Ornithine carbamoyltransferase

Overview
NameOrnithine carbamoyltransferase
Smed IDSMED30028596
Length (bp)1780
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ornithine carbamoyltransferase (SMED30028596) t-SNE clustered cells

Violin plots show distribution of expression levels for Ornithine carbamoyltransferase (SMED30028596) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ornithine carbamoyltransferase (SMED30028596) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ornithine carbamoyltransferase (SMED30028596) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028596

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30028596SMESG000040441.1 SMESG000035784.1 SmedASXL_005475SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30028596SMESG000040441.1 SMESG000035784.1 dd_Smed_v4_3906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028596SMESG000040441.1 SMESG000035784.1 dd_Smed_v4_3906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30028596SMESG000040441.1 SMESG000035784.1 dd_Smed_v4_3906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028596SMESG000040441.1 SMESG000035784.1 dd_Smed_v4_3906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028596SMESG000040441.1 SMESG000035784.1 dd_Smed_v4_3906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028596SMESG000005752.1 Contig4817GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028596SMESG000040441.1 SMESG000035784.1 Contig41109uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028596SMESG000040441.1 SMESG000035784.1 Contig41109newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028596SMESG000040441.1 SMESG000035784.1 Contig4817GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ornithine carbamoyltransferase vs. Ensembl Human
Match: OTC (ornithine carbamoyltransferase [Source:HGNC Symbol;Acc:HGNC:8512])

HSP 1 Score: 392.889 bits (1008), Expect = 1.692e-132
Identity = 188/353 (53.26%), Postives = 250/353 (70.82%), Query Frame = 1
Query:  106 NWNCTKITSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            N+ C +   N   Q  G+D LTLK+F+ +EI +++W +ADLK R K   E +                     L GKS+ MIF+K STRTRLS ETGFAL+G HPCFL++QDIHLG NE++ DTA+VLS   DA+LARVY+  DL+TLA  AS+P+INGLS+ YHP+Q+LAD LTLQEHY  +KGL ++WIGDG NN+ HS +++  K G++L+ A+PK YEPD++V     +  ++N  KL+LT +P+EA H   V++TDT++SMG+E E   RL+ F GYQV      +A+ +W FLHCLPRKP+EV DEVFY   RSLV+ EAENRKWT+MAV+V+LL+DY+PQL KP F
Sbjct:   24 NFRCGQPLQNKV-QLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYL-------------------PLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDG-NNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSP-RSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF 354          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Human
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:HGNC Symbol;Acc:HGNC:1424])

HSP 1 Score: 88.5817 bits (218), Expect = 1.534e-17
Identity = 88/339 (25.96%), Postives = 148/339 (43.66%), Query Frame = 1
Query:  127 TSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDY 1137
            TS   H  VG+  L+++ F+KD++ HL   A  L  R  + KE                  LD   L GK +A +F ++STRT  S     A +G      S     + K E++ D+ + +S + D ++ R  +   +   A +   PVIN G     HP Q L DI T++E  G V G+ +  +GD  +  T HS      +  ++L+  +P S      V    R        K     +  EA+ +++V+   T +   R          F  + +  ++++ A      +H +PR  +E+S EV  D  R+  + +AEN  +  MA+L  +L  +
Sbjct: 1851 TSPLLHSLVGQHILSVQQFTKDQMSHLFNVAHTL--RMMVQKER----------------SLDI--LKGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLRMPPTV----RAFVASRGTKQEEFESIEEALPDTDVLYM-TRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRV-NEISVEVDSDP-RAAYFRQAENGMYIRMALLATVLGRF 2162          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Human
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:HGNC Symbol;Acc:HGNC:1424])

HSP 1 Score: 88.5817 bits (218), Expect = 1.543e-17
Identity = 88/339 (25.96%), Postives = 148/339 (43.66%), Query Frame = 1
Query:  127 TSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDY 1137
            TS   H  VG+  L+++ F+KD++ HL   A  L  R  + KE                  LD   L GK +A +F ++STRT  S     A +G      S     + K E++ D+ + +S + D ++ R  +   +   A +   PVIN G     HP Q L DI T++E  G V G+ +  +GD  +  T HS      +  ++L+  +P S      V    R        K     +  EA+ +++V+   T +   R          F  + +  ++++ A      +H +PR  +E+S EV  D  R+  + +AEN  +  MA+L  +L  +
Sbjct: 1914 TSPLLHSLVGQHILSVQQFTKDQMSHLFNVAHTL--RMMVQKER----------------SLDI--LKGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLRMPPTV----RAFVASRGTKQEEFESIEEALPDTDVLYM-TRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRV-NEISVEVDSDP-RAAYFRQAENGMYIRMALLATVLGRF 2225          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Human
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:HGNC Symbol;Acc:HGNC:1424])

HSP 1 Score: 71.2478 bits (173), Expect = 6.031e-13
Identity = 73/298 (24.50%), Postives = 126/298 (42.28%), Query Frame = 1
Query:  343 AMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNP-VEA----VHNSEVVVTDT--FVSMGRETEN------------LIRLRD------------FTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDY 1137
            A +F ++STRT  S     A +G      S     + K E++ D+ + +S + D ++ R  +   +   A +   PVIN G     HP Q L DI T++E  G V G+ +  +GD  +  T HS      +  ++L+  +P S      V    R        K V  + P +EA    V  SE     T   +++  E E+            + R++             F  + +  ++++ A      +H +PR  +E+S EV  D  R+  + +AEN  +  MA+L  +L  +
Sbjct:    2 ASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLRMPPTV----RAFVASRGTKQVRPSQPCLEAMEMWVGQSEPSAASTMALLTLQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRV-NEISVEVDSDP-RAAYFRQAENGMYIRMALLATVLGRF 293          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Human
Match: OTC (ornithine carbamoyltransferase [Source:HGNC Symbol;Acc:HGNC:8512])

HSP 1 Score: 66.2402 bits (160), Expect = 2.026e-12
Identity = 39/97 (40.21%), Postives = 52/97 (53.61%), Query Frame = 1
Query:  106 NWNCTKITSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETG 396
            N+ C +   N   Q  G+D LTLK+F+ +EI +++W +ADLK R K   E +                     L GKS+ MIF+K STRTRLS ETG
Sbjct:   24 NFRCGQPLQNKV-QLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYL-------------------PLLQGKSLGMIFEKRSTRTRLSTETG 100          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Celegans
Match: pyr-1 (CAD protein Glutamine-dependent carbamoyl-phosphate synthase Aspartate carbamoyltransferase Dihydroorotase [Source:UniProtKB/Swiss-Prot;Acc:Q18990])

HSP 1 Score: 75.8702 bits (185), Expect = 5.633e-14
Identity = 89/343 (25.95%), Postives = 152/343 (44.31%), Query Frame = 1
Query:  145 QFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNS-YHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYI-VACGKLGLNLKIASPKS-YEPDSNVVNY---GRELFEKNNCKLVLTTNPVEAVHNSEV-----VVTDTFVSMGRETENLIRLRDFTGYQVDK--NLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLS 1131
            + + K+ +++K   K +I  +     +L  RYK + E    L  I               LNGK +  +F ++STRT  S       +G     + SQ   + K ET+EDT +VL  + D ++ R  E+   +  A     PVING   +  HP Q L D+ T+++  G V GL +A +GD  N  T HS   + C    + L   +P +  E    V++Y        +K    L    N V+ V+ + +        D +  +        +L +     V++  +L+  A      +H LPR  DE++ E+ +D+ R+  + +A+N  +  M++L  LL 
Sbjct: 1873 ELLAKNCISVKHLDKGQINRIF----ELADRYKHDVEKGHPLTHI---------------LNGKVLVNLFYEVSTRTSCSFSAAMQRLGGSVISVDSQSSSVQKGETLEDTVQVLGSYGDILVLRSNENGAADRAARVCDQPVINGGDGTGEHPTQALLDVYTIRQEMGTVNGLTIALVGDLKNGRTVHSLAKLLCLYKDITLHYVAPSTELEMPQEVLDYVSSKSNFVQKKFTSLAEGINHVDVVYVTRIQKERFSSPDEYNKVKGSYVINAKLLNEAARDVEEPSSLLVPARSLPIVMHPLPRV-DEIAVELDHDE-RAAYFRQAKNGVFVRMSILSLLLG 2194          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Fly
Match: r (gene:FBgn0003189 transcript:FBtr0089734)

HSP 1 Score: 83.5741 bits (205), Expect = 3.420e-16
Identity = 85/334 (25.45%), Postives = 146/334 (43.71%), Query Frame = 1
Query:  142 HQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRET-ENLIRLRDFTGYQV-DKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLS 1131
            H  +GK  L +  F+KD +  +   A  LK R   ++ V                    + L GK +A +F ++STRT+ S       +G     + +    + K E++ED+ KV+S + D ++ R      +   AT++  P+IN G     HP Q L DI T++E +G V GL +  +GD  N  T HS         +NL+  +P S +    VV +      +   K +   +    + +++V+       + RE  +N+       G+ V     +  A      LH LPR  +E+S E+  D  R+  + +AE   +  MA+L  ++ 
Sbjct: 1913 HSLMGKHILAVDMFNKDHLNDIFNLAQLLKLRGTKDRPVD-------------------ELLPGKIMASVFYEVSTRTQCSFAAAMLRLGGRVISMDNITSSVKKGESLEDSIKVVSSYADVVVLRHPSPGAVARAATFSRKPLINAGDGVGEHPTQALLDIFTIREEFGTVNGLTITMVGDLKNGRTVHSLARLLTLYNVNLQYVAPNSLQMPDEVVQF----VHQRGVKQLFARDLKNVLPDTDVLY---MTRIQRERFDNVEDYEKCCGHLVLTPEHMMRAKKRSIVLHPLPRL-NEISREIDSDP-RAAYFRQAEYGMYIRMALLAMVVG 2218          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Fly
Match: r (gene:FBgn0003189 transcript:FBtr0340156)

