Serine/threonine-protein phosphatase with EF-hands

Overview
NameSerine/threonine-protein phosphatase with EF-hands
Smed IDSMED30028575
Length (bp)2226
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase with EF-hands (SMED30028575) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase with EF-hands (SMED30028575) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase with EF-hands (SMED30028575) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase with EF-hands (SMED30028575) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028575

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30028575SMESG000042202.1 SmedASXL_016642SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30028575SMESG000042202.1 SmedASXL_016641SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30028575SMESG000042202.1 dd_Smed_v4_11874_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028575SMESG000042202.1 dd_Smed_v4_11874_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30028575SMESG000042202.1 dd_Smed_v4_11874_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30028575SMESG000042202.1 dd_Smed_v4_11874_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30028575SMESG000042202.1 dd_Smed_v4_11874_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028575SMESG000042202.1 dd_Smed_v4_11874_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028575SMESG000042202.1 Contig35664newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028575SMESG000042202.1 Contig35664uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30028575SMESG000042202.1 dd_Smed_v6_11874_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF1 (protein phosphatase with EF-hand domain 1 [Source:HGNC Symbol;Acc:HGNC:9243])

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 279/641 (43.53%), Postives = 401/641 (62.56%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHV------LKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNEN----------------------------KEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            S++AA++IQNWYR Y+A+L+A++ Y   I+QSIEY+ EQ Q++L +FF+ +L                 + TH+      L+     S++D   ++   ++ I V  +Y G +L FPL+   +  L+E+F+++QILHA Y+LE+L  T+ +LK  PN +   TS SK VTICGDLHG+LDDL  IFYKN  P   NPY+ NGDFVDRG +S+EI  IL   FL+YP  + LNRGNHED +MN RYGF KEI  KYK +  +I++   + ++WLP+ TI+DN ILV HGGIS   +L+++ +++R+K  SVL  P E  ++ +                             E EW QI+D+LWSDPR K GC  N  RGGGCYFGPD+T+ IL KY L +LIRSHECK +GYE CH+ KVVT+FSASNYY++GSN+GA++++ +    +FFQY   K       L Q V+ +E SA++ L+ ++++ K++L   F  +D    G + + +W   MEN+L L LPWR+L  +LV + + G VEY S F+  +++        T+ E LY+ + +LE IF  +D D+SG IS+ EFR   KL   H N ++ +  +  LA  +D+NKDG IDFNEFL+AF +V
Sbjct:   16 SLRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLSTFFSFMLE----------------NYTHIHKEELELRNQSLESEQDMRDRW-DYVDSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQ-PLRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEYMSSFQNIRIEKPVQEAHSTLVETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFLKAFYVV 638          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF1 (protein phosphatase with EF-hand domain 1 [Source:HGNC Symbol;Acc:HGNC:9243])

HSP 1 Score: 443.736 bits (1140), Expect = 6.117e-147
Identity = 242/613 (39.48%), Postives = 365/613 (59.54%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHV------LKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            S++AA++IQNWYR Y+A+L+A++ Y   I+QSIEY+ EQ Q++L +FF+ +L                 + TH+      L+     S++D   ++   ++ I V  +Y G +L FPL+   +  L+E+F+++QILHA Y+LE+L  T+ +LK  PN +   TS SK VTICGDLHG+LDDL  IFYKN  P   NPY+ NGDFVDRG +S+EI  IL   FL+YP  + LNRGNHED +MN RYGF KEI  KYK +  +I++   + ++WLP+ TI+DN ILV HGGIS   +L+++ +++R+K  SVL  P E  ++ + + +             +K G + N +       G   TN             S    +  +EW    +VVT+FSASNYY++GSN+GA++++ +    +FFQY   K       L Q V+ +E SA++ L+ ++++ K++L   F  +D    G + + +W   MEN+L L LPWR+L  +LV + + G VEY S F+  +++        T+ E LY+ + +LE IF  +D D+SG IS+ EFR   KL   H N ++ +  +  LA  +D+NKDG IDFNEFL+AF +V
Sbjct:   16 SLRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLSTFFSFMLE----------------NYTHIHKEELELRNQSLESEQDMRDRW-DYVDSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSK------------HNKVGVTFNAH-------GRIKTNG------------SPTEHLTEHEW---EQVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQ-PLRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEYMSSFQNIRIEKPVQEAHSTLVETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFLKAFYVV 576          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF2 (protein phosphatase with EF-hand domain 2 [Source:HGNC Symbol;Acc:HGNC:9244])

HSP 1 Score: 307.375 bits (786), Expect = 1.667e-94
Identity = 148/320 (46.25%), Postives = 209/320 (65.31%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEE 1212
            + KAA LIQ WYRRY A+LE +RR TW I+QSIEY+G+QDQ+KL  FF+ L+         D + +  +              +D +++  +  E I V  +Y G +L+FPL  +  TAL+E+FR +Q LHARY+L LL  T+  L   PN+++ ST  S+ +T+CGDLHGQLDDL+ IFYKN  P     Y+ NGDFVDRG  SVEI  ILF+F L+YP+   LNRGNHEDH++N RYGF KE+  KYK +  +I+R   D+F WLPL T+ID  +L+ HGG+S + +L++++K++R K +S ++      K+E + EE
Sbjct:   19 AFKAAALIQRWYRRYVARLEMRRRCTWSIFQSIEYAGQQDQVKLHDFFSYLMDHFIPSSHNDRDFLTRIFTEDRFA-------QDSEMKKCSDYESIEVPDSYTGPRLSFPLLPDHATALVEAFRLKQQLHARYVLNLLYETKKHLVQLPNINRVSTCYSEEITVCGDLHGQLDDLIFIFYKNGLPSPERSYVFNGDFVDRGKDSVEILMILFAFMLVYPKEFHLNRGNHEDHMVNLRYGFTKEVMNKYKVHGKEILRTLQDVFCWLPLATLIDEKVLILHGGVSDITDLELLDKIERSKIVSTMRCKTRQ-KSEKQMEE 330          

HSP 2 Score: 176.407 bits (446), Expect = 1.736e-46
Identity = 77/158 (48.73%), Postives = 110/158 (69.62%), Query Frame = 1
Query: 1204 EEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQ 1677
            +EEW Q++D+LWSDP ++ GC  N  RGGGCYFGPD+T  +L+KYN+  LIRSHECK +GYE+CH  KV+T+FSASNYY+ GSN+GA++++         QY  +K     LT+ Q ++++EESALR L+ K+ A  ++L  EF + D +  G+   Q
Sbjct:  435 QEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYNMQFLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKVTHT-LTMRQRISRVEESALRALREKLFAHSSDLLSEFKKHDADKVGLASSQ 591          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF2 (protein phosphatase with EF-hand domain 2 [Source:HGNC Symbol;Acc:HGNC:9244])

HSP 1 Score: 306.99 bits (785), Expect = 1.088e-92
Identity = 148/320 (46.25%), Postives = 209/320 (65.31%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEE 1212
            + KAA LIQ WYRRY A+LE +RR TW I+QSIEY+G+QDQ+KL  FF+ L+         D + +  +              +D +++  +  E I V  +Y G +L+FPL  +  TAL+E+FR +Q LHARY+L LL  T+  L   PN+++ ST  S+ +T+CGDLHGQLDDL+ IFYKN  P     Y+ NGDFVDRG  SVEI  ILF+F L+YP+   LNRGNHEDH++N RYGF KE+  KYK +  +I+R   D+F WLPL T+ID  +L+ HGG+S + +L++++K++R K +S ++      K+E + EE
Sbjct:   19 AFKAAALIQRWYRRYVARLEMRRRCTWSIFQSIEYAGQQDQVKLHDFFSYLMDHFIPSSHNDRDFLTRIFTEDRFA-------QDSEMKKCSDYESIEVPDSYTGPRLSFPLLPDHATALVEAFRLKQQLHARYVLNLLYETKKHLVQLPNINRVSTCYSEEITVCGDLHGQLDDLIFIFYKNGLPSPERSYVFNGDFVDRGKDSVEILMILFAFMLVYPKEFHLNRGNHEDHMVNLRYGFTKEVMNKYKVHGKEILRTLQDVFCWLPLATLIDEKVLILHGGVSDITDLELLDKIERSKIVSTMRCKTRQ-KSEKQMEE 330          

HSP 2 Score: 305.064 bits (780), Expect = 4.709e-92
Identity = 145/296 (48.99%), Postives = 202/296 (68.24%), Query Frame = 1
Query: 1204 EEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFE---AQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSS 2082
            +EEW Q++D+LWSDP ++ GC  N  RGGGCYFGPD+T  +L+KYN+  LIRSHECK +GYE+CH  KV+T+FSASNYY+ GSN+GA++++         QY  +K     LT+ Q ++++EESALR L+ K+ A  ++L  EF + D +  G+I L +W   +E+VL L LPWR LRP LV  S +  +EY S  +    +Q+  +   I  ++ E LY+N+ NLETIFRI+D D+SG ISL EFR   KL   H N +++++ I DLA+ +D NKDG ID NEFLEAFR+V+ S
Sbjct:  435 QEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYNMQFLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKVTHT-LTMRQRISRVEESALRALREKLFAHSSDLLSEFKKHDADKVGLITLSDWAAAVESVLHLGLPWRMLRPQLVNSSADNMLEYKSWLKNLAKEQLSRE--NIQSSLLETLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMNIDITDDCICDLARSIDFNKDGHIDINEFLEAFRLVEKS 727          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPP5C (protein phosphatase 5 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9322])

