCLSYFAPSPM-----FRPYLEGYVL----RHLDNSHSNEFPTPQQIQQAAEKTLQILSHQTNTTIRMDSNIQFQYQQQQQQQMMMMANMQTMSGQKNHLPLHLFESGDNSDDSASQRCLPLSSHFGYTLDEIMRAQYLRFPERELPWILVTLCEEIWNRNGNQTEGIFRISADSSAVQAMCTVLDL------------------CDNLSDNQLT--NGEHSPHTPACCVKRWLDSLLEPLV-----PPSLCSISQAGRARSPLEVYQCLTRLHQATLMYLVRFLQLLSLDDNVRLNRMGPWNLAVALAPNVFQLD 833          

HSP 2 Score: 53.1434 bits (126), Expect = 7.764e-7
Identity = 29/90 (32.22%), Postives = 46/90 (51.11%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPP------DQYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNK 508
            W E+ EP   + VF++  +G      P      D Y    +  WWEL D KS   YY+N   +QT+W+KP + +++    +Q+  N K+K
Sbjct:   10 WVELHEPFNNQPVFISLSTGITSEKRPLNVDIKDAY----DFDWWELLDSKSNRFYYFNTNNKQTTWIKPQSNSIIPFGNVQI--NSKDK 93          
BLAST of rho GTPase-activating protein 39 vs. Planmine SMEST
Match: SMESG000060019.1 (SMESG000060019.1)

HSP 1 Score: 159.458 bits (402), Expect = 6.698e-40
Identity = 124/422 (29.38%), Postives = 193/422 (45.73%), Query Frame = 2
Query: 1022 WSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKLNLENLEAGDFKSRSIFCSRISLKLLDMSNKVN-SLKID---------------------------------------DVRDAKKTYSCLTM---FFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSEVNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPLLLSSILKNWFRHLHTPLIYFDKSDEPLTSIAK-DYSKILLKI-TSLPELNYMVLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSD 2152
            W+  LF K D     L++W   SI   LL  T K  + + C++FKQIQ YMGDR+ K S   LV +I Q+G++     +EIFMQ+CKQ T NP +  T  GWEL+  CL +F P  +     F+ +L  Y       +L+N  + +F +           L  +S++ N ++++D                                       D  D   +  CL +   F  +L+E+M  Q   FP R+LPWI V L EEI+  +G +T+GIFRI ++ + + A+   ++                   CD L +  L+  + EH P   +  +K W   L  PL+        L SI++   ++  L++   L  L+   L +L+ FLQ+LS  +NV    M   NL   +AP +F+ D
Sbjct:  459 WNSELFRK-DQPATKLLNWCKDSIQKPLLVSTDKILKSEACQSFKQIQGYMGDRKSKHSPSELVNSIMQKGLNYYPLRDEIFMQICKQTTNNPDDLSTLRGWELLRTCLSYFAPSPM-----FRPYLEGYVL----RHLDNSHSNEFPTPQQIQQAAEKTLQILSHQTNTTIRMDSNIQFQYQQQQQQQMMMMANMQTMSGQKNHLPLHLFESGDNSDDSASQRCLPLSSHFGYTLDEIMRAQYLRFPERELPWILVTLCEEIWNRNGNQTEGIFRISADSSAVQAMCTVLDL------------------CDNLSDNQLT--NGEHSPHTPACCVKRWLDSLLEPLV-----PPSLCSISQAGRARSPLEVYQCLTRLHQATLMYLVRFLQLLSLDDNVRLNRMGPWNLAVALAPNVFQLD 845          

HSP 2 Score: 53.5286 bits (127), Expect = 7.469e-7
Identity = 29/90 (32.22%), Postives = 46/90 (51.11%), Query Frame = 2
Query:  257 WFEIIEPKTKKKVFVNTLSGKCQWNPP------DQYQQILENQWWELYDFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNK 508
            W E+ EP   + VF++  +G      P      D Y    +  WWEL D KS   YY+N   +QT+W+KP + +++    +Q+  N K+K
Sbjct:   10 WVELHEPFNNQPVFISLSTGITSEKRPLNVDIKDAY----DFDWWELLDSKSNRFYYFNTNNKQTTWIKPQSNSIIPFGNVQI--NSKDK 93          
BLAST of rho GTPase-activating protein 39 vs. Planmine SMEST
Match: SMESG000064837.1 (SMESG000064837.1)