HSP 1 Score: 83.5741 bits (205), Expect = 3.420e-16
Identity = 85/334 (25.45%), Postives = 146/334 (43.71%), Query Frame = 1
Query:  142 HQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRET-ENLIRLRDFTGYQV-DKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLS 1131
            H  +GK  L +  F+KD +  +   A  LK R   ++ V                    + L GK +A +F ++STRT+ S       +G     + +    + K E++ED+ KV+S + D ++ R      +   AT++  P+IN G     HP Q L DI T++E +G V GL +  +GD  N  T HS         +NL+  +P S +    VV +      +   K +   +    + +++V+       + RE  +N+       G+ V     +  A      LH LPR  +E+S E+  D  R+  + +AE   +  MA+L  ++ 
Sbjct: 1913 HSLMGKHILAVDMFNKDHLNDIFNLAQLLKLRGTKDRPVD-------------------ELLPGKIMASVFYEVSTRTQCSFAAAMLRLGGRVISMDNITSSVKKGESLEDSIKVVSSYADVVVLRHPSPGAVARAATFSRKPLINAGDGVGEHPTQALLDIFTIREEFGTVNGLTITMVGDLKNGRTVHSLARLLTLYNVNLQYVAPNSLQMPDEVVQF----VHQRGVKQLFARDLKNVLPDTDVLY---MTRIQRERFDNVEDYEKCCGHLVLTPEHMMRAKKRSIVLHPLPRL-NEISREIDSDP-RAAYFRQAEYGMYIRMALLAMVVG 2218          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Fly
Match: r (gene:FBgn0003189 transcript:FBtr0340155)

HSP 1 Score: 83.5741 bits (205), Expect = 3.420e-16
Identity = 85/334 (25.45%), Postives = 146/334 (43.71%), Query Frame = 1
Query:  142 HQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRET-ENLIRLRDFTGYQV-DKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLS 1131
            H  +GK  L +  F+KD +  +   A  LK R   ++ V                    + L GK +A +F ++STRT+ S       +G     + +    + K E++ED+ KV+S + D ++ R      +   AT++  P+IN G     HP Q L DI T++E +G V GL +  +GD  N  T HS         +NL+  +P S +    VV +      +   K +   +    + +++V+       + RE  +N+       G+ V     +  A      LH LPR  +E+S E+  D  R+  + +AE   +  MA+L  ++ 
Sbjct: 1913 HSLMGKHILAVDMFNKDHLNDIFNLAQLLKLRGTKDRPVD-------------------ELLPGKIMASVFYEVSTRTQCSFAAAMLRLGGRVISMDNITSSVKKGESLEDSIKVVSSYADVVVLRHPSPGAVARAATFSRKPLINAGDGVGEHPTQALLDIFTIREEFGTVNGLTITMVGDLKNGRTVHSLARLLTLYNVNLQYVAPNSLQMPDEVVQF----VHQRGVKQLFARDLKNVLPDTDVLY---MTRIQRERFDNVEDYEKCCGHLVLTPEHMMRAKKRSIVLHPLPRL-NEISREIDSDP-RAAYFRQAEYGMYIRMALLAMVVG 2218          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Zebrafish
Match: otc (ornithine carbamoyltransferase [Source:ZFIN;Acc:ZDB-GENE-070912-422])

HSP 1 Score: 381.333 bits (978), Expect = 2.943e-128
Identity = 187/360 (51.94%), Postives = 249/360 (69.17%), Query Frame = 1
Query:   73 AIKITKLLSGFNWNCTKITSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLP 1152
            ++   K     N++  K T ++ +   G+ FLTLKD++ +EI H++W +ADLK R K   E             HL        L GKSIAMIF+K STRTR+S ETGF+L+G HPCFL+ QDIHLG NE   DTA+VLS   D +LARVY H  L  L    S+PVINGLS+ YHP+Q+LAD+LTLQEHYG +KG  + WIGDGNN + HS++++  KLG+NLK+A+PK YEPD+ V    + L ++   +L   ++PVEA  +S V+VTDT+VSMG+E E   RL+DF+GYQ+     S+A+P+W FLHCLPRKP+EV DEVFY + RSLV+ EAENRKWT+M ++V +L+DY PQ+P
Sbjct:   11 SLGFAKCCQSRNFSVGKATLDSVN-LKGRSFLTLKDYNAEEIKHILWVSADLKHRIKHRGE-------------HLPL------LQGKSIAMIFEKRSTRTRMSTETGFSLLGGHPCFLTPQDIHLGVNECTTDTARVLSGLADIVLARVYNHSSLEHLDKDTSIPVINGLSDLYHPIQILADLLTLQEHYGSLKGRTLTWIGDGNNVL-HSFMMSLAKLGVNLKVATPKGYEPDAAVTEEAQRLAKQFGTRLQFVSDPVEAARDSSVLVTDTWVSMGQEEEKKKRLKDFSGYQITIQTGSVAAPDWTFLHCLPRKPEEVDDEVFYSQ-RSLVFEEAENRKWTIMGLMVCILTDYRPQIP 348          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Zebrafish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 87.4261 bits (215), Expect = 2.372e-17
Identity = 88/341 (25.81%), Postives = 151/341 (44.28%), Query Frame = 1
Query:  127 TSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNY----GRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLS 1131
            TS   H  VG+  L+++ FSK+++ HL   A  L  R  + KE                  LD   L GK +A +F ++STRT  S       +G              K E++ D+   +S + D I+ R      + + A +   PVIN G     HP Q L DI T++E  G V G+ +  +GD  +  T HS      +  + L+  +PK+    + ++++    G +  E N+ +        EA+ +++V+   T +   R +        F  + +  ++++ A      +H LPR  +E+S EV  D  R+  + +AEN  +  MA+L  +L 
Sbjct: 1920 TSPLLHPLVGQHILSVRQFSKEQMSHLFNVAHTL--RLMVQKE----------------RPLDI--LKGKVMASMFYEVSTRTSSSFAAAMHRLGGSVVHFCESTSSTQKGESLVDSVNTMSCYADVIVLRHPIPGAVESAARHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLARLLTQYRITLRYVAPKNLSMPAEIIDFVASKGIKQEEFNSIE--------EALPDTDVLYM-TRIQKERFSSEKEYNACFGQFILTPHIMTGAKRKMVVMHPLPRV-NEISVEVDTDP-RAAYFRQAENGMYIRMALLATVLG 2229          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Zebrafish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 60.4622 bits (145), Expect = 3.043e-9
Identity = 50/172 (29.07%), Postives = 74/172 (43.02%), Query Frame = 1
Query:  127 TSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQE 639
            TS   H  VG+  L+++ FSK+++ HL   A  L  R  + KE                  LD   L GK +A +F ++STRT  S       +G              K E++ D+   +S + D I+ R      + + A +   PVIN G     HP Q L DI T++E
Sbjct:  332 TSPLLHPLVGQHILSVRQFSKEQMSHLFNVAHTL--RLMVQKE----------------RPLDI--LKGKVMASMFYEVSTRTSSSFAAAMHRLGGSVVHFCESTSSTQKGESLVDSVNTMSCYADVIVLRHPIPGAVESAARHCRRPVINAGDGVGEHPTQALLDIFTIRE 483          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Xenopus
Match: otc (ornithine carbamoyltransferase [Source:NCBI gene;Acc:448273])

HSP 1 Score: 390.193 bits (1001), Expect = 1.291e-131
Identity = 189/357 (52.94%), Postives = 251/357 (70.31%), Query Frame = 1
Query:  112 NCTKITSNAFH------QFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            N +K T + F       Q  G++ LTLK ++ +EI +L+W AADLK R K   E +                     L GKS+AMIF+K STRTRLS ETGFAL+G HPCFL++QDIHLG NE+++DTA+VLS   DA+LARVY   DL+ LA  A++P++NGLS+ YHP+Q+LAD LTLQEHYGH+ GL ++WIGDGNN + +S +++  K G+NL+IA+PK YEPDS+V++   +  +++   L +T  P+EA   + V+VTDT+VSMG+E E   RL+DF GYQ+      +ASP+W FLHCLPRKP+EV D VFY   +SLV+ EAENRKWT+MAV+V LL+DY PQLPKP F
Sbjct:   16 NASKCTVHHFRSSHCNVQLKGRNLLTLKHYTAEEIQYLLWVAADLKYRIKQKGEYV-------------------PVLQGKSLAMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLKDTARVLSGMTDAVLARVYRQTDLDLLAKEATIPIVNGLSDMYHPIQILADFLTLQEHYGHLNGLTISWIGDGNNVL-NSIMMSAAKFGMNLRIATPKGYEPDSSVISAAEQFSKESGTPLFMTNEPLEAATGANVLVTDTWVSMGKEEEKKKRLKDFKGYQITMQTGKVASPDWTFLHCLPRKPEEVDDAVFYSP-KSLVFPEAENRKWTIMAVMVALLTDYIPQLPKPTF 351          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Xenopus
Match: otc (ornithine carbamoyltransferase [Source:NCBI gene;Acc:448273])