HSP 1 Score: 231.876 bits (590), Expect = 3.497e-67
Identity = 133/369 (36.04%), Postives = 204/369 (55.28%), Query Frame = 1
Query:  421 KGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLT-FPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISA--MLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRID-NEHNKQFFQYTT 1515
            K QEC+  V     K    + A    +  R +     IE + +E  Y G KL    ++I+ +  L++ ++ ++ LH +   ++L   + +L     + + +   ++++T+CGD HGQ  DL+ IF  N  P  +NPYI NGDFVDRGS SVE+   LF F LLYP    L RGNHE   MN  YGF  E++ KY +   ++   F+++F WLPL   I+  +L+ HGG+ +   + LD I K++R++     Q P           +   + DLLWSDP+ + G S+++ RG  C FGPD+T   L++ NL  +IRSHE K +GYE  H  + VT+FSA NY  Q  NK +++ +  ++   QF Q+T 
Sbjct:  135 KYQECNKIV-----KQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTA---QMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNR-----QPP-----------DSGPMCDLLWSDPQPQNGRSISK-RGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTA 478          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 288/646 (44.58%), Postives = 405/646 (62.69%), Query Frame = 1
Query:  229 STGDTGP---ISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSL----TNKG---QECDSEVIEALSKTHVLKTAPTVSDED----RDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKE------EEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLR-IDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGT------MTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSSL 2085
            S+G   P   ++IK+AILIQ WYRR  A+LEA+RR TW I+ ++EY+GEQDQLKL  FF D++        KG      +S ++ ALS  H  K  P++ D +    + +   T    + ++  YKG  L+ PL   QV  +IE+F+  ++LH +Y+L +L   R + K  P+VS+ STSIS +VTICGDLHG+ DDL  I YKN +P   NPYI NGDFVDRG  S+E+  +LF+  ++ P S++LNRGNHEDH+MN RYGF+KE+  KYK  +  I R   D+FSWLP+ TIID  I V HGGIS    +  ++K+ RH+F SVL+ PV       KE      +EW Q+LD++WSDP+   GC  N +RGGG YFG DIT   L+K+   LL+RSHECK +GYE+ H N  +T+FSASNYY+ GSN+GA+++ I       F QY   K ++K  TL + +  +EESA+++LK K+ +F  +L +EF   D+   G + + +W   +E +  L LPW  L P +  LS++GK      +   + D +   + GT      + E LY++K  LET+FR MDKDNSG +S+ EF DAC++L ++T R +  + I  +A+ +D NKDG ID NE LEAFR+VD  L
Sbjct:    6 SSGRQNPSTELTIKSAILIQKWYRRCEARLEARRRATWQIFTALEYAGEQDQLKLYDFFADVIRAMAEENGKGGVENGRNSPLMSALS--HYAK--PSLMDSEGETVKKMLEDTSPTNVDIDRNYKGPTLSLPLDKPQVAKMIEAFKVNKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASKTHRKS-TLRERLGVVEESAVKELKEKLSSFHTDLQKEFEIMDIEKSGKLPILKWSDCVERITGLNLPWIALAPKVATLSEDGK------YVMYKEDRRIAQVGGTHAQEKDIVESLYRHKSTLETLFRFMDKDNSGQVSMKEFIDACEVLGKYTKRPLQTDYISQIAESIDFNKDGFIDLNELLEAFRLVDRPL 640          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 285/636 (44.81%), Postives = 401/636 (63.05%), Query Frame = 1
Query:  250 ISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSL----TNKG---QECDSEVIEALSKTHVLKTAPTVSDED----RDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKE------EEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLR-IDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGT------MTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSSL 2085
            ++IK+AILIQ WYRR  A+LEA+RR TW I+ ++EY+GEQDQLKL  FF D++        KG      +S ++ ALS  H  K  P++ D +    + +   T    + ++  YKG  L+ PL   QV  +IE+F+  ++LH +Y+L +L   R + K  P+VS+ STSIS +VTICGDLHG+ DDL  I YKN +P   NPYI NGDFVDRG  S+E+  +LF+  ++ P S++LNRGNHEDH+MN RYGF+KE+  KYK  +  I R   D+FSWLP+ TIID  I V HGGIS    +  ++K+ RH+F SVL+ PV       KE      +EW Q+LD++WSDP+   GC  N +RGGG YFG DIT   L+K+   LL+RSHECK +GYE+ H N  +T+FSASNYY+ GSN+GA+++ I       F QY   K ++K  TL + +  +EESA+++LK K+ +F  +L +EF   D+   G + + +W   +E +  L LPW  L P +  LS++GK      +   + D +   + GT      + E LY++K  LET+FR MDKDNSG +S+ EF DAC++L ++T R +  + I  +A+ +D NKDG ID NE LEAFR+VD  L
Sbjct:   81 LTIKSAILIQKWYRRCEARLEARRRATWQIFTALEYAGEQDQLKLYDFFADVIRAMAEENGKGGVENGRNSPLMSALS--HYAK--PSLMDSEGETVKKMLEDTSPTNVDIDRNYKGPTLSLPLDKPQVAKMIEAFKVNKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASKTHRKS-TLRERLGVVEESAVKELKEKLSSFHTDLQKEFEIMDIEKSGKLPILKWSDCVERITGLNLPWIALAPKVATLSEDGK------YVMYKEDRRIAQVGGTHAQEKDIVESLYRHKSTLETLFRFMDKDNSGQVSMKEFIDACEVLGKYTKRPLQTDYISQIAESIDFNKDGFIDLNELLEAFRLVDRPL 705          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 505.368 bits (1300), Expect = 9.763e-172
Identity = 247/548 (45.07%), Postives = 343/548 (62.59%), Query Frame = 1
Query:  481 TAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKE------EEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLR-IDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGT------MTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSSL 2085
            T+PT  D DR+               YKG  L+ PL   QV  +IE+F+  ++LH +Y+L +L   R + K  P+VS+ STSIS +VTICGDLHG+ DDL  I YKN +P   NPYI NGDFVDRG  S+E+  +LF+  ++ P S++LNRGNHEDH+MN RYGF+KE+  KYK  +  I R   D+FSWLP+ TIID  I V HGGIS    +  ++K+ RH+F SVL+ PV       KE      +EW Q+LD++WSDP+   GC  N +RGGG YFG DIT   L+K+   LL+RSHECK +GYE+ H N  +T+FSASNYY+ GSN+GA+++ I       F QY   K ++K  TL + +  +EESA+++LK K+ +F  +L +EF   D+   G + + +W   +E +  L LPW  L P +  LS++GK      +   + D +   + GT      + E LY++K  LET+FR MDKDNSG +S+ EF DAC++L ++T R +  + I  +A+ +D NKDG ID NE LEAFR+VD  L
Sbjct:   45 TSPTNVDIDRN---------------YKGPTLSLPLDKPQVAKMIEAFKVNKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASKTHRKS-TLRERLGVVEESAVKELKEKLSSFHTDLQKEFEIMDIEKSGKLPILKWSDCVERITGLNLPWIALAPKVATLSEDGK------YVMYKEDRRIAQVGGTHAQEKDIVESLYRHKSTLETLFRFMDKDNSGQVSMKEFIDACEVLGKYTKRPLQTDYISQIAESIDFNKDGFIDLNELLEAFRLVDRPL 570          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pph-5 (Serine/threonine-protein phosphatase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q9NES8])

HSP 1 Score: 245.743 bits (626), Expect = 8.489e-73
Identity = 147/408 (36.03%), Postives = 215/408 (52.70%), Query Frame = 1
Query:  274 IQNWYRRYRAKLEAKR-RYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGI--SAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEH 1488
            ++ +YRR  A +   R +     YQ++      D+     F  D  S   + Q+ ++    A+S  H  KT     D          I  + +E +Y G +L   ++   V  LI++F+ +Q LH +Y  ++L    N +K+ P + + +    K+ TICGD+HGQ  DL  IF  N +P  +NPY+ NGDFVDRGS SVE    +  F LLYP   F++RGNHE  VMN  YGF  E++ KY     ++   F + F WLPL  +I+  I VCHGG+     + L+ I K DR++     Q P E I           + DLLWSDP+   G S ++ RG GC FGPD+T+   +   +  ++RSHE K +GYE  H  +  T+FSA NY  Q +NKGAF+ I  ++
Sbjct:   96 VKGFYRRATANMALGRFKKALTDYQAVVKVCPNDKDARAKF--DECSKIVRRQKFEA----AISTDHDKKTVAETLD----------INAMAIEDSYDGPRLEDKITKEFVLQLIKTFKNQQKLHKKYAFKMLLEFYNYVKSLPTMVEITVPTGKKFTICGDVHGQFYDLCNIFEINGYPSETNPYLFNGDFVDRGSFSVETIFTMIGFKLLYPNHFFMSRGNHESDVMNKMYGFEGEVKAKY---TQQMCDMFTETFCWLPLCHLINEKIFVCHGGLFKEDGVTLEDIRKTDRNR-----QPPDEGI-----------MCDLLWSDPQPINGRSPSK-RGVGCQFGPDVTSKWCETNGIEYVVRSHEVKPEGYEMHHNGQCFTVFSAPNYCDQMNNKGAFITITGDN 467          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: C47A4.3 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:Q9U3L7])

HSP 1 Score: 181.03 bits (458), Expect = 4.596e-51
Identity = 103/294 (35.03%), Postives = 160/294 (54.42%), Query Frame = 1
Query:  634 QILHARYLLELLDHTRNLLKT-KPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLN----LDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQF 1500
            +++    +L+LLD    + K  KP V      ++  + +CGD+HGQ  DL+ +F++  +P T+N Y+  GD+VDRG  S+E   +L ++ + +P + FL RGNHE   +N  YGF +E Q +Y+S   ++   F D+F+WLPL  +I   IL  HGG+S ++     LD + K++R                E KE     + DLLW+DP S     +N  RG GC FG D   ++  ++ L L+ R+H+   DGYE+    K+VT+FSA +Y  Q  N  AF+  D +    F
Sbjct:   25 KVITEERVLKLLDLALGVFKAQKPMVE-----VNAPIKVCGDIHGQFPDLLRLFHRGGWPPTAN-YLFLGDYVDRGRFSIETIVLLLAYKVKFPCNFFLLRGNHECEFVNKTYGFYEECQKRYQSV--RMYAAFQDVFNWLPLTGLIATKILCMHGGLSPLMTKEFTLDTLRKIER--------------PTEGKEG---LVADLLWADPISGLSGFMNNQRGAGCGFGRDSVLNLCSEFQLDLVCRAHQVVQDGYEFFAGRKLVTIFSAPHYCGQFDNCAAFMSCDEKLQCSF 293          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342946)

HSP 1 Score: 514.612 bits (1324), Expect = 6.464e-174
Identity = 258/612 (42.16%), Postives = 387/612 (63.24%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQ--ILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMT--EELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVD 2076
            +I+AAI IQ WYRR++A+ E +RR  W I+Q++EY+ EQDQ +L  FFNDL+            + +A  + +  + +  VS  D     + +   IV       AK+  P+  N +  LI+ FRK++   LH +Y+  +L      LK  PN+S  ST++S++VT+CGDLHG+LDDL+ + +KN  P +SNPY+ NGDFVDRG   +E+  +L S +L +P +VFLNRGNHED VMN RYGF++E++ KY  N  +I+ F  +++ WLPL +++++ +L+ HGG S   +LD+I+ +DR K++S+L+ P+ D +  +K  EW QI D++WSDP++  GC  N  RG G +FGPD+T++ L+++ LS +IRSHECK +G+E+ H+NK++T+FSASNYY  GSNKGA++R++N+    F QY +     K L+  Q +  +E SAL++L  ++   ++EL +EF + D  + G I +  WC VMENV KL LPWR LR  L   +   KV Y+   +    D      A  M+  + LY NK +L  IF I+D DNSG I+L EF  A  LL  H     S+  + +  + +D+N DG++D NEFLEAFR+ D
Sbjct:    5 AIRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIK----------HMPQAAGRKNQYQGSAHVSVLDDKDDLVEEFGDIV------NAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDK-TEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANKASLVAIFNIIDADNSGEITLDEFETAIDLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRLSD 599          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0473730)