HSP 1 Score: 67.781 bits (164), Expect = 3.106e-11
Identity = 37/101 (36.63%), Postives = 54/101 (53.47%), Query Frame = 2
Query: 1076 WTSKSISDSLLALTPKAYRKKVCENFKQIQMYMGDREFKLSKDALVLAICQRGIS-SSFWANEIFMQLCKQVTYNPHNERTFYGWELICICLKFFHPESVE 1375
            WT +S+   +L    K   K   ++FK IQ YMGDR  + S   L+ A+ Q  +S      +E+ +Q+CKQ   NP    +  GWEL+  CL  F PES++
Sbjct:  213 WTRQSLKQPILNYVQKGQGKNAIKSFKVIQKYMGDRRTRKSPSQLI-ALLQSYVSFHEALKDEVLIQICKQTIKNPDCRSSCRGWELLSECLLQFSPESLD 312          
The following BLAST results are available for this feature:
BLAST of rho GTPase-activating protein 39 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGAP396.804e-5429.38Rho GTPase activating protein 39 [Source:HGNC Symb... [more]
ARHGAP394.306e-5128.27Rho GTPase activating protein 39 [Source:HGNC Symb... [more]
ARHGAP403.620e-726.75Rho GTPase activating protein 40 [Source:HGNC Symb... [more]
ARHGAP403.720e-726.75Rho GTPase activating protein 40 [Source:HGNC Symb... [more]
ARHGAP222.135e-624.12Rho GTPase activating protein 22 [Source:HGNC Symb... [more]
back to top
BLAST of rho GTPase-activating protein 39 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y92H12BL.47.544e-2025.70pep chromosome:WBcel235:I:1376942:1385057:-1 gene:... [more]
Y92H12BM.12.516e-1630.28pep chromosome:WBcel235:I:1385937:1392759:-1 gene:... [more]
Y92H12BM.12.516e-1630.28pep chromosome:WBcel235:I:1385818:1392759:-1 gene:... [more]
back to top
BLAST of rho GTPase-activating protein 39 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RhoGAP93B5.138e-4428.34gene:FBgn0038853 transcript:FBtr0084036[more]
back to top
BLAST of rho GTPase-activating protein 39 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:921071.430e-4929.84zgc:92107 [Source:ZFIN;Acc:ZDB-GENE-041114-4][more]
zgc:921072.099e-4929.84zgc:92107 [Source:ZFIN;Acc:ZDB-GENE-041114-4][more]
zgc:921072.099e-4929.84zgc:92107 [Source:ZFIN;Acc:ZDB-GENE-041114-4][more]
arhgap398.492e-4927.77Rho GTPase activating protein 39 [Source:ZFIN;Acc:... [more]
arhgap391.281e-4527.06Rho GTPase activating protein 39 [Source:ZFIN;Acc:... [more]
back to top
BLAST of rho GTPase-activating protein 39 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrmda4.633e-5027.80leucine rich melanocyte differentiation associated... [more]
lrmda5.868e-5027.80leucine rich melanocyte differentiation associated... [more]
gpr1803.163e-2034.41G protein-coupled receptor 180 [Source:Xenbase;Acc... [more]
ARHGAP243.187e-723.36Rho GTPase activating protein 24 [Source:NCBI gene... [more]
ARHGAP403.588e-630.05Rho GTPase activating protein 40 [Source:NCBI gene... [more]
back to top
BLAST of rho GTPase-activating protein 39 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arhgap398.662e-5530.08Rho GTPase activating protein 39 [Source:MGI Symbo... [more]
Arhgap399.376e-5530.08Rho GTPase activating protein 39 [Source:MGI Symbo... [more]