HSP 1 Score: 357.451 bits (916), Expect = 3.460e-119
Identity = 170/318 (53.46%), Postives = 228/318 (71.70%), Query Frame = 1
Query:  154 GKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVM 1107
            G++ LTLK ++ +EI +L+W AADLK R K   E +                     L GKS+AMIF+K STRTRLS ETGFAL+G HPCFL++QDIHLG NE+++DTA+VLS   DA+LARVY   DL+ LA  A++P++NGLS+ YHP+Q+LAD LTLQEHYGH+ GL ++WIGDGNN + +S +++  K G+NL+IA+PK YEPDS+V++   +  +++   L +T  P+EA   + V+VTDT+VSMG+E E   RL+DF GYQ+      +ASP+W FLHCLPRKP+EV D VFY   +SLV+ EAENRKWT+M
Sbjct:   12 GRNLLTLKHYTAEEIQYLLWVAADLKYRIKQKGEYV-------------------PVLQGKSLAMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLKDTARVLSGMTDAVLARVYRQTDLDLLAKEATIPIVNGLSDMYHPIQILADFLTLQEHYGHLNGLTISWIGDGNNVL-NSIMMSAAKFGMNLRIATPKGYEPDSSVISAAEQFSKESGTPLFMTNEPLEAATGANVLVTDTWVSMGKEEEKKKRLKDFKGYQITMQTGKVASPDWTFLHCLPRKPEEVDDAVFYSP-KSLVFPEAENRKWTIM 308          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 96.6709 bits (239), Expect = 4.943e-20
Identity = 93/350 (26.57%), Postives = 152/350 (43.43%), Query Frame = 1
Query:  127 TSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNY------GRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRD-----FTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDY 1137
            TS   H  +G+  LT+K FSKD++ HL   A  L  R  + KE                  LD   L GK +A +F + STRT  S       +G              K E++ D+ + +S ++D ++ R  E   +   A +   PVIN G     HP Q L DI T++E  G V G+ +  +GD  +  T HS      +  + L+  +P+S    SN++++       +E FE             EA+ +++V+       M R  +      D     F  + +  ++++ A      +H +PR  +E+S EV  D  R+  + +AEN  +  MA+L  +L  Y
Sbjct: 1541 TSPLLHPLIGQHILTVKQFSKDQMSHLFNVAHTL--RMLVQKE----------------RNLDI--LKGKVMASMFFEASTRTSSSFAAAMQRLGGSVLSFCETTSSSQKGESLTDSVQTMSCYSDVLVVRHPEPGAVELAAKHCRKPVINAGDGVGEHPTQALLDIFTIREELGTVNGMIITMVGDLKHGRTVHSLACLLTQYRVTLRYVTPRSLRMPSNIIHFVASKGIKQEEFESIE----------EALPDTDVLY------MTRIQKERFNSTDEYNACFGQFILTPHIMTRAKKKMVVMHPMPRV-NEISFEVDSDP-RAAYFRQAENGMYIRMALLATVLGKY 1852          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 96.2857 bits (238), Expect = 5.213e-20
Identity = 93/350 (26.57%), Postives = 152/350 (43.43%), Query Frame = 1
Query:  127 TSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNY------GRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRD-----FTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDY 1137
            TS   H  +G+  LT+K FSKD++ HL   A  L  R  + KE                  LD   L GK +A +F + STRT  S       +G              K E++ D+ + +S ++D ++ R  E   +   A +   PVIN G     HP Q L DI T++E  G V G+ +  +GD  +  T HS      +  + L+  +P+S    SN++++       +E FE             EA+ +++V+       M R  +      D     F  + +  ++++ A      +H +PR  +E+S EV  D  R+  + +AEN  +  MA+L  +L  Y
Sbjct: 1548 TSPLLHPLIGQHILTVKQFSKDQMSHLFNVAHTL--RMLVQKE----------------RNLDI--LKGKVMASMFFEASTRTSSSFAAAMQRLGGSVLSFCETTSSSQKGESLTDSVQTMSCYSDVLVVRHPEPGAVELAAKHCRKPVINAGDGVGEHPTQALLDIFTIREELGTVNGMIITMVGDLKHGRTVHSLACLLTQYRVTLRYVTPRSLRMPSNIIHFVASKGIKQEEFESIE----------EALPDTDVLY------MTRIQKERFNSTDEYNACFGQFILTPHIMTRAKKKMVVMHPMPRV-NEISFEVDSDP-RAAYFRQAENGMYIRMALLATVLGKY 1859          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 96.2857 bits (238), Expect = 6.041e-20
Identity = 93/350 (26.57%), Postives = 152/350 (43.43%), Query Frame = 1
Query:  127 TSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNY------GRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRD-----FTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDY 1137
            TS   H  +G+  LT+K FSKD++ HL   A  L  R  + KE                  LD   L GK +A +F + STRT  S       +G              K E++ D+ + +S ++D ++ R  E   +   A +   PVIN G     HP Q L DI T++E  G V G+ +  +GD  +  T HS      +  + L+  +P+S    SN++++       +E FE             EA+ +++V+       M R  +      D     F  + +  ++++ A      +H +PR  +E+S EV  D  R+  + +AEN  +  MA+L  +L  Y
Sbjct: 1684 TSPLLHPLIGQHILTVKQFSKDQMSHLFNVAHTL--RMLVQKE----------------RNLDI--LKGKVMASMFFEASTRTSSSFAAAMQRLGGSVLSFCETTSSSQKGESLTDSVQTMSCYSDVLVVRHPEPGAVELAAKHCRKPVINAGDGVGEHPTQALLDIFTIREELGTVNGMIITMVGDLKHGRTVHSLACLLTQYRVTLRYVTPRSLRMPSNIIHFVASKGIKQEEFESIE----------EALPDTDVLY------MTRIQKERFNSTDEYNACFGQFILTPHIMTRAKKKMVVMHPMPRV-NEISFEVDSDP-RAAYFRQAENGMYIRMALLATVLGKY 1995          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Mouse
Match: Otc (ornithine transcarbamylase [Source:MGI Symbol;Acc:MGI:97448])

HSP 1 Score: 384.415 bits (986), Expect = 2.341e-129
Identity = 182/340 (53.53%), Postives = 242/340 (71.18%), Query Frame = 1
Query:  145 QFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            Q  G+D LTLK+F+ +EI +++W +ADLK R K   E +                     L GKS+ MIF+K STRTRLS ETGFAL+G HP FL++QDIHLG NE++ DTA+VLS   DA+LARVY+  DL+TLA  AS+P++NGLS+ YHP+Q+LAD LTLQEHYG +KGL ++WIGDG NN+ HS +++  K G++L+ A+PK YEPD N+V    +  ++N  KL +T +P+EA     V++TDT++SMG+E E   RL+ F GYQV      +A+ +W FLHCLPRKP+EV DEVFY   RSLV+ EAENRKWT+MAV+V+LL+DY+P L KP F
Sbjct:   36 QLKGRDLLTLKNFTGEEIQYMLWLSADLKFRIKQKGEYL-------------------PLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSFLTTQDIHLGVNESLTDTARVLSSMTDAVLARVYKQSDLDTLAKEASIPIVNGLSDLYHPIQILADYLTLQEHYGSLKGLTLSWIGDG-NNILHSIMMSAAKFGMHLQAATPKGYEPDPNIVKLAEQYAKENGTKLSMTNDPLEAARGGNVLITDTWISMGQEDEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSP-RSLVFPEAENRKWTIMAVMVSLLTDYSPVLQKPKF 354          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Mouse
Match: Otc (ornithine transcarbamylase [Source:MGI Symbol;Acc:MGI:97448])

HSP 1 Score: 362.073 bits (928), Expect = 8.676e-121
Identity = 176/335 (52.54%), Postives = 234/335 (69.85%), Query Frame = 1
Query:  145 QFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQL 1149
            Q  G+D LTLK+F+ +EI +++W +ADLK R K   E +                     L GKS+ MIF+K STRTRLS ETGFAL+G HP FL++QDIHLG NE++ DTA+VLS   DA+LARVY+  DL+TLA  AS+P++NGLS+ YHP+Q+LAD LTLQEHYG +KGL ++WIGDG NN+ HS +++  K G++L+ A+PK YEPD N+V    +  ++N  KL +T +P+EA     V++TDT++SMG+E E   RL+ F GYQV      +A+ +W FLHCLPRKP+EV DEVFY   RSLV+ EAENRKWT+M   V+L S +AP L
Sbjct:   36 QLKGRDLLTLKNFTGEEIQYMLWLSADLKFRIKQKGEYL-------------------PLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSFLTTQDIHLGVNESLTDTARVLSSMTDAVLARVYKQSDLDTLAKEASIPIVNGLSDLYHPIQILADYLTLQEHYGSLKGLTLSWIGDG-NNILHSIMMSAAKFGMHLQAATPKGYEPDPNIVKLAEQYAKENGTKLSMTNDPLEAARGGNVLITDTWISMGQEDEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSP-RSLVFPEAENRKWTIM---VSLRSHHAPCL 346          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 95.1301 bits (235), Expect = 1.033e-19
Identity = 91/343 (26.53%), Postives = 153/343 (44.61%), Query Frame = 1
Query:  130 SNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEV-----VVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDY 1137
            S   H  VG+  L++K F+KD++ HL   A  L  R  + KE                  LD   L GK +A +F ++STRT  S     A +G      S     + K E++ D+ + +S + D I+ R  +   +   A +   PVIN G     HP Q L DI T++E  G V G+ +  +GD  +  T HS      +  ++L+  +P S     +V    R+       K     +  EA+ +++V     +  + F S+ +E E       F  + +  ++++ A      +H +PR  +E+S EV  D  R+  + +AEN  +  MA+L  +L  +
Sbjct: 1915 SPLLHSLVGQHILSVKQFTKDQMSHLFNVAHTL--RMMVQKE----------------RSLDI--LKGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVIVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLRMPPSV----RDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSV-QEYEAC-----FGQFILTPHIMTRAKKKMVVMHPMPRV-NEISVEVDSDP-RAAYFRQAENGMYIRMALLATVLGRF 2225          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 89.7373 bits (221), Expect = 5.004e-18
Identity = 88/340 (25.88%), Postives = 152/340 (44.71%), Query Frame = 1
Query:  130 SNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRD--FTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDY 1137
            S   H  VG+  L++K F+KD++ HL   A  L  R  + KE                  LD   L GK +A +F ++STRT  S     A +G      S     + K E++ D+ + +S + D I+ R  +   +   A +   PVIN G     HP Q L DI T++E  G V G+ +  +GD  +  T HS      +  ++L+  +P S     +V    R+       K     +  EA+ +++V+       + +E    ++  +  F  + +  ++++ A      +H +PR  +E+S EV  D  R+  + +AEN  +  MA+L  +L  +
Sbjct: 1852 SPLLHSLVGQHILSVKQFTKDQMSHLFNVAHTL--RMMVQKER----------------SLDI--LKGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVIVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLRMPPSV----RDFVASRGTKQEEFESIEEALPDTDVLY---MTRIQKERFGSVQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRV-NEISVEVDSDP-RAAYFRQAENGMYIRMALLATVLGRF 2162          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 55.4546 bits (132), Expect = 2.041e-7
Identity = 56/219 (25.57%), Postives = 98/219 (44.75%), Query Frame = 1
Query:  502 DAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEV-----VVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDY 1137
            D +  +V   M     A +   PVIN G     HP Q L DI T++E  G V G+ +  +GD  +  T HS      +  ++L+  +P S     +V    R+       K     +  EA+ +++V     +  + F S+ +E E       F  + +  ++++ A      +H +PR  +E+S EV  D  R+  + +AEN  +  MA+L  +L  +
Sbjct: 1958 DILKGKVMASMFYELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLRMPPSV----RDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSV-QEYEAC-----FGQFILTPHIMTRAKKKMVVMHPMPRV-NEISVEVDSDP-RAAYFRQAENGMYIRMALLATVLGRF 2164          
BLAST of Ornithine carbamoyltransferase vs. UniProt/SwissProt
Match: sp|P00480|OTC_HUMAN (Ornithine carbamoyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OTC PE=1 SV=3)