HSP 1 Score: 514.227 bits (1323), Expect = 1.536e-173
Identity = 258/612 (42.16%), Postives = 387/612 (63.24%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQ--ILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMT--EELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVD 2076
            +I+AAI IQ WYRR++A+ E +RR  W I+Q++EY+ EQDQ +L  FFNDL+            + +A  + +  + +  VS  D     + +   IV       AK+  P+  N +  LI+ FRK++   LH +Y+  +L      LK  PN+S  ST++S++VT+CGDLHG+LDDL+ + +KN  P +SNPY+ NGDFVDRG   +E+  +L S +L +P +VFLNRGNHED VMN RYGF++E++ KY  N  +I+ F  +++ WLPL +++++ +L+ HGG S   +LD+I+ +DR K++S+L+ P+ D +  +K  EW QI D++WSDP++  GC  N  RG G +FGPD+T++ L+++ LS +IRSHECK +G+E+ H+NK++T+FSASNYY  GSNKGA++R++N+    F QY +     K L+  Q +  +E SAL++L  ++   ++EL +EF + D  + G I +  WC VMENV KL LPWR LR  L   +   KV Y+   +    D      A  M+  + LY NK +L  IF I+D DNSG I+L EF  A  LL  H     S+  + +  + +D+N DG++D NEFLEAFR+ D
Sbjct:   21 TIRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIK----------HMPQAAGRKNQYQGSAHVSVLDDKDDLVEEFGDIV------NAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDK-TEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANKASLVAIFNIIDADNSGEITLDEFETAIDLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRLSD 615          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342949)

HSP 1 Score: 514.998 bits (1325), Expect = 6.070e-173
Identity = 258/612 (42.16%), Postives = 387/612 (63.24%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQ--ILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMT--EELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVD 2076
            +I+AAI IQ WYRR++A+ E +RR  W I+Q++EY+ EQDQ +L  FFNDL+            + +A  + +  + +  VS  D     + +   IV       AK+  P+  N +  LI+ FRK++   LH +Y+  +L      LK  PN+S  ST++S++VT+CGDLHG+LDDL+ + +KN  P +SNPY+ NGDFVDRG   +E+  +L S +L +P +VFLNRGNHED VMN RYGF++E++ KY  N  +I+ F  +++ WLPL +++++ +L+ HGG S   +LD+I+ +DR K++S+L+ P+ D +  +K  EW QI D++WSDP++  GC  N  RG G +FGPD+T++ L+++ LS +IRSHECK +G+E+ H+NK++T+FSASNYY  GSNKGA++R++N+    F QY +     K L+  Q +  +E SAL++L  ++   ++EL +EF + D  + G I +  WC VMENV KL LPWR LR  L   +   KV Y+   +    D      A  M+  + LY NK +L  IF I+D DNSG I+L EF  A  LL  H     S+  + +  + +D+N DG++D NEFLEAFR+ D
Sbjct:   90 TIRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIK----------HMPQAAGRKNQYQGSAHVSVLDDKDDLVEEFGDIV------NAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDK-TEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANKASLVAIFNIIDADNSGEITLDEFETAIDLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRLSD 684          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342947)

HSP 1 Score: 514.998 bits (1325), Expect = 6.070e-173
Identity = 258/612 (42.16%), Postives = 387/612 (63.24%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQ--ILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMT--EELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVD 2076
            +I+AAI IQ WYRR++A+ E +RR  W I+Q++EY+ EQDQ +L  FFNDL+            + +A  + +  + +  VS  D     + +   IV       AK+  P+  N +  LI+ FRK++   LH +Y+  +L      LK  PN+S  ST++S++VT+CGDLHG+LDDL+ + +KN  P +SNPY+ NGDFVDRG   +E+  +L S +L +P +VFLNRGNHED VMN RYGF++E++ KY  N  +I+ F  +++ WLPL +++++ +L+ HGG S   +LD+I+ +DR K++S+L+ P+ D +  +K  EW QI D++WSDP++  GC  N  RG G +FGPD+T++ L+++ LS +IRSHECK +G+E+ H+NK++T+FSASNYY  GSNKGA++R++N+    F QY +     K L+  Q +  +E SAL++L  ++   ++EL +EF + D  + G I +  WC VMENV KL LPWR LR  L   +   KV Y+   +    D      A  M+  + LY NK +L  IF I+D DNSG I+L EF  A  LL  H     S+  + +  + +D+N DG++D NEFLEAFR+ D
Sbjct:   90 TIRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIK----------HMPQAAGRKNQYQGSAHVSVLDDKDDLVEEFGDIV------NAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDK-TEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANKASLVAIFNIIDADNSGEITLDEFETAIDLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRLSD 684          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342948)

HSP 1 Score: 514.998 bits (1325), Expect = 6.070e-173
Identity = 258/612 (42.16%), Postives = 387/612 (63.24%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQ--ILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMT--EELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVD 2076
            +I+AAI IQ WYRR++A+ E +RR  W I+Q++EY+ EQDQ +L  FFNDL+            + +A  + +  + +  VS  D     + +   IV       AK+  P+  N +  LI+ FRK++   LH +Y+  +L      LK  PN+S  ST++S++VT+CGDLHG+LDDL+ + +KN  P +SNPY+ NGDFVDRG   +E+  +L S +L +P +VFLNRGNHED VMN RYGF++E++ KY  N  +I+ F  +++ WLPL +++++ +L+ HGG S   +LD+I+ +DR K++S+L+ P+ D +  +K  EW QI D++WSDP++  GC  N  RG G +FGPD+T++ L+++ LS +IRSHECK +G+E+ H+NK++T+FSASNYY  GSNKGA++R++N+    F QY +     K L+  Q +  +E SAL++L  ++   ++EL +EF + D  + G I +  WC VMENV KL LPWR LR  L   +   KV Y+   +    D      A  M+  + LY NK +L  IF I+D DNSG I+L EF  A  LL  H     S+  + +  + +D+N DG++D NEFLEAFR+ D
Sbjct:   90 TIRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIK----------HMPQAAGRKNQYQGSAHVSVLDDKDDLVEEFGDIV------NAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDK-TEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANKASLVAIFNIIDADNSGEITLDEFETAIDLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRLSD 684          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppef1 (protein phosphatase, EF-hand calcium binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-080303-27])

HSP 1 Score: 333.569 bits (854), Expect = 3.903e-103
Identity = 165/335 (49.25%), Postives = 222/335 (66.27%), Query Frame = 1
Query:  184 IENSKKTSHHVKKIYSTGDTGPISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLL----SLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAP 1176
            IEN  + S     I  +     ++IKAAILIQ WYRRY A LE +RRYTW I+QSIEY+GEQDQL+L SFF  +L     +   G +  S +++++           +++E R L+Y    EQI+V  +Y G +L+FPLS+    AL+ +F++EQ LH +Y+L+LL  T+  LK  PNV   STS +K +TICGDLHG+LDDL+ IFYKN  P   NPYI NGDFVDRG  S EI  ILF+F LLYP  + LNRGNHEDH+MN RYGF +E+  KYK++  +I++   D+FS LP+ T+IDN +L+ HGGIS   +LD +  ++RHK  S L+ P
Sbjct:    9 IENQTRPSETDGSIKQSNPA--LTIKAAILIQRWYRRYVAHLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFTFMLDNFTQINGNGPDLISHLLDSV--------VDPLTEEVRQLKY----EQIMVPESYSGPRLSFPLSVTDTNALLSAFKEEQTLHGKYVLQLLYETKKFLKQMPNVIYLSTSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSTEIIIILFAFVLLYPDHMHLNRGNHEDHIMNLRYGFTREVMQKYKTHGREILQLLQDVFSLLPVATVIDNKVLIVHGGISDKTDLDFLSTVERHKVKSALRLP 329          

HSP 2 Score: 320.857 bits (821), Expect = 2.394e-98
Identity = 150/291 (51.55%), Postives = 200/291 (68.73%), Query Frame = 1
Query: 1201 KEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            +E EW Q++D+LWSDP+ + GCS N +RGGGCYFGPD+T  +L+K+ L LLIRSHECK +GYE CH  +V+T+FSASNYY++GSN+GA++++  E   +FFQY   +  +K LTL Q V   E SALR LK K+ A ++EL   F Q D+NN G I   EW  V+E+VL+L LPWRTLRP L +L  +G VEY S FE          +   + E LY+ + +LE IF I+DKD+SG IS+ EFR   KL   H    V+++ I+D+A+ +D NKDG IDF EFLEAFR+V
Sbjct:  429 EELEWQQVVDILWSDPKHQNGCSPNSFRGGGCYFGPDVTQTLLQKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYVKLGPELVPRFFQYQVSRSTRK-LTLHQRVRVAEGSALRALKEKLYAHRSELMAAFQQYDINNTGRISTSEWAQVVESVLRLDLPWRTLRPRLARLGTDGNVEYESCFEDISPGEPIPPVTPNLAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSSHLGVAVNDQTIDDMARSIDFNKDGSIDFTEFLEAFRVV 718          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppef1 (protein phosphatase, EF-hand calcium binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-080303-27])

HSP 1 Score: 332.028 bits (850), Expect = 9.192e-103
Identity = 160/312 (51.28%), Postives = 214/312 (68.59%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLL----SLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAP 1176
            +IKAAILIQ WYRRY A LE +RRYTW I+QSIEY+GEQDQL+L SFF  +L     +   G +  S +++++           +++E R L+Y    EQI+V  +Y G +L+FPLS+    AL+ +F++EQ LH +Y+L+LL  T+  LK  PNV   STS +K +TICGDLHG+LDDL+ IFYKN  P   NPYI NGDFVDRG  S EI  ILF+F LLYP  + LNRGNHEDH+MN RYGF +E+  KYK++  +I++   D+FS LP+ T+IDN +L+ HGGIS   +LD +  ++RHK  S L+ P
Sbjct:   19 AIKAAILIQRWYRRYVAHLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFTFMLDNFTQINGNGPDLISHLLDSV--------VDPLTEEVRQLKY----EQIMVPESYSGPRLSFPLSVTDTNALLSAFKEEQTLHGKYVLQLLYETKKFLKQMPNVIYLSTSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSTEIIIILFAFVLLYPDHMHLNRGNHEDHIMNLRYGFTREVMQKYKTHGREILQLLQDVFSLLPVATVIDNKVLIVHGGISDKTDLDFLSTVERHKVKSALRLP 318          