Arhgap396.788e-5228.91Rho GTPase activating protein 39 [Source:MGI Symbo... [more]
Arhgap397.878e-5228.91Rho GTPase activating protein 39 [Source:MGI Symbo... [more]
Arhgap391.039e-1737.04Rho GTPase activating protein 39 [Source:MGI Symbo... [more]
back to top
BLAST of rho GTPase-activating protein 39 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9C0H5|RHG39_HUMAN3.268e-5329.38Rho GTPase-activating protein 39 OS=Homo sapiens O... [more]
sp|P59281|RHG39_MOUSE4.748e-5128.91Rho GTPase-activating protein 39 OS=Mus musculus O... [more]
sp|Q54QF4|MGP4_DICDI2.181e-1027.27Mental retardation GTPase activating protein homol... [more]
sp|P47808|MYSH_ACACA4.019e-930.43High molecular weight form of myosin-1 OS=Acantham... [more]
sp|Q55GP8|GACO_DICDI4.660e-828.43Rho GTPase-activating protein gacO OS=Dictyosteliu... [more]
back to top
BLAST of rho GTPase-activating protein 39 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W2W6J81.266e-6826.58rho GTPase-activating protein 39 OS=Ciona intestin... [more]
A0A151NWN89.473e-6728.26Rho GTPase-activating protein 39-like isoform B OS... [more]
A0A151NW292.888e-6427.57Rho GTPase-activating protein 39-like isoform A OS... [more]
A0A1I8A5621.097e-6227.47Uncharacterized protein OS=Steinernema glaseri OX=... [more]
A0A1A7WEE29.025e-5529.31Rho GTPase activating protein 39 OS=Iconisemion st... [more]
back to top
BLAST of rho GTPase-activating protein 39 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgap391.095e-4627.57Rho GTPase activating protein 39 [Source:ZFIN;Acc:... [more]
zgc:921075.660e-4529.75zgc:92107 [Source:ZFIN;Acc:ZDB-GENE-041114-4][more]
si:ch211-218g4.21.462e-4427.53rho GTPase-activating protein 39-like [Source:NCBI... [more]
si:ch211-218g4.21.595e-4427.53rho GTPase-activating protein 39-like [Source:NCBI... [more]
arhgap251.299e-825.50Rho GTPase activating protein 25 [Source:ZFIN;Acc:... [more]
back to top
BLAST of rho GTPase-activating protein 39 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
arhgap392.846e-4030.48Rho GTPase activating protein 39 [Source:ZFIN;Acc:... [more]
arhgap182.882e-727.35Rho GTPase activating protein 18 [Source:ZFIN;Acc:... [more]
back to top
BLAST of rho GTPase-activating protein 39 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of rho GTPase-activating protein 39 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO357824.593e-2831.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357832.755e-2032.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357843.408e-1941.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of rho GTPase-activating protein 39 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgap392.062e-5128.63Rho GTPase activating protein 39 [Source:NCBI gene... [more]
zgc:921072.342e-5129.96rho GTPase-activating protein 39 [Source:NCBI gene... [more]
zgc:921072.247e-5029.54rho GTPase-activating protein 39 [Source:NCBI gene... [more]