HSP 1 Score: 392.889 bits (1008), Expect = 8.126e-132
Identity = 188/353 (53.26%), Postives = 250/353 (70.82%), Query Frame = 1
Query:  106 NWNCTKITSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            N+ C +   N   Q  G+D LTLK+F+ +EI +++W +ADLK R K   E +                     L GKS+ MIF+K STRTRLS ETGFAL+G HPCFL++QDIHLG NE++ DTA+VLS   DA+LARVY+  DL+TLA  AS+P+INGLS+ YHP+Q+LAD LTLQEHY  +KGL ++WIGDG NN+ HS +++  K G++L+ A+PK YEPD++V     +  ++N  KL+LT +P+EA H   V++TDT++SMG+E E   RL+ F GYQV      +A+ +W FLHCLPRKP+EV DEVFY   RSLV+ EAENRKWT+MAV+V+LL+DY+PQL KP F
Sbjct:   24 NFRCGQPLQNKV-QLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYL-------------------PLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDG-NNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSP-RSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF 354          
BLAST of Ornithine carbamoyltransferase vs. UniProt/SwissProt
Match: sp|P31326|OTC_LITCT (Ornithine carbamoyltransferase, mitochondrial OS=Lithobates catesbeianus OX=8400 PE=2 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.028e-131
Identity = 185/345 (53.62%), Postives = 248/345 (71.88%), Query Frame = 1
Query:  130 SNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            S  + Q  G+D LTLK++S +EI +L+W AADLK R K   E +                     L GKS+AMIF+K STRTRLS ETGFAL+G HP FL++QDIHLG NE+++DTA+VLS   DA+LARVY   DL  LA  AS+P++NGLS+ YHP+Q+LAD LT+QEHYGH+KGL ++WIGDGNN + HS +++  K G++L IA+PK YEP+S++    ++  ++   KL++T +P+EA + + V+VTDT+VSMG+E E   RL DF GYQ+      +A+PNW FLHCLPRKP+EV DEVFY   +SLV+ EAENRKWT+M V+V+LL+DY+PQL +P F
Sbjct:   27 SQTYSQLKGRDLLTLKNYSAEEIKYLLWVAADLKYRIKEKGEYL-------------------PLLQGKSLAMIFEKRSTRTRLSTETGFALLGGHPSFLTTQDIHLGVNESLKDTARVLSGMTDAVLARVYHQSDLEVLAEEASIPIVNGLSDDYHPIQILADYLTIQEHYGHLKGLTISWIGDGNNVL-HSIMMSAAKFGMHLHIATPKGYEPNSSLTEAAKQFSKECGTKLLMTNDPLEAANGANVLVTDTWVSMGQEEEKKKRLLDFKGYQITMKTAKLAAPNWIFLHCLPRKPEEVDDEVFYCP-KSLVFQEAENRKWTIMGVMVSLLTDYSPQLLRPTF 350          
BLAST of Ornithine carbamoyltransferase vs. UniProt/SwissProt
Match: sp|P84010|OTC_SHEEP (Ornithine carbamoyltransferase, mitochondrial OS=Ovis aries OX=9940 GN=OTC PE=1 SV=2)

HSP 1 Score: 387.111 bits (993), Expect = 1.579e-129
Identity = 184/353 (52.12%), Postives = 248/353 (70.25%), Query Frame = 1
Query:  106 NWNCTKITSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            N+ C +   +   Q  G+D LTLK+F+ +EI +++W +ADLK R K   E +                     L GKS+ MIF+K STRTRLS ETGFAL+G HPCFL++ DIHLG NE++ DTA+VLS   DA+LARVY+  DL+ LA  AS+P++NGLS+ YHP+Q+LAD LTLQEHYG +KGL ++WIGDG NN+ HS +++  K G++L++A+PK YEPD ++     +  ++N  KL LT +P+EA     V++TDT++SMG+E E   RL+ F GYQV      +A+P+W FLHCLPRKP+EV DEVFY   RSLV+ EAENRKWT+MAV+V+LL+DY+PQL KP F
Sbjct:   25 NFRCGQPVQDKV-QLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYL-------------------PLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTDDIHLGVNESLTDTARVLSSMTDAVLARVYKQSDLDILAKEASIPIVNGLSDLYHPIQILADYLTLQEHYGSLKGLTLSWIGDG-NNILHSIMMSAAKFGMHLQVATPKGYEPDPSITKLAEQYAKENGTKLSLTNDPLEAACGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAAPDWTFLHCLPRKPEEVDDEVFYSP-RSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF 355          
BLAST of Ornithine carbamoyltransferase vs. UniProt/SwissProt
Match: sp|Q9N1U7|OTC_BOVIN (Ornithine carbamoyltransferase, mitochondrial OS=Bos taurus OX=9913 GN=OTC PE=2 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 6.311e-129
Identity = 184/353 (52.12%), Postives = 247/353 (69.97%), Query Frame = 1
Query:  106 NWNCTKITSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            N+ C +   +   Q  G+D LTLK+F+ +EI +++W +ADLK R K   E +                     L GKS+ MIF+K STRTRLS ETGFAL+G HPCFL++ DIHLG NE++ DTA+VLS   DA+LARVY+  DL+ LA  AS+P++NGLS+ YHP+Q+LAD LTLQEHYG +KGL ++WIGDG NN+ HS +++  K G++L++A+PK YEPD ++     +  ++N  KL LT +P+EA     V++TDT++SMG+E E   RL+ F GYQV      +A+P+W FLHCLPRKP+EV DEVFY   RSLV  EAENRKWT+MAV+V+LL+DY+PQL KP F
Sbjct:   24 NFRCGQPLQDKV-QLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYL-------------------PLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTDDIHLGVNESLTDTARVLSSMTDAVLARVYKQSDLDLLAKEASIPIVNGLSDLYHPIQILADYLTLQEHYGSLKGLTLSWIGDG-NNILHSIMMSAAKFGMHLQVATPKGYEPDPSITKMAEQYAKENGTKLSLTNDPLEAACGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAAPDWTFLHCLPRKPEEVDDEVFYSP-RSLVSPEAENRKWTIMAVMVSLLTDYSPQLQKPKF 354          
BLAST of Ornithine carbamoyltransferase vs. UniProt/SwissProt
Match: sp|O19072|OTC_PIG (Ornithine carbamoyltransferase, mitochondrial (Fragment) OS=Sus scrofa OX=9823 GN=OTC PE=2 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 9.484e-129
Identity = 180/340 (52.94%), Postives = 243/340 (71.47%), Query Frame = 1
Query:  145 QFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            Q  G+D LTLK+F+ +EI +++W +ADLK R K   E +                     L GKS+ MIF+K STRTRLS ETGFAL+G HPCFL++QDIHLG NE+++DTA+VLS   DA+LARVY+  DL+ LA  AS+P+INGLS+ YHP+Q+LAD LTLQEHYG +KGL ++WIGDG NN+ HS +++  K G++L++A+PK YEPD ++     +  ++N   + LT +P+EA     V++TDT++SMG+E E   RL+ F GYQV      +A+ +W FLHCLPRKP+EV DEVFY   +SLV+ EAENRKWT+MAV+V+LL+DY+PQL KP F
Sbjct:   10 QLKGRDLLTLKNFTGEEIKYILWLSADLKFRIKQKGEYL-------------------PLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLKDTARVLSSMTDAVLARVYKQSDLDILAQEASIPIINGLSDLYHPIQILADYLTLQEHYGALKGLTLSWIGDG-NNILHSIMMSAAKFGMHLQVATPKGYEPDPSITKLAEQYAKENGTNVSLTNDPLEAARGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAEVAASDWTFLHCLPRKPEEVDDEVFYSP-QSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF 328          
BLAST of Ornithine carbamoyltransferase vs. TrEMBL
Match: R7T9F5 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_178077 PE=3 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 1.427e-135
Identity = 197/340 (57.94%), Postives = 248/340 (72.94%), Query Frame = 1
Query:  148 FVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNFE 1167
             VG+DFLTL+DF+K EI   +WTA DLK R K+N E                    ++PL GKS+A+IFQK STRTRLS+ETGFAL+G  PCFLS +DIHLG NE I D+A+VLS F D ILARVY    L+ LA   S+PV++GLS++YHPLQ LAD+LTLQEH+G +KGL +AW+GDGNN + HS ++    +G+++ IA+PK YE DS VV     L EK+  KL  T +P EAVH S+V+VTDT+VSMG+E E  IRL+ F GYQVD  + S+A+P+W FLHCLPR P+EVSDEVFYD  RSLVW EAENRKWTVM++L++LL ++ P  PKPNFE
Sbjct:    1 MVGQDFLTLRDFNKAEIEQFLWTANDLKTRIKLNGE-------------------RYEPLQGKSLALIFQKRSTRTRLSSETGFALLGGKPCFLSPEDIHLGVNECILDSARVLSGFVDIILARVYAQQTLDELAAEGSIPVVSGLSDTYHPLQTLADLLTLQEHFGKLKGLKMAWVGDGNN-IIHSLMMGGLPMGVDINIATPKGYECDSVVVKDAVALAEKHGTKLNFTNDPKEAVHKSDVIVTDTWVSMGQEEEAKIRLKAFDGYQVDAKMASLANPDWVFLHCLPRHPEEVSDEVFYDAKRSLVWQEAENRKWTVMSILLHLLKEHIPTTPKPNFE 320          
BLAST of Ornithine carbamoyltransferase vs. TrEMBL
Match: F6UHY3 (Ornithine carbamoyltransferase OS=Monodelphis domestica OX=13616 GN=OTC PE=3 SV=1)