HSP 2 Score: 320.472 bits (820), Expect = 2.139e-98
Identity = 150/291 (51.55%), Postives = 200/291 (68.73%), Query Frame = 1
Query: 1201 KEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            +E EW Q++D+LWSDP+ + GCS N +RGGGCYFGPD+T  +L+K+ L LLIRSHECK +GYE CH  +V+T+FSASNYY++GSN+GA++++  E   +FFQY   +  +K LTL Q V   E SALR LK K+ A ++EL   F Q D+NN G I   EW  V+E+VL+L LPWRTLRP L +L  +G VEY S FE          +   + E LY+ + +LE IF I+DKD+SG IS+ EFR   KL   H    V+++ I+D+A+ +D NKDG IDF EFLEAFR+V
Sbjct:  418 EELEWQQVVDILWSDPKHQNGCSPNSFRGGGCYFGPDVTQTLLQKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYVKLGPELVPRFFQYQVSRSTRK-LTLHQRVRVAEGSALRALKEKLYAHRSELMAAFQQYDINNTGRISTSEWAQVVESVLRLDLPWRTLRPRLARLGTDGNVEYESCFEDISPGEPIPPVTPNLAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSSHLGVAVNDQTIDDMARSIDFNKDGSIDFTEFLEAFRVV 707          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppef1 (protein phosphatase, EF-hand calcium binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-080303-27])

HSP 1 Score: 332.028 bits (850), Expect = 9.192e-103
Identity = 160/312 (51.28%), Postives = 214/312 (68.59%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLL----SLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAP 1176
            +IKAAILIQ WYRRY A LE +RRYTW I+QSIEY+GEQDQL+L SFF  +L     +   G +  S +++++           +++E R L+Y    EQI+V  +Y G +L+FPLS+    AL+ +F++EQ LH +Y+L+LL  T+  LK  PNV   STS +K +TICGDLHG+LDDL+ IFYKN  P   NPYI NGDFVDRG  S EI  ILF+F LLYP  + LNRGNHEDH+MN RYGF +E+  KYK++  +I++   D+FS LP+ T+IDN +L+ HGGIS   +LD +  ++RHK  S L+ P
Sbjct:   19 AIKAAILIQRWYRRYVAHLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFTFMLDNFTQINGNGPDLISHLLDSV--------VDPLTEEVRQLKY----EQIMVPESYSGPRLSFPLSVTDTNALLSAFKEEQTLHGKYVLQLLYETKKFLKQMPNVIYLSTSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSTEIIIILFAFVLLYPDHMHLNRGNHEDHIMNLRYGFTREVMQKYKTHGREILQLLQDVFSLLPVATVIDNKVLIVHGGISDKTDLDFLSTVERHKVKSALRLP 318          

HSP 2 Score: 320.472 bits (820), Expect = 2.139e-98
Identity = 150/291 (51.55%), Postives = 200/291 (68.73%), Query Frame = 1
Query: 1201 KEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            +E EW Q++D+LWSDP+ + GCS N +RGGGCYFGPD+T  +L+K+ L LLIRSHECK +GYE CH  +V+T+FSASNYY++GSN+GA++++  E   +FFQY   +  +K LTL Q V   E SALR LK K+ A ++EL   F Q D+NN G I   EW  V+E+VL+L LPWRTLRP L +L  +G VEY S FE          +   + E LY+ + +LE IF I+DKD+SG IS+ EFR   KL   H    V+++ I+D+A+ +D NKDG IDF EFLEAFR+V
Sbjct:  418 EELEWQQVVDILWSDPKHQNGCSPNSFRGGGCYFGPDVTQTLLQKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYVKLGPELVPRFFQYQVSRSTRK-LTLHQRVRVAEGSALRALKEKLYAHRSELMAAFQQYDINNTGRISTSEWAQVVESVLRLDLPWRTLRPRLARLGTDGNVEYESCFEDISPGEPIPPVTPNLAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSSHLGVAVNDQTIDDMARSIDFNKDGSIDFTEFLEAFRVV 707          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: CU695117.1 (protein phosphatase with EF-hand domain 2a [Source:NCBI gene;Acc:100537120])

HSP 1 Score: 284.263 bits (726), Expect = 1.912e-84
Identity = 144/298 (48.32%), Postives = 191/298 (64.09%), Query Frame = 1
Query: 1195 ENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIF--EAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSS 2082
            +   +EW QILDLLWSDP S+ GC  N+ RGGGCY+GP+IT D L ++NL L+IRSHECK DGYE+CH  KVVTLFSASNYY+ GSN+GAF+R+  +    F QY       + L+  Q+V + E +AL+ L+ K+ A K++L   F + D  N G+I L +W   +E VL L LPWR L P LV  +  G + Y   F   A +  N   +I  +M E LY+++  LETIFRI+D DNSG IS  +FR   KLL  +    +S+E I +L   +D N DG ID +EF+EAFR+VD S
Sbjct:  382 DTSNDEWKQILDLLWSDPMSQDGCVPNEVRGGGCYWGPNITEDFLNRHNLQLIIRSHECKQDGYEFCHNRKVVTLFSASNYYEIGSNRGAFVRLGPDLMPYFIQYQATSMT-RGLSFPQNVKRTEHTALKVLREKLFAHKSDLLSAFQELDKENTGLISLSDWARAVERVLHLDLPWRILHPQLVSSTTNGMLNYHGWFCDLALKKPNS-EVIEQSMLETLYRHRSTLETIFRIVDTDNSGLISFEDFRQTLKLLSAYLKMEISDEVINELVVSMDTNNDGSIDIDEFMEAFRLVDKS 677          

HSP 2 Score: 280.411 bits (716), Expect = 4.590e-83
Identity = 135/291 (46.39%), Postives = 193/291 (66.32%), Query Frame = 1
Query:  307 LEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLL-SLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAP 1176
            +E +RRYTW I+QS+EY+  QDQ+KL +F   L+ + T    E    +I     +H+ +      D + +  +      I V   Y G +LTFPL ++Q   L+E+F+ +Q LH+RY+L+LL  T  LL+  PN+++ ST  SK +TICGDLHGQL+DL+ IFYKN  P    PY+ NGD+VDRG  S+E+  ILF+F L+YP  V+LNRGNHEDH++N RYGF KE+  KYK +  +I++    IFSWLPL+T+ID  +L+ HGGIS   NL +I ++DRH+++S L+ P
Sbjct:    1 MEMRRRYTWNIFQSMEYADLQDQIKLYNFLGYLVDNFTPSSSE--RNLI-----SHIFRENEVCRDAEWERYF--NYTNIDVPDIYSGPRLTFPLDMDQAADLVEAFKNKQQLHSRYVLQLLLETWKLLRVLPNINRVSTCHSKEITICGDLHGQLEDLLLIFYKNGMPSMEKPYVFNGDYVDRGKDSMEVLLILFAFLLVYPGDVYLNRGNHEDHIINLRYGFTKEVLGKYKLHGKRILKLLQKIFSWLPLVTVIDQRVLIVHGGISDSTNLALIARVDRHRYVSALRPP 282          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 240.35 bits (612), Expect = 9.448e-71
Identity = 134/350 (38.29%), Postives = 202/350 (57.71%), Query Frame = 1
Query:  532 IEQIVVEPTYKGAKL-TFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISA--MLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNK-QFFQYTT-HKKNQKHLTLIQSVNQI 1566
            IE + +E  Y G KL    +++  +  L++ F+ ++ LH +   ++L   + +L   P++ + +   S+++TICGD HGQ  DL+ IF  N  P  +NPY+ NGDFVDRGS SVE+   LF F LLYP+   L RGNHE   MN  YGF  E++ KY S   ++ + F+++F WLPL   I++ +LV HGG+ +   + LD I K+DR++     Q P           +   + DLLWSDP+ + G S+++ RG  C FGPD+T   L++  L  ++RSHE K +GYE  H  K +T+FSA NY  Q  NKGA++ +     K +F Q+T     N K +    S+ Q+
Sbjct:  157 IENMTIEDDYAGPKLEDGKVTLKFMEDLMDWFKDQKKLHRKCAYQILVQVKEVLTKLPSLVEITLKESEKITICGDTHGQYYDLLNIFELNSLPSPTNPYLFNGDFVDRGSFSVEVILTLFGFKLLYPEHFHLLRGNHETDNMNQMYGFEGEVKAKYSS---QMFKLFSEVFQWLPLAQCINDKVLVMHGGLFSEDGVTLDDIRKIDRNR-----QPP-----------DSGPMCDLLWSDPQLQNGRSISK-RGVSCQFGPDVTERFLEQNKLEYIVRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAYIHLRGSDLKPEFHQFTAVPHPNVKPMAYANSLMQM 486          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: usp43 (ubiquitin specific peptidase 43 [Source:Xenbase;Acc:XB-GENE-940625])

HSP 1 Score: 314.694 bits (805), Expect = 1.818e-96
Identity = 148/289 (51.21%), Postives = 200/289 (69.20%), Query Frame = 1
Query: 1207 EEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            +EW Q++D+LWSDPR++ GC+ N +RGGGCYFGP++T  +L KYN  +LIRSHECK +GYE CH  KVVT+FSASNYY +GSN+GA+L++  +   +F  Y   K  +K LTL Q V+ +E++ALR L+ KI A ++EL   F   D    G I + EW + +E VL L LPWRTLRP L+KL+ +G V+Y S FE  Q++     +   + E +Y+ K +LE IF I+DKD+SG IS+ EFR   KL   H + N+ + AI+DLA  +D NKDG IDFNEFLEAFR+V
Sbjct:  366 KEWKQVVDILWSDPRNQNGCTPNSFRGGGCYFGPNVTKKLLAKYNFKMLIRSHECKQEGYELCHNGKVVTIFSASNYYDEGSNRGAYLKLSPDLTPRFVPYQVSKCTRK-LTLHQRVSAVEDTALRALREKIYAHRSELINAFKLCDPKETGKISISEWASAVEAVLHLDLPWRTLRPRLIKLTSDGSVDYLSSFEDLQIEQPIKEVQPNLVETIYRYKADLEIIFNIIDKDHSGLISVEEFRQTWKLFSSHLHINIDDSAIDDLAHSIDTNKDGSIDFNEFLEAFRVV 653          

HSP 2 Score: 256.144 bits (653), Expect = 1.354e-74
Identity = 132/312 (42.31%), Postives = 185/312 (59.29%), Query Frame = 1
Query:  250 ISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVED 1185
            ++IKAAILIQ WYR Y A+LE +RRYT  I+QSIEY+ EQ QL+L +FF  ++      +    ++I  +S +             ++       E+I V  +Y G ++TFPL+++   AL+ +F++ Q LHARY+L+L   T+  LK  PN+   STS SK +TICGDLHG+LDDL+ IFYKN  P T N Y+ NGD VDRG +S+EI  +LF+F L+YP +V +NRGNHED +MN                            S LPL TI+D+ +L+ HGGI    +LD +  +DR K+ S L+ P  D
Sbjct:   17 LAIKAAILIQRWYRFYTARLEMRRRYTLNIFQSIEYAEEQAQLQLSNFFTFMMDHFAHWKGQGPDLISDISNS-------------KEGHKFIDYEKIEVPNSYGGPRITFPLTVSDTNALLRAFKQGQQLHARYVLQLFHETKKFLKQLPNIVHLSTSYSKEITICGDLHGKLDDLLLIFYKNGLPSTENHYLFNGDLVDRGKNSIEILVLLFTFLLMYPNNVHINRGNHEDPIMN---------------------------LSRLPLATIVDSKVLILHGGIGDKTDLDFLSSIDRFKYKSALRTPKTD 288          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: PPEF2 (protein phosphatase, EF-hand calcium binding domain 2 [Source:NCBI gene;Acc:100496073])