arhgap394.084e-5028.04Rho GTPase activating protein 39 [Source:NCBI gene... [more]
arhgap241.198e-725.13Rho GTPase activating protein 24 [Source:NCBI gene... [more]
back to top
BLAST of rho GTPase-activating protein 39 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029199.10.000e+099.40SMESG000029199.1[more]
SMESG000060019.15.337e-4029.38SMESG000060019.1[more]
SMESG000060019.16.671e-4029.38SMESG000060019.1[more]
SMESG000060019.16.698e-4029.38SMESG000060019.1[more]
SMESG000064837.13.106e-1136.63SMESG000064837.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028609 ID=SMED30028609|Name=rho GTPase-activating protein 39|organism=Schmidtea mediterranea sexual|type=transcript|length=2446bp
TATTTAAAATTTATTAAAATTATGAAGATTTGCATTTTGGATTATGCAAT
GGATTTACATGTTTTAAAAGTCAATATTCCACTTTAGTGTTTTCTATTAT
TTATAATAAATATTCTATTTTTCTGTATATAATCATATTTTCCCTGTGTC
TCATTTTTATATAATTTAGTTACTATAAACGAATATTTCCTTATTTTTAG
CGTTGGAATTAATAAGCAAGGAACTTTTATTAATGAATATTGTTATAAAT
AACGGTTGGTTTGAAATAATTGAACCTAAGACTAAAAAAAAGGTTTTCGT
CAATACATTATCTGGAAAATGTCAATGGAATCCTCCAGATCAATATCAGC
AAATATTAGAAAATCAGTGGTGGGAACTTTATGATTTCAAATCTTGTCAT
TTGTATTATTATAATGTCCAAACAAGACAAACGTCATGGCTCAAACCAAG
TACTACTAATTTGGTATCCCTTGTGCAATTACAGGTTATCAAAAACCAAA
AGAATAAAGCATTTGCGGACAAAGAAATTCAAACCAGTCTAGAAAATTTT
GAGGAACGTGATCAGCTAATAATAAATGACTTGAGTACGCATTCTGTTGA
GAATATTGACACGTCTGGTTACAGTACTTACAAAAGCAATTCAATCAATC
ATACAAATGGTGAAATATTAAGCAATACGTATGATTCTAAAGCAAATCAT
TCAAATCACAAAGAATCTTCCTCAACTTTACCAGCGACTCGTAAATTTAT
TCCCAGAACGAATCCGAATTACACTCGTCATTCTCAAACGTTACGACTGA
GTCAACCAGTAATCGGCCTTTATAGTGATTCAGATATCGAATTAGTTCTT
CCAGAACAAAAAACTTATATATCTTCTAAAAGTGTCGATGAAGATGAAAA
TAAAGAGTTCAATAATTCACTTCAATTATCAACAAATAAAATATCTTTTG
ATAGCAATAACTTTCCGCGGCATTCTCTTATTAATGCAATTGATCAAGGA
ACAGTCACAAATATGGAAATTTGGTCTCGAAATCTGTTTAACAAATCAGA
TAGTCAGTTGGCTGGATTAATGTCGTGGACATCGAAATCAATATCCGACT
CATTGTTAGCTTTGACGCCGAAGGCTTACAGGAAAAAAGTCTGCGAAAAT
TTTAAGCAAATACAGATGTATATGGGCGATCGAGAGTTTAAATTAAGTAA
AGACGCTTTAGTTCTCGCTATATGCCAAAGAGGAATATCAAGTTCATTTT
GGGCTAATGAAATCTTCATGCAGCTATGTAAGCAAGTTACTTACAATCCT
CACAATGAGCGAACCTTTTACGGCTGGGAATTAATATGCATTTGTTTGAA
ATTTTTTCATCCTGAATCTGTAGAAATGCAAAATTGTTTCAAATCCTTTT
TGATTCAATATTCGTGTTTTGATCAGAAATTAAATTTAGAAAATCTTGAA
GCCGGTGATTTCAAATCGAGGTCGATTTTTTGCAGCAGAATATCTTTAAA
ACTTTTAGATATGTCAAATAAAGTCAATAGTTTAAAAATAGATGATGTTC
GGGATGCAAAGAAAACATATAGTTGTTTGACAATGTTTTTCAGTTCTTTG
GAAGAGGTTATGGAAATACAGAAAAAATTATTTCCAAGCAGAAAATTGCC
TTGGATACAAGTTGCTTTATCGGAGGAAATCTTTCGCTGTGATGGGTGTA
GAACTCAAGGAATATTCAGAATACCTTCAGAAGTCAATAAAATTGACGCT
CTTACTCAAGCCATTGAAAAAGCTTTTAAATCAAATTCGATTCAAGATAT
AAATTTTTTGCATAGTTCAAATGGTTGTGATCCCCTTTTGAATAAAATAT
TATCTGATTTGGATATGGAACATGATCCTTTATTATTATCCAGTATTCTC
AAAAATTGGTTTCGGCATTTGCATACTCCTCTTATATATTTCGATAAATC
AGATGAACCACTGACTTCAATTGCGAAAGATTATTCAAAAATCCTCCTGA
AGATAACTTCACTTCCTGAGCTGAATTATATGGTCTTGAAACATTTAATT
CACTTTCTACAGATTTTAAGTAAACAAGAAAATGTCCCTTATACAAACAT
GCCTGTGGAAAATCTGGTGACTTTAATGGCACCAACTCTTTTCAAATCAG