HSP 1 Score: 405.601 bits (1041), Expect = 2.148e-134
Identity = 196/374 (52.41%), Postives = 263/374 (70.32%), Query Frame = 1
Query:   43 WNLIYLFQMKAIKITKLLSGFNWNCTKITSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            +NL  L +  A++   LL+  ++ C K   +   Q  G+  LTLKDF+ +EI +L+W +ADLK R K   E +                     L GKS++MIF+K STRTRLS ETGFAL+G HPCFL++QDIHLG NE++ DTA+VLS   DAILARVY+H DL+ LA  ASVP++NGLS  YHP+Q+LAD LTLQEHYG++KGL ++WIGDG NN+ HS +++  K G+NL++A+PK YEPD  +     +  +++  KL LT++P+EA   S V++TDT++SMG+E E   RL+DF GYQ+      +A+PNW FLHCLPRKP+EV DEVFY   +SLV+ EAENRKWT+MAV+V+LL+DY+PQL KP F
Sbjct:    3 FNLKTLLRSAALRQQSLLAVRHFQCGKSVQSKV-QMKGRHLLTLKDFTGEEIKYLLWLSADLKYRIKQKGEYL-------------------PLLQGKSLSMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMTDAILARVYKHSDLDHLAKEASVPIVNGLSEMYHPVQILADYLTLQEHYGYLKGLTLSWIGDG-NNILHSIMMSAAKFGMNLQVATPKGYEPDPGITKLAEKYAKEHGTKLSLTSDPMEAAQGSNVLITDTWISMGQEEEKNKRLQDFQGYQITMKTAGVAAPNWTFLHCLPRKPEEVDDEVFYCP-KSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPTF 354          
BLAST of Ornithine carbamoyltransferase vs. TrEMBL
Match: A0A4X2JVR8 (Uncharacterized protein OS=Vombatus ursinus OX=29139 GN=OTC PE=3 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 2.780e-133
Identity = 198/375 (52.80%), Postives = 261/375 (69.60%), Query Frame = 1
Query:   43 WNLIYLFQMKAIKITKLLSGFNWNCTK-ITSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            +N+  L +  A +    L+  N+ C K + SN   Q  G+  LTLKDF+ +EI +L+W +ADLK R K   E +                     L GKS++MIF+K STRTRLS ETGFAL+G HPCFL++QDIHLG NE++ DTA+VLS   DAILARVY+H DL+ LA  ASVP++NGLS  YHP+Q+LAD LTLQEHYG++KGL ++WIGDG NN+ HS +++  K G+NL++A+PK YEPD  +     +  +++  KL LT +P+EA   S V++TDT++SMG+E E   RLRDF GYQ+      +A+ NW FLHCLPRKP+EV DEVFY   RSLV+ EAENRKWT+MAV+V+LL+DY+PQL KP F
Sbjct:    3 FNMKTLLRSAAFRQGSQLAVRNFQCGKSVQSNV--QLKGRHLLTLKDFTGEEIKYLLWLSADLKYRIKQKGEYL-------------------PLLQGKSLSMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMTDAILARVYKHSDLDHLAKEASVPIVNGLSEMYHPIQILADYLTLQEHYGYLKGLTLSWIGDG-NNILHSIMMSAAKFGMNLQVATPKGYEPDPGITKLAEQYAKEHGTKLSLTFDPMEAAQGSNVLITDTWISMGQEEEKNKRLRDFRGYQITMKTAGVAASNWTFLHCLPRKPEEVDDEVFYCP-RSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPTF 354          
BLAST of Ornithine carbamoyltransferase vs. TrEMBL
Match: A0A191XX94 (TMP OS=Boleophthalmus pectinirostris OX=150288 GN=otc PE=2 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 2.783e-132
Identity = 197/364 (54.12%), Postives = 251/364 (68.96%), Query Frame = 1
Query:   79 KITKLLSGFNWNCTKITSNAFH--QFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            K  + L+G         S A    Q  G+ FLTLKDF  DEI  L+W + DLK R K N E +                     L GKSIAMIF+K STRTR+S ETGFAL+G HPCFL+SQDIHLG NE+  DTA+VLS   D +LARVY H  L  LA  AS+P+INGLS+ YHP+Q+LAD LTLQEHYG + GL V+WIGDGNN + HS+++   KLG++LKIA+PK YEP+ +V+   + L +K   +LVLTT+P+EA H+S V+VTDT+VSMG+E E   RL+DF GYQ+     S+A P+W FLHCLPRKP+EV D+VFY   RSLV++EAENRKWT+M ++V+LL+DY+P+ P   F
Sbjct:   14 KCLQTLAGVQPRALSTGSAALSSVQLKGRSFLTLKDFGSDEIKKLLWVSGDLKHRIKQNNEYL-------------------PLLQGKSIAMIFEKRSTRTRMSTETGFALLGGHPCFLTSQDIHLGVNESSTDTARVLSGLCDIVLARVYSHSTLEELAKEASIPIINGLSDMYHPIQILADFLTLQEHYGSLNGLTVSWIGDGNNVL-HSFMMTAAKLGVHLKIATPKGYEPEDSVMQEAQRLSKKYGTQLVLTTDPMEAAHDSNVLVTDTWVSMGQEEEKKKRLKDFDGYQITMQTGSVARPDWTFLHCLPRKPEEVDDQVFYSP-RSLVFSEAENRKWTIMGLMVSLLTDYSPKTPMMKF 356          
BLAST of Ornithine carbamoyltransferase vs. TrEMBL
Match: A0A2U9CEJ5 (Putative ornithine carbamoyltransferase mitochondrial OS=Scophthalmus maximus OX=52904 GN=SMAX5B_018554 PE=3 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 6.359e-132
Identity = 191/337 (56.68%), Postives = 244/337 (72.40%), Query Frame = 1
Query:  154 GKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            G+  LTLKDFS DEI  L+W +ADLK R K  K+ +                     L GKSIAMIF+K STRTR+S ETGFAL+G HPCFL+SQDIHLG NE+  DTA+VLS F D +LARVY H  L  L   ASVP+INGLS+ YHP+Q+LAD LTLQEHYG + GL V+WIGDGNN + HS+++   KLG++LKIA+PK YEP+ +V+   ++L +++  +L+LT++P+EA H S V+VTDT+VSMG+E E   RLRDF GYQ+     S+A P+W FLHCLPRK +EV DEVFY  +RSLV+ EAENRKWT+M ++V+L++DY PQ P P F
Sbjct:   42 GRSCLTLKDFSSDEIKRLLWVSADLKHRIKQEKQYL-------------------PLLQGKSIAMIFEKRSTRTRMSTETGFALLGGHPCFLTSQDIHLGVNESCRDTARVLSGFCDIVLARVYSHSTLEELDEAASVPIINGLSDLYHPIQILADFLTLQEHYGSLSGLTVSWIGDGNNVL-HSFMMTAAKLGVHLKIATPKGYEPEKSVIQEAQKLSKEHGTQLLLTSDPMEAAHGSNVLVTDTWVSMGQEEEKKKRLRDFHGYQITMKTGSVAKPDWTFLHCLPRKMEEVDDEVFYS-SRSLVFPEAENRKWTIMGLMVSLMTDYTPQTPTPKF 357          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Cavefish
Match: otc (ornithine carbamoyltransferase [Source:NCBI gene;Acc:103045553])

HSP 1 Score: 382.104 bits (980), Expect = 5.983e-129
Identity = 182/334 (54.49%), Postives = 241/334 (72.16%), Query Frame = 1
Query:  157 KDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPL-NGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPK 1155
            + FLTLKDF+ DEI H++  +ADLK R K+                    Q  + PL  GKSIAMIF+K STRTR+S ETGF+L+G HPCFL+ QDIHLG NE+  DTA+VLS   D +LARVY H  L  L+  AS+P+INGLS+ YHP+Q+LAD+LTLQEHYG +KGL VAWIGDGNN + HS +++  KLG+NL+IA+PK YEPD+ V    + L ++   +L L++ P+EA   S V+VTDT++SMG+E E   R++DF GYQ+     S+A+P+W FLHCLPRK +EV+DEVFY   RSLV+ EAENRKWT+M ++V +L+DY+PQ+P+
Sbjct:   21 RSFLTLKDFNPDEIKHILRVSADLKHRIKL--------------------QGQYLPLLQGKSIAMIFEKRSTRTRMSTETGFSLLGGHPCFLTPQDIHLGVNESTTDTARVLSGLADIVLARVYSHSTLEQLSKEASIPIINGLSDLYHPIQILADLLTLQEHYGSLKGLTVAWIGDGNNVL-HSLMMSLAKLGVNLRIATPKGYEPDAAVTQEAQRLSKQFGTELQLSSEPMEAAQGSNVLVTDTWISMGQEEEKKKRIKDFQGYQITMQTGSVAAPDWTFLHCLPRKSEEVNDEVFYSP-RSLVFTEAENRKWTIMGLMVCMLTDYSPQIPE 332          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Cavefish
Match: otc (ornithine carbamoyltransferase [Source:NCBI gene;Acc:103045553])