HSP 1 Score: 296.59 bits (758), Expect = 2.460e-89
Identity = 150/292 (51.37%), Postives = 195/292 (66.78%), Query Frame = 1
Query: 1204 EEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFL-MIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVD 2076
            +EE  QI+D+LWSDP  + GC  N  RGGGCYFGPD+T  IL+K+ L +LIRSHECK +GYE+CH  KV+T+FSASNYY+ GSNKGAF+++  +    F QY   +    +LTL Q V+ +EESALR L+ K+ A K++L   F   D N  G I L +W  V+E+VL L LPWR LRP L+  S EG + Y   F+   V       +  ++ E LY+N+ +LETIFRI+D D+SG IS  EF+   KLL  H N  VS+EAI  +A+ +D NKDG ID NEFLEAFR+VD
Sbjct:  405 DEEKKQIVDILWSDPIPQDGCKSNTVRGGGCYFGPDVTEKILQKHGLQMLIRSHECKQEGYEFCHSGKVLTIFSASNYYEVGSNKGAFVKLGPDLVPHFVQYQASRLTN-NLTLRQRVSTVEESALRALREKLFAHKSDLMNAFRNYDNNQTGYINLSDWAIVLESVLNLGLPWRMLRPQLIHSSPEGLLRYREWFDELSVCQPIQEHLHDSLLEALYRNRSDLETIFRIIDSDSSGLISFEEFQHTWKLLSSHLNIEVSDEAICKMARSIDFNKDGNIDINEFLEAFRLVD 695          

HSP 2 Score: 288.115 bits (736), Expect = 4.173e-86
Identity = 141/299 (47.16%), Postives = 192/299 (64.21%), Query Frame = 1
Query:  304 KLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLS-LTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNE 1197
            ++E +RR TW I+QSIEY+GEQDQ+KL  FFN L+   T    +    +    ++    K        D +L+     E I V  +Y G  L+FP+     TAL+E+F++ Q LH+RY+L LL  T+  LK  PN+ + STS  K +TICGDLHG+LDDL  IFYKN  P    PYI NGDFVDRG  S+EI  ILF+F L+YP+ V LNRGNHED+++N RYGF KE+  KYK +  KI++    +FSWLPL T+ID  +LV HGG+S   +L+++ K++RHKF S L+   +  KN+
Sbjct:    1 QMEVRRRCTWSIFQSIEYTGEQDQIKLYDFFNLLMDHFTPDNSKERDFICRIFTEEENFK--------DTELEKYCDYETIEVPESYTGPHLSFPIKPTHATALVEAFKQNQQLHSRYVLHLLHETKKYLKQLPNIKRISTSYGKEITICGDLHGRLDDLFLIFYKNGLPSPEKPYIFNGDFVDRGKQSIEILMILFAFQLVYPKVVHLNRGNHEDYIVNLRYGFTKEVMKKYKVHGKKILKMLQSVFSWLPLATLIDQKVLVTHGGVSDTTDLEILSKIERHKFASTLRPHKKKEKNK 291          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 235.343 bits (599), Expect = 1.970e-68
Identity = 132/364 (36.26%), Postives = 202/364 (55.49%), Query Frame = 1
Query:  421 KGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLT-FPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISA--MLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFF 1503
            K QEC       L +    + A      +R +     IE + +E  Y G +L    ++I+ +  L++ ++ ++ LH + + ++L   +++L   P++ + S   S++VT+CGD HGQ  DL+ IF+ N  P  +NPYI NGDFVDRGS SVE+   LF F LLYP    L RGNHE   MN  YGF  E++ KY +   ++ + F+++F WLPL   ++  +L+ HGG+ +   + LD I  ++R++     Q P           +   + DLLWSDP+ + G S ++ RG  C FGPD+T   L++  L  +IRSHE K +GYE  H    VT+FSA NY  Q  NKGA++ ++    K  F
Sbjct:  147 KFQECSK-----LVRQKAFERAIACEQHNRSVVDSLDIEGMTIEDEYTGPQLKDGNVTIDFMLELMQFYKDQKKLHRKCVYQMLVQVKDILSKLPSLVEISLEKSQQVTVCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAHFHLLRGNHETDTMNQMYGFEGEVKAKYSA---QMFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTLDQIRSIERNR-----QPP-----------DSGPMCDLLWSDPQPQDGRSSSK-RGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNGSDLKPKF 485          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 221.861 bits (564), Expect = 1.626e-63
Identity = 128/364 (35.16%), Postives = 195/364 (53.57%), Query Frame = 1
Query:  421 KGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLT-FPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISA--MLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFF 1503
            K QEC       L +    + A      +R +     IE + +E  Y G +L    ++I+ +  L++ ++ ++ LH + + ++L   +++L   P++ + S   S++VT+CGD HGQ  DL+ IF+ N  P  +NPYI NGDFVDRGS SVE+   LF F LLYP    L RGNHE   MN  YGF  E++ KY +   ++ + F+++F WLPL   ++  +L+ HGG+ +   + LD I  ++R++     Q P   +           I    +SD RS      +  RG  C FGPD+T   L++  L  +IRSHE K +GYE  H    VT+FSA NY  Q  NKGA++ ++    K  F
Sbjct:  147 KFQECSK-----LVRQKAFERAIACEQHNRSVVDSLDIEGMTIEDEYTGPQLKDGNVTIDFMLELMQFYKDQKKLHRKCVYQMLVQVKDILSKLPSLVEISLEKSQQVTVCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAHFHLLRGNHETDTMNQMYGFEGEVKAKYSA---QMFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTLDQIRSIERNR-----QPPDSGVTLVLLLLLSFPI----FSDGRS------SSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNGSDLKPKF 487          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 208.379 bits (529), Expect = 7.709e-59
Identity = 128/365 (35.07%), Postives = 189/365 (51.78%), Query Frame = 1
Query:  421 KGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLT-FPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISA--MLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQ 1506
            K QEC       L +    + A      +R +     IE + +E  Y G +L    ++I+ +  L++ ++ ++ LH                 +  V Q    +S  + +CGD HGQ  DL+ IF+ N  P  +NPYI NGDFVDRGS SVE+   LF F LLYP    L RGNHE   MN  YGF  E++ KY +   ++ + F+++F WLPL   ++  +L+ HGG+ +   + LD I  ++R++     Q P           +   + DLLWSDP+ + G S ++ RG  C FGPD+T   L++  L  +IRSHE K +GYE  H    VT+FSA NY  Q  NKGA++ ++    K  F 
Sbjct:  130 KFQECSK-----LVRQKAFERAIACEQHNRSVVDSLDIEGMTIEDEYTGPQLKDGNVTIDFMLELMQFYKDQKKLH-----------------RKCVYQVRFCLS--LYMCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAHFHLLRGNHETDTMNQMYGFEGEVKAKYSA---QMFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTLDQIRSIERNR-----QPP-----------DSGPMCDLLWSDPQPQDGRSSSK-RGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNGSDLKPKFH 450          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef1 (protein phosphatase with EF hand calcium-binding domain 1 [Source:MGI Symbol;Acc:MGI:1097157])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 294/636 (46.23%), Postives = 401/636 (63.05%), Query Frame = 1
Query:  256 IKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSD-EDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPV----EDIKNENK----------------------EEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQY---TTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            IKAA++IQNWYRRYRA+L  ++ Y   I+QSIEYS EQ Q++L SFF+ +L    K    DS ++     T +       S  +DRD  +L  IE   V  +Y G +L FPL+   +  L+++F+++QILHA Y+LE+L   R +LK  PN S   T  +K +TICGDLHG+LDDL+ IFYKN  P  +NPY+ NGDFVDRG++S+EI  IL   FL+YP  + LNRGNHED +MN RYGF KEI  KYK +  KI++   ++++WLP+ TIIDN ILV HGGIS   +L+ + +L R+K  SVL  PV    E  +  NK                      ++EW QI+D+LWSDPR K GC  N  RGGGCYFGPD+T+ +L K  L +LIRSHECK DGYE  H+ KV+T+FSASNYY++GSN+GA++R+      QFFQY   +T   N  H    Q +N +E SA + LK K+++ K +L   F  +D +  G I L EW   MEN+L L LPWR+L  HLV +   G V+Y S F+  +++     +   +TE +Y+ + +L+ IF I+D D SG IS+ EFR   KL + H   ++ +  I++LA  +D NKDG IDFNEFL+AF +V
Sbjct:   17 IKAALVIQNWYRRYRARLRVRQHYALAIFQSIEYSDEQGQMQLSSFFSFMLENYTKTNNEDSALV-----TRIFDNTRRESQIKDRD-DFLGLIE---VPDSYDGPRLQFPLTFTDIHILLQAFKQQQILHAHYVLEVLFEARKVLKQMPNFSHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNSMEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGRKILQVLEEVYTWLPIGTIIDNEILVIHGGISESTDLNTLHQLQRNKMKSVLMPPVLGNQETGEKRNKSASNYVEPRKVEPDKTPSEDLTKQEWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLKMLIRSHECKPDGYEVSHDGKVITVFSASNYYEEGSNRGAYIRLSYGTMPQFFQYQVTSTSCLNPLH----QRMNAMESSAFKILKEKMISRKTDLINAFELRDHSRSGRISLAEWAFSMENILGLNLPWRSLSSHLVTIDSSGSVDYMSSFDDIRIEKPTKDMKSNLTETMYRYRSDLKIIFNIIDSDQSGLISMDEFRTMWKLFNAHYKAHIDDSQIDELASIVDFNKDGNIDFNEFLKAFYVV 639          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef2 (protein phosphatase, EF hand calcium-binding domain 2 [Source:MGI Symbol;Acc:MGI:1342304])