ATATTCAACTTTTACAACCGGCAATGCAACTTTTACAGAGTCTGATTATT
AATTGGGACACTTCTGATATTGAGAATGTTCGATAGAAAATCTGTGTTTT
AATATTTCTATTCAATTGTTTGAATTTTATTGTGATTTGAATTCTATATT
TATATGTAGCACTTTCGAAACGCTTGAACAACACACGTAAGGCGGCATGT
TTAGAGCAATGTTGTGAACATTTTTTTGTATTTATCATACATTTGCAGTT
ATTTTGATTGTAACATAATAATAAATTTTGTTATCTTTAAAAAAAA
back to top

protein sequence of SMED30028609-orf-1

>SMED30028609-orf-1 ID=SMED30028609-orf-1|Name=SMED30028609-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=668bp
MNIVINNGWFEIIEPKTKKKVFVNTLSGKCQWNPPDQYQQILENQWWELY
DFKSCHLYYYNVQTRQTSWLKPSTTNLVSLVQLQVIKNQKNKAFADKEIQ
TSLENFEERDQLIINDLSTHSVENIDTSGYSTYKSNSINHTNGEILSNTY
DSKANHSNHKESSSTLPATRKFIPRTNPNYTRHSQTLRLSQPVIGLYSDS
DIELVLPEQKTYISSKSVDEDENKEFNNSLQLSTNKISFDSNNFPRHSLI
NAIDQGTVTNMEIWSRNLFNKSDSQLAGLMSWTSKSISDSLLALTPKAYR
KKVCENFKQIQMYMGDREFKLSKDALVLAICQRGISSSFWANEIFMQLCK
QVTYNPHNERTFYGWELICICLKFFHPESVEMQNCFKSFLIQYSCFDQKL
NLENLEAGDFKSRSIFCSRISLKLLDMSNKVNSLKIDDVRDAKKTYSCLT
MFFSSLEEVMEIQKKLFPSRKLPWIQVALSEEIFRCDGCRTQGIFRIPSE
VNKIDALTQAIEKAFKSNSIQDINFLHSSNGCDPLLNKILSDLDMEHDPL
LLSSILKNWFRHLHTPLIYFDKSDEPLTSIAKDYSKILLKITSLPELNYM
VLKHLIHFLQILSKQENVPYTNMPVENLVTLMAPTLFKSDIQLLQPAMQL
LQSLIINWDTSDIENVR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR038185MyTH4_dom_sf
IPR036020WW_dom_sf
IPR000198RhoGAP_dom
IPR001202WW_dom
IPR000857MyTH4_dom
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000857MyTH4 domainSMARTSM00139MyTH4_1coord: 282..409
e-value: 6.6E-5
score: 2.2
IPR000857MyTH4 domainPFAMPF00784MyTH4coord: 326..393
e-value: 1.8E-12
score: 47.7
IPR000857MyTH4 domainPROSITEPS51016MYTH4coord: 282..426
score: 23.494
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 470..659
e-value: 3.6E-7
score: 39.8
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 473..640
e-value: 1.6E-19
score: 70.3
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 454..662
score: 22.057
IPR001202WW domainSMARTSM00456ww_5coord: 41..74
e-value: 0.64
score: 18.2
coord: 4..37
e-value: 0.033
score: 23.3
IPR001202WW domainPROSITEPS01159WW_DOMAIN_1coord: 46..72
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 3..37
score: 8.867
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 40..74
score: 11.566
IPR001202WW domainCDDcd00201WWcoord: 58..72
e-value: 0.00202253
score: 34.0406
NoneNo IPR availableGENE3DG3DSA:2.20.70.10coord: 5..74
e-value: 1.3E-6
score: 30.4
NoneNo IPR availablePANTHERPTHR45876FAMILY NOT NAMEDcoord: 547..666
NoneNo IPR availablePANTHERPTHR45876:SF8FI04035Pcoord: 547..666
coord: 8..513
NoneNo IPR availablePANTHERPTHR45876FAMILY NOT NAMEDcoord: 8..513
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 414..664
e-value: 8.5E-27
score: 95.8
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 451..659
IPR038185MyTH4 domain superfamilyGENE3DG3DSA:1.25.40.530coord: 248..413
e-value: 1.5E-15
score: 59.6
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 40..73