HSP 1 Score: 382.489 bits (981), Expect = 9.010e-129
Identity = 182/334 (54.49%), Postives = 241/334 (72.16%), Query Frame = 1
Query:  157 KDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPL-NGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPK 1155
            + FLTLKDF+ DEI H++  +ADLK R K+                    Q  + PL  GKSIAMIF+K STRTR+S ETGF+L+G HPCFL+ QDIHLG NE+  DTA+VLS   D +LARVY H  L  L+  AS+P+INGLS+ YHP+Q+LAD+LTLQEHYG +KGL VAWIGDGNN + HS +++  KLG+NL+IA+PK YEPD+ V    + L ++   +L L++ P+EA   S V+VTDT++SMG+E E   R++DF GYQ+     S+A+P+W FLHCLPRK +EV+DEVFY   RSLV+ EAENRKWT+M ++V +L+DY+PQ+P+
Sbjct:   38 RSFLTLKDFNPDEIKHILRVSADLKHRIKL--------------------QGQYLPLLQGKSIAMIFEKRSTRTRMSTETGFSLLGGHPCFLTPQDIHLGVNESTTDTARVLSGLADIVLARVYSHSTLEQLSKEASIPIINGLSDLYHPIQILADLLTLQEHYGSLKGLTVAWIGDGNNVL-HSLMMSLAKLGVNLRIATPKGYEPDAAVTQEAQRLSKQFGTELQLSSEPMEAAQGSNVLVTDTWISMGQEEEKKKRIKDFQGYQITMQTGSVAAPDWTFLHCLPRKSEEVNDEVFYSP-RSLVFTEAENRKWTIMGLMVCMLTDYSPQIPE 349          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Cavefish
Match: otc (ornithine carbamoyltransferase [Source:NCBI gene;Acc:103045553])

HSP 1 Score: 381.333 bits (978), Expect = 1.967e-128
Identity = 182/334 (54.49%), Postives = 241/334 (72.16%), Query Frame = 1
Query:  157 KDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPL-NGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPK 1155
            + FLTLKDF+ DEI H++  +ADLK R K+                    Q  + PL  GKSIAMIF+K STRTR+S ETGF+L+G HPCFL+ QDIHLG NE+  DTA+VLS   D +LARVY H  L  L+  AS+P+INGLS+ YHP+Q+LAD+LTLQEHYG +KGL VAWIGDGNN + HS +++  KLG+NL+IA+PK YEPD+ V    + L ++   +L L++ P+EA   S V+VTDT++SMG+E E   R++DF GYQ+     S+A+P+W FLHCLPRK +EV+DEVFY   RSLV+ EAENRKWT+M ++V +L+DY+PQ+P+
Sbjct:   32 RSFLTLKDFNPDEIKHILRVSADLKHRIKL--------------------QGQYLPLLQGKSIAMIFEKRSTRTRMSTETGFSLLGGHPCFLTPQDIHLGVNESTTDTARVLSGLADIVLARVYSHSTLEQLSKEASIPIINGLSDLYHPIQILADLLTLQEHYGSLKGLTVAWIGDGNNVL-HSLMMSLAKLGVNLRIATPKGYEPDAAVTQEAQRLSKQFGTELQLSSEPMEAAQGSNVLVTDTWISMGQEEEKKKRIKDFQGYQITMQTGSVAAPDWTFLHCLPRKSEEVNDEVFYSP-RSLVFTEAENRKWTIMGLMVCMLTDYSPQIPE 343          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Cavefish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 89.3521 bits (220), Expect = 4.819e-18
Identity = 87/341 (25.51%), Postives = 150/341 (43.99%), Query Frame = 1
Query:  139 FHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNY----GRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRD----FTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLS 1131
             H  VG+  L+++ F+K+++ HL   A  L  R  + KE                  LD   L GK +A +F ++STRT  S       +G      S       K E++ D+ + +S + D I+ R  E   +   A +   P+IN G     HP Q L DI T++E  G V G+ +  +GD  +  T HS      +  + L+  +PK+      +V++    G +  E N+ +        EA+ +++V+          + E  +   D    F  + +  ++++ A      +H LPR  +E+S EV  D  R+  + +AEN  +  MA+L  +L 
Sbjct: 1914 LHPLVGQHILSVQQFTKEQMSHLFNVAHTL--RLMVQKE----------------RSLDI--LKGKVMASMFYEVSTRTSSSFAAAMQRLGGSVVHFSECTSSTQKGESLGDSVQTMSCYADVIVLRHPEPGAVEKAAKHCRRPMINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLARLLTQYRITLRYVAPKNLSMPVEIVDFVASKGIKQEEFNSIE--------EALPDTDVLYMTRI-----QKERFVSKEDYKACFGQFVLTPHIMTGAKRKMVVMHPLPRV-NEISVEVDTDP-RAAYFRQAENGMYIRMALLATVLG 2219          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Cavefish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 88.1965 bits (217), Expect = 1.330e-17
Identity = 86/341 (25.22%), Postives = 150/341 (43.99%), Query Frame = 1
Query:  139 FHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNY----GRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRD----FTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLS 1131
             H  VG+  L+++ F+K+++ HL   A  L  R  + KE                  LD   L GK +A +F ++STRT  S       +G      S       K E++ D+ + +S + D I+ R  E   +   A +   P+IN G     HP Q L DI T++E  G V G+ +  +GD  +  T HS      +  + L+  +PK+      +V++    G +  E N+ +        EA+ +++V+          + E  +   D    F  + +  ++++ A      +H LPR  +E+S EV  D  R+  + +AEN  +  MA+L  ++ 
Sbjct: 1928 LHPLVGQHILSVQQFTKEQMSHLFNVAHTL--RLMVQKE----------------RSLDI--LKGKVMASMFYEVSTRTSSSFAAAMQRLGGSVVHFSECTSSTQKGESLGDSVQTMSCYADVIVLRHPEPGAVEKAAKHCRRPMINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLARLLTQYRITLRYVAPKNLSMPVEIVDFVASKGIKQEEFNSIE--------EALPDTDVLYMTRI-----QKERFVSKEDYKACFGQFVLTPHIMTGAKRKMVVMHPLPRV-NEISVEVDTDP-RAAYFRQAENGMYIRMALLCTVVG 2233          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Yeast
Match: ARG3 (Ornithine carbamoyltransferase; also known as carbamoylphosphate:L-ornithine carbamoyltransferase; catalyzes the biosynthesis of the arginine precursor citrulline [Source:SGD;Acc:S000003624])

HSP 1 Score: 242.276 bits (617), Expect = 1.408e-75
Identity = 130/329 (39.51%), Postives = 197/329 (59.88%), Query Frame = 1
Query:  157 KDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHV-----KGLN----VAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVL 1116
            +  +++KD S +E   L+  A   K  +K NK      N          FQ +   L G++IA+IF K STRTR+S E      GA P FL  +DI LG NE+  DT KV+S     I ARV +H D+      +SVP+IN L + +HPLQ + D+LT+ E++        KG+N    +AWIGD NN + +   +AC K G+++ I++P   E DS++V+  +++ E+N     LT + ++A  N+ ++VTDTFVSMG E     +L+ F G+Q+++ LVS+A PN+ F+HCLPR  +EVSD+VFY ++ S+V+ EAENR +  M+ +
Sbjct:   12 RHLISIKDLSDEEFRILVQRAQHFKNVFKANK-----TND---------FQSNHLKLLGRTIALIFTKRSTRTRISTEGAATFFGAQPMFLGKEDIQLGVNESFYDTTKVVSSMVSCIFARVNKHEDILAFCKDSSVPIINSLCDKFHPLQAICDLLTIIENFNISLDEVNKGINSKLKMAWIGDANN-VINDMCIACLKFGISVSISTPPGIEMDSDIVDEAKKVAERNGATFELTHDSLKASTNANILVTDTFVSMGEEFAKQAKLKQFKGFQINQELVSVADPNYKFMHCLPRHQEEVSDDVFYGEH-SIVFEEAENRLYAAMSAI 324          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Yeast
Match: URA2 (Bifunctional carbamoylphosphate synthetase/aspartate transcarbamylase; catalyzes the first two enzymatic steps in the de novo biosynthesis of pyrimidines; both activities are subject to feedback inhibition by UTP [Source:SGD;Acc:S000003666])

HSP 1 Score: 95.1301 bits (235), Expect = 1.067e-20
Identity = 89/331 (26.89%), Postives = 150/331 (45.32%), Query Frame = 1
Query:  148 FVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSY-HPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGR--ETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLL 1128
            F G+  L++K F + + + L   A +L  R  + +E +  L                  + G  I  IF + STRT  S       +G     ++     + K ET++DT + L+ ++DAI+ R  E M ++  A Y+ VP+ING + S  HP Q   D+ T++E  G V G+ V ++GD  +  T HS         + + + SP    P+  +    RE   K     V +      + +   V+  T V   R    E   RL+D   Y VD  +++ A  N   +H LPR  +E+ +EV YD +R+  + + +   +  MA+L  ++
Sbjct: 1908 FRGRHILSIKQFKRSDFHVLFAVAQEL--RAAVAREGVLDL------------------MKGHVITTIFFEPSTRTCSSFIAAMERLGGRIVNVNPLVSSVKKGETLQDTIRTLACYSDAIVMRHSEEMSVHIAAKYSPVPIINGGNGSREHPTQAFLDLFTIREEIGTVNGITVTFMGDLKHGRTVHSLCRLLMHYQVRINLVSP----PELRLPEGLREELRKAGLLGVESIELTPHIISKTDVLYCTRVQEERFNSPEEYARLKD--TYIVDNKILAHAKENMAIMHPLPRV-NEIKEEVDYD-HRAAYFRQMKYGLFVRMALLAMVM 2210          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Nematostella
Match: EDO44662 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV06])