HSP 1 Score: 313.153 bits (801), Expect = 4.141e-95
Identity = 151/320 (47.19%), Postives = 207/320 (64.69%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEE 1212
            + KAA LIQ WYRRY A+LE +RR TW I+QSIEY+G+QDQ+KL  FF+ L+         + + +  +              +D + +     E I V  +Y G +L+FPL  +  TAL+E+FR  Q LHARY+L LL  TR  L   PN+++ ST  S+ VT+CGDLHGQLDDL+ IFYKN  P     Y+ NGDFVDRG  SVE+  +LF+F L+YP+   LNRGNHEDH++N RYGF KE+  KYK +  KI+R   D+F WLPL T++D  +LV HGG+S   +L+++ KLDRHK +S ++      ++EN+EE+
Sbjct:   19 AFKAAALIQRWYRRYMARLEMRRRCTWNIFQSIEYAGQQDQVKLHEFFSYLVDHFTPSSHHERDFLNRMFTEERFA-------QDVETEEGGDFESIEVPDSYTGPRLSFPLLPDHATALVEAFRLRQQLHARYVLNLLYETRKHLAQLPNINRVSTCYSEEVTVCGDLHGQLDDLIFIFYKNGLPSPERAYVFNGDFVDRGKDSVEVLMVLFAFMLVYPKEFHLNRGNHEDHLVNLRYGFTKEVMHKYKIHGKKILRTLQDVFCWLPLATLVDEKVLVLHGGVSDKTDLELLAKLDRHKIVSTMRCKTRK-ESENREEQ 330          

HSP 2 Score: 308.145 bits (788), Expect = 2.711e-93
Identity = 147/299 (49.16%), Postives = 207/299 (69.23%), Query Frame = 1
Query: 1195 ENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEA---QQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSS 2082
            E   EEW Q++D+LWSDP ++ GC  N  RGGGCYFGPD+T  +++KY L LLIRSHECK +GYE+CH  KV+T+FSASNYY+ GSN+GA++++         QY  +K   + LT+ Q ++++EESALR L+ K+ A  ++L  EF ++D +  GVI L +W T +E+VL L LPWR LRP LV  S +  +EY S  ++   +Q+  +   I  ++ E+LY+N+ NLETIFRI+D D+SG ISL EFR   KL   H + +++++ I DLA+ +D NKDG ID NEFLEAFR+V+ S
Sbjct:  436 EPTPEEWKQVVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKATHR-LTMRQRISRVEESALRALRQKLFAHSSDLLVEFRKRDPDESGVITLSDWATAVESVLHLGLPWRMLRPQLVNSSADNVLEYRSWLDSLAKEQLSRE--NIQSSLLEKLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMSIDITDDGICDLARSIDFNKDGHIDINEFLEAFRLVEQS 731          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef2 (protein phosphatase, EF hand calcium-binding domain 2 [Source:MGI Symbol;Acc:MGI:1342304])

HSP 1 Score: 313.153 bits (801), Expect = 4.141e-95
Identity = 151/320 (47.19%), Postives = 207/320 (64.69%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEE 1212
            + KAA LIQ WYRRY A+LE +RR TW I+QSIEY+G+QDQ+KL  FF+ L+         + + +  +              +D + +     E I V  +Y G +L+FPL  +  TAL+E+FR  Q LHARY+L LL  TR  L   PN+++ ST  S+ VT+CGDLHGQLDDL+ IFYKN  P     Y+ NGDFVDRG  SVE+  +LF+F L+YP+   LNRGNHEDH++N RYGF KE+  KYK +  KI+R   D+F WLPL T++D  +LV HGG+S   +L+++ KLDRHK +S ++      ++EN+EE+
Sbjct:   19 AFKAAALIQRWYRRYMARLEMRRRCTWNIFQSIEYAGQQDQVKLHEFFSYLVDHFTPSSHHERDFLNRMFTEERFA-------QDVETEEGGDFESIEVPDSYTGPRLSFPLLPDHATALVEAFRLRQQLHARYVLNLLYETRKHLAQLPNINRVSTCYSEEVTVCGDLHGQLDDLIFIFYKNGLPSPERAYVFNGDFVDRGKDSVEVLMVLFAFMLVYPKEFHLNRGNHEDHLVNLRYGFTKEVMHKYKIHGKKILRTLQDVFCWLPLATLVDEKVLVLHGGVSDKTDLELLAKLDRHKIVSTMRCKTRK-ESENREEQ 330          

HSP 2 Score: 308.145 bits (788), Expect = 2.711e-93
Identity = 147/299 (49.16%), Postives = 207/299 (69.23%), Query Frame = 1
Query: 1195 ENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEA---QQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSS 2082
            E   EEW Q++D+LWSDP ++ GC  N  RGGGCYFGPD+T  +++KY L LLIRSHECK +GYE+CH  KV+T+FSASNYY+ GSN+GA++++         QY  +K   + LT+ Q ++++EESALR L+ K+ A  ++L  EF ++D +  GVI L +W T +E+VL L LPWR LRP LV  S +  +EY S  ++   +Q+  +   I  ++ E+LY+N+ NLETIFRI+D D+SG ISL EFR   KL   H + +++++ I DLA+ +D NKDG ID NEFLEAFR+V+ S
Sbjct:  436 EPTPEEWKQVVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKATHR-LTMRQRISRVEESALRALRQKLFAHSSDLLVEFRKRDPDESGVITLSDWATAVESVLHLGLPWRMLRPQLVNSSADNVLEYRSWLDSLAKEQLSRE--NIQSSLLEKLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMSIDITDDGICDLARSIDFNKDGHIDINEFLEAFRLVEQS 731          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef1 (protein phosphatase with EF hand calcium-binding domain 1 [Source:MGI Symbol;Acc:MGI:1097157])

HSP 1 Score: 226.868 bits (577), Expect = 7.952e-69
Identity = 109/212 (51.42%), Postives = 148/212 (69.81%), Query Frame = 1
Query:  502 EDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEK 1137
            +DRD  +L  IE   V  +Y G +L FPL+   +  L+++F+++QILHA Y+LE+L   R +LK  PN S   T  +K +TICGDLHG+LDDL+ IFYKN  P  +NPY+ NGDFVDRG++S+EI  IL   FL+YP  + LNRGNHED +MN RYGF KEI  KYK +  KI++   ++++WLP+ TIIDN ILV HGGIS   +L+ + +
Sbjct:   30 KDRD-DFLGLIE---VPDSYDGPRLQFPLTFTDIHILLQAFKQQQILHAHYVLEVLFEARKVLKQMPNFSHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNSMEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGRKILQVLEEVYTWLPIGTIIDNEILVIHGGISESTDLNTLHQ 237          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppp5c (protein phosphatase 5, catalytic subunit [Source:MGI Symbol;Acc:MGI:102666])

HSP 1 Score: 228.024 bits (580), Expect = 6.364e-66
Identity = 125/332 (37.65%), Postives = 190/332 (57.23%), Query Frame = 1
Query:  532 IEQIVVEPTYKGAKLT-FPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISA--MLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRID-NEHNKQFFQYTT 1515
            IE + +E  Y G KL    ++I  +  L++ ++ ++ LH +   ++L   + +L     + + +   ++++T+CGD HGQ  DL+ IF  N  P  +NPYI NGDFVDRGS SVE+   LF F LLYP    L RGNHE   MN  YGF  E++ KY +   ++   F+++F WLPL   I+  +L+ HGG+ +   + LD I K++R++     Q P           +   + DLLWSDP+ + G SV++ RG  C FGPD+T   L++  L  +IRSHE K +GYE  H  + VT+FSA NY  Q  NK +++ +  ++   QF Q+T 
Sbjct:  167 IESMTIEDEYSGPKLEDGKVTITFMKDLMQWYKDQKKLHRKCAYQILVQVKEVLCKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTA---QMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNR-----QPP-----------DSGPMCDLLWSDPQPQNGRSVSK-RGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTA 478          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|G5EBX9|PPE_CAEEL (Serine/threonine-protein phosphatase with EF-hands pef-1 OS=Caenorhabditis elegans OX=6239 GN=pef-1 PE=1 SV=1)

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 285/636 (44.81%), Postives = 401/636 (63.05%), Query Frame = 1
Query:  250 ISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSL----TNKG---QECDSEVIEALSKTHVLKTAPTVSDED----RDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKE------EEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLR-IDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGT------MTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSSL 2085
            ++IK+AILIQ WYRR  A+LEA+RR TW I+ ++EY+GEQDQLKL  FF D++        KG      +S ++ ALS  H  K  P++ D +    + +   T    + ++  YKG  L+ PL   QV  +IE+F+  ++LH +Y+L +L   R + K  P+VS+ STSIS +VTICGDLHG+ DDL  I YKN +P   NPYI NGDFVDRG  S+E+  +LF+  ++ P S++LNRGNHEDH+MN RYGF+KE+  KYK  +  I R   D+FSWLP+ TIID  I V HGGIS    +  ++K+ RH+F SVL+ PV       KE      +EW Q+LD++WSDP+   GC  N +RGGG YFG DIT   L+K+   LL+RSHECK +GYE+ H N  +T+FSASNYY+ GSN+GA+++ I       F QY   K ++K  TL + +  +EESA+++LK K+ +F  +L +EF   D+   G + + +W   +E +  L LPW  L P +  LS++GK      +   + D +   + GT      + E LY++K  LET+FR MDKDNSG +S+ EF DAC++L ++T R +  + I  +A+ +D NKDG ID NE LEAFR+VD  L
Sbjct:   81 LTIKSAILIQKWYRRCEARLEARRRATWQIFTALEYAGEQDQLKLYDFFADVIRAMAEENGKGGVENGRNSPLMSALS--HYAK--PSLMDSEGETVKKMLEDTSPTNVDIDRNYKGPTLSLPLDKPQVAKMIEAFKVNKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASKTHRKS-TLRERLGVVEESAVKELKEKLSSFHTDLQKEFEIMDIEKSGKLPILKWSDCVERITGLNLPWIALAPKVATLSEDGK------YVMYKEDRRIAQVGGTHAQEKDIVESLYRHKSTLETLFRFMDKDNSGQVSMKEFIDACEVLGKYTKRPLQTDYISQIAESIDFNKDGFIDLNELLEAFRLVDRPL 705          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|Q3SWT6|PPE1_RAT (Serine/threonine-protein phosphatase with EF-hands 1 OS=Rattus norvegicus OX=10116 GN=Ppef1 PE=2 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 282/623 (45.26%), Postives = 401/623 (64.37%), Query Frame = 1
Query:  256 IKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEE-----------------EWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            ++AA++IQNWYRRYRA+L A++ Y   I+QSIEY+ EQ Q++L SFF+ +L       + DS ++  L +   L++      +DR+ +Y+  I+   V  +Y G +L FPL+   +  L+++F+++Q LHA Y+LE+L   R +LK  PN ++  T  +K +TICGDLHG+LDDL+ IFYKN  P   NPY+ NGDFVDRG++S+EI  IL   FL+YP  + LNRGNHED +MN RYGF KEI  KYK +  KI++   ++++WLP+ TIIDN ILV HGGIS   +L+++++L R+K  SVL  P+   +  N ++                 EW QI+DLLWSDPR K GC  N  RGGGCYFGPD+T+ +L K  L ++IRSHECK DGYE CH+ KV+T+FSASNYY++GSN+GA++R+    + QFFQY     +  +  L Q VN +E SA R LK +++A K +L   F  +D +  G I L +W   ME++L L LPWR+L  HLV     G V+Y S F+   ++     +   + E +Y+ + +L+ IF I+D D SG IS+ EFR   KL + H   ++ +  I++LA  +D NKDG IDFNEFL AF +V
Sbjct:   17 VRAALIIQNWYRRYRARLSARQHYALAIFQSIEYADEQGQMQLSSFFSFMLENYTNTHKEDSALVSRLFENTRLES------KDRE-EYVGLID---VPDSYDGPRLQFPLTFTDINLLLQAFKQQQTLHAHYVLEVLFEARKILKQMPNFTRIQTFPAKEITICGDLHGKLDDLMLIFYKNGLPSEKNPYVFNGDFVDRGNNSMEILMILLVSFLVYPTDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGKKILQVLEELYTWLPIGTIIDNEILVIHGGISESTDLNILQQLQRNKMKSVLMPPMSTNQECNIKKNKAGPSEQSASEQLTKLEWEQIIDLLWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLNKNQLKMVIRSHECKPDGYEICHDGKVITVFSASNYYEEGSNRGAYIRLSYGTSPQFFQYQVTSTSCLN-PLYQRVNAMEFSAFRILKERMIARKTDLINAFELRDHSRTGKISLAQWAFSMESILGLNLPWRSLSSHLVSTDSSGSVDYMSSFDDIHIEKPMKDMKSDLIETMYRYRSDLKIIFNIIDTDQSGLISMDEFRTMWKLFNAHYKVHIDDSQIDELASTMDSNKDGNIDFNEFLRAFYVV 628          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|O14829|PPE1_HUMAN (Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens OX=9606 GN=PPEF1 PE=1 SV=1)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 279/641 (43.53%), Postives = 401/641 (62.56%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHV------LKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNEN----------------------------KEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            S++AA++IQNWYR Y+A+L+A++ Y   I+QSIEY+ EQ Q++L +FF+ +L                 + TH+      L+     S++D   ++   ++ I V  +Y G +L FPL+   +  L+E+F+++QILHA Y+LE+L  T+ +LK  PN +   TS SK VTICGDLHG+LDDL  IFYKN  P   NPY+ NGDFVDRG +S+EI  IL   FL+YP  + LNRGNHED +MN RYGF KEI  KYK +  +I++   + ++WLP+ TI+DN ILV HGGIS   +L+++ +++R+K  SVL  P E  ++ +                             E EW QI+D+LWSDPR K GC  N  RGGGCYFGPD+T+ IL KY L +LIRSHECK +GYE CH+ KVVT+FSASNYY++GSN+GA++++ +    +FFQY   K       L Q V+ +E SA++ L+ ++++ K++L   F  +D    G + + +W   MEN+L L LPWR+L  +LV + + G VEY S F+  +++        T+ E LY+ + +LE IF  +D D+SG IS+ EFR   KL   H N ++ +  +  LA  +D+NKDG IDFNEFL+AF +V
Sbjct:   16 SLRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLSTFFSFMLE----------------NYTHIHKEELELRNQSLESEQDMRDRW-DYVDSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQ-PLRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEYMSSFQNIRIEKPVQEAHSTLVETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFLKAFYVV 638          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|O35655|PPE1_MOUSE (Serine/threonine-protein phosphatase with EF-hands 1 OS=Mus musculus OX=10090 GN=Ppef1 PE=2 SV=2)

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 294/636 (46.23%), Postives = 401/636 (63.05%), Query Frame = 1
Query:  256 IKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSD-EDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPV----EDIKNENK----------------------EEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQY---TTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            IKAA++IQNWYRRYRA+L  ++ Y   I+QSIEYS EQ Q++L SFF+ +L    K    DS ++     T +       S  +DRD  +L  IE   V  +Y G +L FPL+   +  L+++F+++QILHA Y+LE+L   R +LK  PN S   T  +K +TICGDLHG+LDDL+ IFYKN  P  +NPY+ NGDFVDRG++S+EI  IL   FL+YP  + LNRGNHED +MN RYGF KEI  KYK +  KI++   ++++WLP+ TIIDN ILV HGGIS   +L+ + +L R+K  SVL  PV    E  +  NK                      ++EW QI+D+LWSDPR K GC  N  RGGGCYFGPD+T+ +L K  L +LIRSHECK DGYE  H+ KV+T+FSASNYY++GSN+GA++R+      QFFQY   +T   N  H    Q +N +E SA + LK K+++ K +L   F  +D +  G I L EW   MEN+L L LPWR+L  HLV +   G V+Y S F+  +++     +   +TE +Y+ + +L+ IF I+D D SG IS+ EFR   KL + H   ++ +  I++LA  +D NKDG IDFNEFL+AF +V
Sbjct:   17 IKAALVIQNWYRRYRARLRVRQHYALAIFQSIEYSDEQGQMQLSSFFSFMLENYTKTNNEDSALV-----TRIFDNTRRESQIKDRD-DFLGLIE---VPDSYDGPRLQFPLTFTDIHILLQAFKQQQILHAHYVLEVLFEARKVLKQMPNFSHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNSMEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGRKILQVLEEVYTWLPIGTIIDNEILVIHGGISESTDLNTLHQLQRNKMKSVLMPPVLGNQETGEKRNKSASNYVEPRKVEPDKTPSEDLTKQEWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLKMLIRSHECKPDGYEVSHDGKVITVFSASNYYEEGSNRGAYIRLSYGTMPQFFQYQVTSTSCLNPLH----QRMNAMESSAFKILKEKMISRKTDLINAFELRDHSRSGRISLAEWAFSMENILGLNLPWRSLSSHLVTIDSSGSVDYMSSFDDIRIEKPTKDMKSNLTETMYRYRSDLKIIFNIIDSDQSGLISMDEFRTMWKLFNAHYKAHIDDSQIDELASIVDFNKDGNIDFNEFLKAFYVV 639          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|P40421|RDGC_DROME (Serine/threonine-protein phosphatase rdgC OS=Drosophila melanogaster OX=7227 GN=rdgC PE=2 SV=1)

HSP 1 Score: 514.612 bits (1324), Expect = 6.479e-173
Identity = 258/612 (42.16%), Postives = 387/612 (63.24%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQ--ILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMT--EELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVD 2076
            +I+AAI IQ WYRR++A+ E +RR  W I+Q++EY+ EQDQ +L  FFNDL+            + +A  + +  + +  VS  D     + +   IV       AK+  P+  N +  LI+ FRK++   LH +Y+  +L      LK  PN+S  ST++S++VT+CGDLHG+LDDL+ + +KN  P +SNPY+ NGDFVDRG   +E+  +L S +L +P +VFLNRGNHED VMN RYGF++E++ KY  N  +I+ F  +++ WLPL +++++ +L+ HGG S   +LD+I+ +DR K++S+L+ P+ D +  +K  EW QI D++WSDP++  GC  N  RG G +FGPD+T++ L+++ LS +IRSHECK +G+E+ H+NK++T+FSASNYY  GSNKGA++R++N+    F QY +     K L+  Q +  +E SAL++L  ++   ++EL +EF + D  + G I +  WC VMENV KL LPWR LR  L   +   KV Y+   +    D      A  M+  + LY NK +L  IF I+D DNSG I+L EF  A  LL  H     S+  + +  + +D+N DG++D NEFLEAFR+ D
Sbjct:    5 AIRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIK----------HMPQAAGRKNQYQGSAHVSVLDDKDDLVEEFGDIV------NAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDK-TEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANKASLVAIFNIIDADNSGEITLDEFETAIDLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRLSD 599          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A267DFW7 (Serine/threonine-protein phosphatase with EF-hands OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022204g1 PE=3 SV=1)