HSP 1 Score: 349.362 bits (895), Expect = 5.375e-116
Identity = 175/359 (48.75%), Postives = 246/359 (68.52%), Query Frame = 1
Query:   91 LLSGFNWNCTKITSNAFHQFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYK-INKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            LLS    +    + + F    G++FLTLK+F+ DEI++L+W AADLK R+K  N + +                  F PL+GKS A+IF K STRTR+S ETG +L+G  P FL+ +DIHLG NE I DTA+VLS F D ILARV +  ++ +LA  A+VPV++GLS+ YHPLQ+LAD+ TLQEH+G +    VAW+GDG NN+ HS+++A  K+G+ L+IA+PK Y+PD  ++    E  ++    + LT +P EA   ++VVVTDT+VSMG+E E+  RL+ F GYQV+K L+S+ + +  FLHCLPR P+EV+D+VFY + +SL+W EAENRKWT MAV++ LL ++ P +P P F
Sbjct:   28 LLSKRELSSESHSDHPFPSVKGRNFLTLKNFTSDEIHYLLWCAADLKARFKDPNWKYL---------------SESFSPLSGKSAALIFLKRSTRTRISMETGLSLLGCQPVFLTDKDIHLGVNENIYDTARVLSGFVDIILARVNKQEEVESLANNATVPVVSGLSDLYHPLQILADLQTLQEHFGSLYNHTVAWVGDG-NNILHSFLMAAPKMGMKLQIATPKGYDPDPEILKDAMEFAKEFKTTIELTRDPREACEKADVVVTDTWVSMGQEEESAARLKAFQGYQVNKELMSLTNQDSVFLHCLPRHPEEVTDDVFYSE-KSLIWQEAENRKWTAMAVMLCLLENHTPNIPMPTF 369          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Nematostella
Match: EDO37703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF31])

HSP 1 Score: 85.1149 bits (209), Expect = 4.380e-17
Identity = 77/280 (27.50%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  310 LDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMT-HSYIVACGKLGLNLKIASPKSYEPDSNVVNY--GRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDY 1137
            +DF  L G+ +A +F ++STRT  S       +G     +++ D    K E++ D+ +V+S ++D ++ R  +   +   A +   PVIN G     HP Q L D+ T++E  G V G+ V  +GD  N  T HS         + L+  SP S      V +Y   R + ++    L       EA+ +S+V+   T +   R        + F  Y +   +++ A      +H LPR  +E+S EV  D  R+  + +AE   +  MA+L  L+  Y
Sbjct: 1943 VDF--LKGRVMASMFYEVSTRTSSSFSAAMQRLGGTVVQMNASDSSAKKGESLADSVQVMSSYSDVVVIRHPKIGAVQEAAAHCRKPVINAGDGVGEHPTQALLDVFTIREEIGTVNGVTVTMVGDLKNGRTVHSLARLLCLYRVTLRYVSPPSLRMPDKVKDYVRSRGIVQEEYTSL------EEALPDSDVLYV-TRIQRERFNTQEEYEQVFGSYVITPQVLNEAKEKMVVMHPLPRV-NEISVEVDSDP-RAAYFRQAEYGMYVRMALLALLVGKY 2211          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Nematostella
Match: EDO26385 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC55])

HSP 1 Score: 51.6026 bits (122), Expect = 2.036e-7
Identity = 44/155 (28.39%), Postives = 71/155 (45.81%), Query Frame = 1
Query:  337 SIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAK-VLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSY-HPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNY 795
            +IA IF + STRT+LS E     + A     S+    + K ET+ DT   +LS   D ++ R       + L+   +  ++N    ++ HP Q L D  T++E  G V G  V  +GD    + HS +       L ++ A  K   P++ +  Y
Sbjct:   48 TIANIFFENSTRTKLSFELAQKRLSADVISFSAAQSSVKKGETLIDTVNNILSMKVDMVVMRHSSPGAAHFLSQNVNASIVNAGDGAHEHPTQALLDSYTIREKLGDVAGKKVVIVGD----ILHSRVALSNIFALQMQGAEVKVCGPNTLIPKY 198          
BLAST of Ornithine carbamoyltransferase vs. Ensembl Medaka
Match: otc (ornithine carbamoyltransferase [Source:NCBI gene;Acc:101173100])

HSP 1 Score: 393.275 bits (1009), Expect = 6.373e-133
Identity = 186/337 (55.19%), Postives = 243/337 (72.11%), Query Frame = 1
Query:  154 GKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNF 1164
            G+  LTLKDFS +EI  L+W + DLK+  K  K+ +                     L GKSIAMIF+K STRTR+S ETG AL+G HPCFL+SQDIHLG NE+  DTA+VLS   D +LARVY H  L  L   AS+P+INGLS+ YHP+Q+LAD LTLQEHYG + GL V+WIGDGNN + HS+++A  KLG++L++A+PK YE DS+V+   + L +++  +LVLT++P+EA H S V+VTDT++SMG+E E   RLRDF GYQ+     S+A P+W FLHCLPRKP+EV D+VFY   RSLV+NEAENRKWT+M ++V+LL+DY+PQ+P   F
Sbjct:   42 GRSCLTLKDFSSEEITRLLWVSGDLKRLIKQEKQYL-------------------PLLQGKSIAMIFEKRSTRTRMSTETGMALLGGHPCFLTSQDIHLGVNESCTDTARVLSGLCDLVLARVYSHSTLEELHREASIPIINGLSDLYHPIQILADFLTLQEHYGSLSGLTVSWIGDGNNVL-HSFMMAAAKLGVHLRVATPKGYEADSSVIQEAKNLSKQHGTQLVLTSDPMEAAHGSNVLVTDTWISMGQEEEKKKRLRDFQGYQITMKTGSVAEPDWTFLHCLPRKPEEVDDQVFYS-TRSLVFNEAENRKWTIMGLMVSLLTDYSPQIPSSKF 357          
BLAST of Ornithine carbamoyltransferase vs. Planmine SMEST
Match: SMESG000040441.1 (SMESG000040441.1)

HSP 1 Score: 539.265 bits (1388), Expect = 0.000e+0
Identity = 257/257 (100.00%), Postives = 257/257 (100.00%), Query Frame = 1
Query:  397 FALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNFE 1167
            FALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNFE
Sbjct:   69 FALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNFE 325          
BLAST of Ornithine carbamoyltransferase vs. Planmine SMEST
Match: SMESG000035784.1 (SMESG000035784.1)

HSP 1 Score: 525.398 bits (1352), Expect = 0.000e+0
Identity = 252/254 (99.21%), Postives = 252/254 (99.21%), Query Frame = 1
Query:  406 MGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYAPQLPKPNFE 1167
            MGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNC LVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDY PQLPKPNFE
Sbjct:    1 MGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNYGRELFEKNNCNLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFTGYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLSDYVPQLPKPNFE 254          
BLAST of Ornithine carbamoyltransferase vs. Planmine SMEST
Match: SMESG000012911.1 (SMESG000012911.1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.728e-14
Identity = 84/340 (24.71%), Postives = 151/340 (44.41%), Query Frame = 1
Query:  145 QFVGKDFLTLKDFSKDEIYHLIWTAADLKQRYKINKEVIF*LNSI*FVLLHL*FQLDFKPLNGKSIAMIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGD-GNNNMTHSYIVACGKLGLNLK-IASPKSYEPDSNVVNY--GRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGR-ETENLIRLRDFTGYQVDKN-----LVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLS 1131
            +  G  FLT+K   K ++ H++  A +     + N+            L HL        L GK + ++F + STRT  S       +G      + +   + K E++EDT ++LS + D ++ R      ++ ++  +S PVIN G  +  HP Q L DI T++E +G V  L +  +GD  N    HS         + L+ +A   S +   ++V+Y   + + ++    L        A+ +S+VV       M R + E + +L +     ++KN     L+  A      +H LPR  +E+S   F    R+  + +AE   +  M++L  ++S
Sbjct: 1890 EITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNEN-----------LSHL--------LEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDL------ESALRDSDVVY------MTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRC-EEISTS-FDSDPRAAYFRQAEYGLYVRMSLLATIMS 2196          
The following BLAST results are available for this feature:
BLAST of Ornithine carbamoyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OTC1.692e-13253.26ornithine carbamoyltransferase [Source:HGNC Symbol... [more]
CAD1.534e-1725.96carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD1.543e-1725.96carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD6.031e-1324.50carbamoyl-phosphate synthetase 2, aspartate transc... [more]
OTC2.026e-1240.21ornithine carbamoyltransferase [Source:HGNC Symbol... [more]
back to top
BLAST of Ornithine carbamoyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pyr-15.633e-1425.95CAD protein Glutamine-dependent carbamoyl-phosphat... [more]
back to top
BLAST of Ornithine carbamoyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
r3.420e-1625.45gene:FBgn0003189 transcript:FBtr0089734[more]
r3.420e-1625.45gene:FBgn0003189 transcript:FBtr0340156[more]
r3.420e-1625.45gene:FBgn0003189 transcript:FBtr0340155[more]
back to top
BLAST of Ornithine carbamoyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
otc2.943e-12851.94ornithine carbamoyltransferase [Source:ZFIN;Acc:ZD... [more]
cad2.372e-1725.81carbamoyl-phosphate synthetase 2, aspartate transc... [more]
cad3.043e-929.07carbamoyl-phosphate synthetase 2, aspartate transc... [more]
back to top
BLAST of Ornithine carbamoyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otc1.291e-13152.94ornithine carbamoyltransferase [Source:NCBI gene;A... [more]
otc3.460e-11953.46ornithine carbamoyltransferase [Source:NCBI gene;A... [more]
CAD4.943e-2026.57carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD5.213e-2026.57carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD6.041e-2026.57carbamoyl-phosphate synthetase 2, aspartate transc... [more]
back to top
BLAST of Ornithine carbamoyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Otc2.341e-12953.53ornithine transcarbamylase [Source:MGI Symbol;Acc:... [more]
Otc8.676e-12152.54ornithine transcarbamylase [Source:MGI Symbol;Acc:... [more]
Cad1.033e-1926.53carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Cad5.004e-1825.88carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Cad2.041e-725.57carbamoyl-phosphate synthetase 2, aspartate transc... [more]
back to top
BLAST of Ornithine carbamoyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00480|OTC_HUMAN8.126e-13253.26Ornithine carbamoyltransferase, mitochondrial OS=H... [more]
sp|P31326|OTC_LITCT2.028e-13153.62Ornithine carbamoyltransferase, mitochondrial OS=L... [more]
sp|P84010|OTC_SHEEP1.579e-12952.12Ornithine carbamoyltransferase, mitochondrial OS=O... [more]
sp|Q9N1U7|OTC_BOVIN6.311e-12952.12Ornithine carbamoyltransferase, mitochondrial OS=B... [more]
sp|O19072|OTC_PIG9.484e-12952.94Ornithine carbamoyltransferase, mitochondrial (Fra... [more]
back to top
BLAST of Ornithine carbamoyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7T9F51.427e-13557.94Uncharacterized protein OS=Capitella teleta OX=283... [more]
F6UHY32.148e-13452.41Ornithine carbamoyltransferase OS=Monodelphis dome... [more]
A0A4X2JVR82.780e-13352.80Uncharacterized protein OS=Vombatus ursinus OX=291... [more]
A0A191XX942.783e-13254.12TMP OS=Boleophthalmus pectinirostris OX=150288 GN=... [more]
A0A2U9CEJ56.359e-13256.68Putative ornithine carbamoyltransferase mitochondr... [more]
back to top
BLAST of Ornithine carbamoyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otc5.983e-12954.49ornithine carbamoyltransferase [Source:NCBI gene;A... [more]
otc9.010e-12954.49ornithine carbamoyltransferase [Source:NCBI gene;A... [more]
otc1.967e-12854.49ornithine carbamoyltransferase [Source:NCBI gene;A... [more]
cad4.819e-1825.51carbamoyl-phosphate synthetase 2, aspartate transc... [more]
cad1.330e-1725.22carbamoyl-phosphate synthetase 2, aspartate transc... [more]
back to top
BLAST of Ornithine carbamoyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ornithine carbamoyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ARG31.408e-7539.51Ornithine carbamoyltransferase; also known as carb... [more]
URA21.067e-2026.89Bifunctional carbamoylphosphate synthetase/asparta... [more]
back to top
BLAST of Ornithine carbamoyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO446625.375e-11648.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377034.380e-1727.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263852.036e-728.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ornithine carbamoyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
otc6.373e-13355.19ornithine carbamoyltransferase [Source:NCBI gene;A... [more]
back to top
BLAST of Ornithine carbamoyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000040441.10.000e+0100.00SMESG000040441.1[more]
SMESG000035784.10.000e+099.21SMESG000035784.1[more]
SMESG000012911.11.728e-1424.71SMESG000012911.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028596 ID=SMED30028596|Name=Ornithine carbamoyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1780bp
TATGAATCCGATGAATTTCAAGGTTTGACAGAAAATTCAAATTGGAATCT
AATTTATTTGTTTCAAATGAAAGCTATTAAAATAACAAAGTTATTATCTG
GTTTCAATTGGAATTGCACGAAAATCACTTCAAACGCTTTTCATCAATTC
GTCGGCAAAGATTTCCTGACCTTGAAAGATTTTAGTAAAGACGAAATTTA
TCATCTCATCTGGACGGCTGCCGATTTAAAACAGAGATACAAAATAAATA
AGGAAGTAATTTTCTGATTAAATTCGATATGATTTGTCCTCCTCCATTTA
TAATTCCAGCTAGACTTCAAACCGTTAAATGGGAAATCTATTGCTATGAT
ATTTCAGAAGCTGAGCACGAGAACAAGATTGTCAGCGGAAACTGGTTTTG
CATTGATGGGAGCTCATCCATGCTTCCTTAGCTCACAAGATATTCATCTT
GGTAAAAATGAAACTATTGAAGATACCGCCAAAGTACTGTCGAAATTCAA
CGATGCCATTCTAGCGAGAGTGTATGAGCATATGGATTTGAACACCTTGG
CAACCTATGCCTCTGTACCTGTGATCAATGGTTTGTCCAACAGTTATCAT
CCTTTGCAATTACTGGCCGATATTCTCACTCTTCAAGAGCATTATGGGCA
TGTCAAAGGACTGAATGTCGCATGGATTGGTGACGGCAATAACAACATGA
CCCATTCCTATATCGTTGCATGTGGCAAACTTGGACTCAACCTGAAAATC
GCAAGTCCAAAGTCCTATGAACCGGATTCCAATGTTGTCAACTATGGCCG
TGAGCTATTTGAAAAGAATAACTGCAAACTAGTTCTGACGACAAACCCAG
TGGAAGCGGTTCACAATAGTGAGGTCGTGGTTACTGACACATTTGTCAGC
ATGGGCAGAGAAACAGAAAATTTAATTCGATTGAGAGATTTCACAGGATA
TCAGGTGGATAAAAATCTTGTTTCAATTGCGTCTCCCAATTGGTGCTTTC
TTCATTGTCTTCCGAGGAAACCCGATGAAGTTTCCGATGAAGTATTTTAC
GACAAAAATCGCTCACTGGTATGGAATGAAGCAGAAAATCGCAAATGGAC
TGTGATGGCAGTATTGGTGAACCTACTATCGGATTACGCGCCTCAATTGC
CAAAACCGAATTTTGAGTAATGAATTTGCGCAACAGTGATTTTTATTTTT
TCCTCGTTTTTCAATTAGTAATTTCGTAAATGCAAAATTTTGTTTTTATA
TATATATGAATAATATTCTAAAAGTTTATTGTGTAATTTTGATAGTATAT
TCAATTGCAAATAATTCAGTTTTAGCACATTTGTTGCTGTCAAGTGTCTG
GCTATCGCAGCAATGAACATATTTTTGTTCCTAGTGATTGAGGTCACTTG
CTGAAAATATAAATCCCAAGGAAGAATTATACCATGAAGACCTACATTTT
TCTGACTGACATTTTAAACAATAATAAAACAAAAGAGGCTCTTCAACTTT
TAAAATTTCCAAAAACTTAGATGACACCAAAAGAGTAGCCCTTTACAAAA
GCTCTCCAAAGAAAGCAAAATCCAAGCGAATCAAGTGCCTGTTTTCTTTT
TTTATATCAATCGAAACCAGGCAAAAATTGTTTTAGTAGATAAACGAGTT
AACTCAATCTTACAAATATATTATATAAAAGCAGAATAAATAATTGTTAT
TAATTTTATTCATCGCGTCTTCATAAATGTTAAAGGTATTCAGAAAAAAT
ATTGTATAACCTTGATTTGAGTCTTATTTG
back to top

protein sequence of SMED30028596-orf-1

>SMED30028596-orf-1 ID=SMED30028596-orf-1|Name=SMED30028596-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MIFQKLSTRTRLSAETGFALMGAHPCFLSSQDIHLGKNETIEDTAKVLSK
FNDAILARVYEHMDLNTLATYASVPVINGLSNSYHPLQLLADILTLQEHY
GHVKGLNVAWIGDGNNNMTHSYIVACGKLGLNLKIASPKSYEPDSNVVNY
GRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGRETENLIRLRDFT
GYQVDKNLVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRK
WTVMAVLVNLLSDYAPQLPKPNFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000050urea cycle
GO:0006593ornithine catabolic process
GO:0019240citrulline biosynthetic process
GO:0097272ammonia homeostasis
GO:0006520cellular amino acid metabolic process
Vocabulary: molecular function
TermDefinition
GO:0004585ornithine carbamoyltransferase activity
GO:0016743carboxyl- or carbamoyltransferase activity
GO:0016597amino acid binding
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002075pigment cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036901Asp/Orn_carbamoylTrfase_sf
IPR002292Orn/put_carbamltrans
IPR006130Asp/Orn_carbamoylTrfase
IPR006132Asp/Orn_carbamoyltranf_P-bd
IPR006131Asp_carbamoyltransf_Asp/Orn-bd
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006130Aspartate/ornithine carbamoyltransferasePRINTSPR00100AOTCASEcoord: 85..96
score: 57.79
coord: 226..249
score: 23.59
coord: 214..223
score: 46.62
coord: 3..22
score: 50.0
IPR006130Aspartate/ornithine carbamoyltransferasePROSITEPS00097CARBAMOYLTRANSFERASEcoord: 3..10
IPR002292Ornithine/putrescine carbamoyltransferasePRINTSPR00102OTCASEcoord: 178..188
score: 57.08
coord: 74..88
score: 64.19
coord: 240..251
score: 56.59
coord: 34..47
score: 53.65
coord: 1..15
score: 64.96
IPR002292Ornithine/putrescine carbamoyltransferaseTIGRFAMTIGR00658TIGR00658coord: 1..261
e-value: 2.9E-99
score: 330.0
IPR006132Aspartate/ornithine carbamoyltransferase, carbamoyl-P bindingPFAMPF02729OTCace_Ncoord: 1..98
e-value: 1.5E-32
score: 112.7
IPR006131Aspartate/ornithine carbamoyltransferase, Asp/Orn-binding domainPFAMPF00185OTCacecoord: 104..258
e-value: 3.1E-45
score: 154.1
IPR036901Aspartate/ornithine carbamoyltransferase superfamilyGENE3DG3DSA:3.40.50.1370coord: 1..257
e-value: 1.9E-96
score: 324.8
IPR036901Aspartate/ornithine carbamoyltransferase superfamilyGENE3DG3DSA:3.40.50.1370coord: 88..248
e-value: 1.9E-96
score: 324.8
IPR036901Aspartate/ornithine carbamoyltransferase superfamilySUPERFAMILYSSF53671Aspartate/ornithine carbamoyltransferasecoord: 1..263
NoneNo IPR availablePANTHERPTHR45753FAMILY NOT NAMEDcoord: 1..262