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 346/690 (50.14%), Postives = 467/690 (67.68%), Query Frame = 1
Query:  109 QMGCAQSNSPKHEYDNIYNSPKENIIENSKKTSHHVKKIYSTGDTG----------PISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYL---------------TKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKE---EEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLM-----IAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDS 2079
            +MGC  S+S   + +      ++   ++ KK  H  +K   +  TG           +SIK+A+LIQ WYRRY+A+LEA+RR TWMIYQSIEYS E  QL L +FF+D++ L       D +  +   + H+          +R  + L               T  E I VE +Y+G  L+FPLS + V  LI+SFR+   LH+RYLL+LL   R LLKTKPNV QASTSIS++VT+ GDLHG+LDDL+ IFYKN  PD +NPY+ NGDFVDRG++SVE AA+LF+  L++P +VF+NRGNHEDH+MN RYGF+KE+Q KYK+ ANKIVR F D FSWLPL T ID+ ILV HGGIS  ++++ ++KLDRH++LS L+ PV D  NEN +   +EW Q+LDLLWSDP+ + GC+ N +RGGGCYFGP+IT   L+K+  SLL+RSHECK DG+E+CH   V+TLFSASNYY+ GSNKGA+ + D E      QY   K   + L + + ++ +EE AL+DL+ K++A K EL   F + D +  G I L +WC  ME  L+L LPWRTLRPHL +L+K+G++ Y + F+   +  K        +AG++TE +YKNKE LETIFRIMDKDNSG ISL EF+++C++L + T R ++E  + D+A+ +D+N DG IDFNEFLEAFRI+D+
Sbjct:   33 KMGCGPSSSADDDSEQQQQPLQKQQKDDGKK--HGKQKRSKSPQTGGKDVTDASVEALSIKSALLIQKWYRRYKARLEARRRTTWMIYQSIEYSSEASQLHLYNFFSDMMQL------ADGKQPQQPQQQHLSPAGSGDPANNRFAERLRQKSLEEEDQELLELTSYEGIQVEKSYRGPHLSFPLSASHVQVLIDSFRQGTQLHSRYLLQLLHEARLLLKTKPNVYQASTSISRQVTVVGDLHGKLDDLLVIFYKNGLPDVTNPYVFNGDFVDRGANSVETAALLFACLLVWPSAVFINRGNHEDHLMNCRYGFIKEVQAKYKTPANKIVRLFGDTFSWLPLATNIDDKILVTHGGISDKVDMERVQKLDRHQYLSALKPPVSD--NENAKVDYKEWRQVLDLLWSDPKPQAGCAPNTFRGGGCYFGPNITEAFLRKHKFSLLVRSHECKPDGWEFCHGGAVLTLFSASNYYEDGSNKGAYAKFDAEGKPHIVQYMASKA--RKLPVGRRLSTVEEGALKDLRAKVIASKTELTAAFQRFDPDKTGSIRLADWCEAMEQTLRLGLPWRTLRPHLAQLAKDGRLLYMTSFDCVSIQTKLGASAGKEVAGSLTEAVYKNKEELETIFRIMDKDNSGQISLDEFQESCRVLTQATGRQMTEAEVGDMARSMDLNSDGYIDFNEFLEAFRIIDT 710          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A1I8F2Q4 (Serine/threonine-protein phosphatase with EF-hands OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 349/682 (51.17%), Postives = 466/682 (68.33%), Query Frame = 1
Query:  112 MGCAQSNSPKHEYDNIYNSPKENIIENSKKTSHHVKKIYSTGDTG----------PISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKL-------QSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLL-YPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKE---EEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLM-----IAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDS 2079
            MGC  S+S   + +      ++   ++ KK  H  +K   +  TG           +SIK+A+LIQ WYRRY+A+LEA+RR TWMIYQSIEYS E  QL L       Q      LS    G   ++   E L +        ++ +ED++L  LT  E I VE +Y+G  L+FPLS + V  LI+SFR+   LH+RYLL+LL   R LLKTKPNV QASTSIS++VT+ GDLHG+LDDL+ IFYKN  PD +NPY+ NGDFVDRG++SVE AA+LF+  LL +P +VF+NRGNHEDH+MN RYGF+KE+Q KYK+ ANKIVR F D FSWLPL T ID+ ILV HGGIS  ++++ ++KLDRH++LS L+ PV D  NEN +   +EW Q+LDLLWSDP+ + GC+ N +RGGGCYFGP+IT   L+K+  SLL+RSHECK DG+E+CH   V+TLFSASNYY+ GSNKGA+ + D E      QY   K   + L + + ++ +EE AL+DL+ K++A K EL   F + D +  G I L +WC  ME  L+L LPWRTLRPHL +L+K+G++ Y + F+   +  K        +AG++TE +YKNKE LETIFRIMDKDNSG ISL EF+++C++L + T R ++E  + D+A+ +D+N DG IDFNEFLEAFRI+D+
Sbjct:    1 MGCGPSSSADDDSEQQQQPLQKQQKDDGKK--HGKQKRSKSPQTGGKDVTDASVEALSIKSALLIQKWYRRYKARLEARRRTTWMIYQSIEYSSEASQLHLLQTESSPQQPQQQHLSPAGSGDPANNRFAERLRQK-------SLEEEDQELLELTSYEGIQVEKSYRGPHLSFPLSASHVQVLIDSFRQGTQLHSRYLLQLLHEARLLLKTKPNVYQASTSISRQVTVVGDLHGKLDDLLVIFYKNGLPDVTNPYVFNGDFVDRGANSVETAALLFACCLLVWPSAVFINRGNHEDHLMNCRYGFIKEVQAKYKTPANKIVRLFGDTFSWLPLATNIDDKILVTHGGISDKVDMERVQKLDRHQYLSALKPPVSD--NENAKVDYKEWRQVLDLLWSDPKPQAGCAPNTFRGGGCYFGPNITEAFLRKHKFSLLVRSHECKPDGWEFCHGGAVLTLFSASNYYEDGSNKGAYAKFDAEGKPHIVQYMASKA--RKLPVGRRLSTVEEGALKDLRAKVIASKTELTAAFQRFDPDKTGSIRLADWCEAMEQTLRLGLPWRTLRPHLAQLAKDGRLLYMTSFDCVSIQTKLGASAGKEVAGSLTEAVYKNKEELETIFRIMDKDNSGQISLDEFQESCRVLTQATGRQMTEAEVGDMARSMDLNSDGYIDFNEFLEAFRIIDT 669          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A1I8HDQ7 (Serine/threonine-protein phosphatase with EF-hands OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 321/636 (50.47%), Postives = 449/636 (70.60%), Query Frame = 1
Query:  250 ISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQEC---DSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISK--------------------RVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKE-EEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLM---IAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVD 2076
            +S+++A+LIQ WYRRY+A+LEA+R+ +WMIYQSIEYS E  QL L +FFND+L L          ++   E L +  + +    + +        T   +I VE  YKG KL+FPLS   V  +I+SFR+  +LHARYLL+LL  TR++LKT+ N+   S+SISK                    +VT+ GDLHG+L+DL+ + YKN  PD +NPYI NGDFVDRG +SVEI AILF+  L++P +VFLNRGNHED VMN RYGF+KE+Q KY+  ANK++  F+++F+W+PL T+ID+ + V HGGIS  ++LD + +LDRH+++SVL+ PV    +E  +  EW Q+LDLLWSDP+++PGC  N +RGGGCYFGP++T   L KY   LL+RSHECK DG+E+CHE+ V+T+FSASNYY++GSNKGA+++ D+E   +  Q+   ++++  L   Q ++ +EESALRDL+GKILA K+EL + F++ D    G I + +WC+ ME  L+L LPWRTLRPHL +L+K+G++ Y S F+   + ++      +A ++TE +YKNKE LETIFRIMDKDNSG ISL EF+++C++L + T R ++E+ + D+AK LD+N DG IDFNEFLEAFRIVD
Sbjct:   59 VSLQSAVLIQKWYRRYKARLEARRQTSWMIYQSIEYSSESSQLHLYNFFNDMLRLGGGSVGGASANAGFAERLRQRSIEEEDEELLEH-------TGYSEITVERNYKGPKLSFPLSATHVQLMIDSFRQGGLLHARYLLQLLHETRSVLKTRQNIQLVSSSISKQLDSVIKKLSLNANFHAPILKVTVVGDLHGKLEDLLIVLYKNGLPDVTNPYIFNGDFVDRGPNSVEILAILFACQLVWPSAVFLNRGNHEDQVMNLRYGFIKEVQYKYRQTANKVLNMFSEVFAWMPLATVIDDRVFVTHGGISDKVDLDRVRRLDRHRYVSVLRPPVAKSSDEKVDYMEWRQVLDLLWSDPKAQPGCKPNTFRGGGCYFGPNVTRAFLDKYGYKLLVRSHECKQDGWEFCHEDTVLTVFSASNYYEEGSNKGAYVKFDSECRPRLVQFVASRRDK--LPKGQRLSSVEESALRDLRGKILANKSELIDAFLRLDPEKTGAIRVSQWCSTMEEQLRLELPWRTLRPHLAQLNKDGRLLYMSTFQRAAIQHRLSGGKEMANSVTETVYKNKEELETIFRIMDKDNSGQISLEEFKESCRILCQATQRQMTEDEVADMAKSLDLNSDGYIDFNEFLEAFRIVD 685          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A2B4SS40 (Serine/threonine-protein phosphatase with EF-hands OS=Stylophora pistillata OX=50429 GN=Ppef1 PE=3 SV=1)

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 321/613 (52.37%), Postives = 441/613 (71.94%), Query Frame = 1
Query:  250 ISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEE--EWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSS 2082
            I+I++AILIQ W+RRY+A++EA+RR TW I+QS+EY+GEQDQLKL +FFND+L+    G   D+  ++ L K     +  T+S     L+ LT   +I VE TYKG  +  PL++  V  +IE ++  ++LH +Y+L +L  TR  LK  PN+ +AST ISK++TICGDLHG+LDDL  IF+KN  P   NPYI NGD VDRG +SVEIA ILFSFFLLYP  V++NRGNHEDH+MN RYGFVKE+  KYK +++K+++ F DIF WLPL T+++N IL+ HGGIS + +L  I+K+DRHK++S+L+ P  D  + +  +  EW Q+LDLLWSDP+  PGC  N +RGGGCYFGPDIT+ ILKK++L LL+RSHECK +GYE+ H  KV+T+FSAS+YY+QGSN+GA+++I  + N  F QY    K +KHLTL Q +  +EESA+R+L+ ++ A K  L   F ++D  N G +   +W + +E+VLKL +PW  LR  L  +  +GKVEY S F+   ++        ++TE LY+++ NLETIFR+MDKDNSG +S+ EF + C LL+ HTN N+  ++IEDLAK +D++KDG IDFNEFLEAFR+VD S
Sbjct:   22 IAIRSAILIQKWFRRYQARIEARRRCTWKIFQSVEYAGEQDQLKLFNFFNDMLNHVADG---DNNAVDILRKGSASSSTSTISKTSEKLEMLTDPSKITVEETYKGPHVALPLTLLTVRNIIELYKSHKLLHVKYVLLILRETREKLKVLPNIYRASTRISKQITICGDLHGKLDDLFVIFHKNGLPSAENPYIFNGDLVDRGPYSVEIAIILFSFFLLYPTGVYINRGNHEDHIMNLRYGFVKEVMDKYKEHSSKVMQLFGDIFGWLPLATVVNNKILITHGGISNITDLSFIDKIDRHKYVSILKPPGMDKAHPDTFDLLEWRQVLDLLWSDPKPFPGCKPNTFRGGGCYFGPDITDRILKKHDLELLVRSHECKFEGYEYMHGGKVITIFSASDYYEQGSNRGAYMKIGPDMNPYFVQYQA-SKAKKHLTLKQRIGIVEESAIRELRERLYANKIALMAAFEERDKGNTGYLTATQWASAVESVLKLDVPWNMLRHQLAHVLPDGKVEYRSCFDQYIIETGLHKNGPSITETLYRHRSNLETIFRLMDKDNSGFVSMEEFEECCHLLNEHTNSNIPVDSIEDLAKSIDMDKDGHIDFNEFLEAFRLVDHS 630          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A1I8IY93 (Serine/threonine-protein phosphatase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 329/629 (52.31%), Postives = 446/629 (70.91%), Query Frame = 1
Query:  232 TGDTGPISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLT------NKGQECDSEVIEALSKTHVLKTAP----TVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLM----IAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVD 2076
                G ISI++A+LIQ WYRRY+A+LEA+RR TWMIYQSIEYS E  QL L +FFND+LSLT      +      +E ++     H   T      +  +EDR+L  LT    + VE +Y+G  LTFPLS + V  +I+SFR+   LH RYLL+LL  TR  L+ KPNV  ASTSISK+VT+ GDLHG+LDDL+ +FYKN  PD +NPY+ NGDFVDRG++SVE+AA+LF+  L++P +V +NRGNHEDHVMN RYGF+KE+Q KY+ +A+KIV+ FA++F+W+PL T+ID+ ILV HGGIS  L+L+++ +LDRH++LS L+ P  D +  +   EW Q+LDLLWSDP+ + GC  N +RGGGCYFGPD+T   L+K  L+LL+RSHECK DGYE+CH+  V+T+FSASNYY++GSN+GA+++ D+       QY   +   + L + + ++ +EE AL+ L+ ++LA K EL   F + D    G I L +WC  M+  L+L LPWRTLRPHL +L+K G++ Y + FE   +D   L     +A ++TE +YKNKE LETIFRIMDKD+SG ISL EFRD+C++L   T R +++  +E +AK +D+N DG IDFNEFLEAFRIVD
Sbjct:  129 AASAGEISIRSAVLIQKWYRRYKARLEARRRTTWMIYQSIEYSSESSQLHLYNFFNDMLSLTGVGGGGHPSGAAAAEPLKTCVVGHRRFTERLRQLSQEEEDRELLDLTSFADLSVEKSYRGPHLTFPLSASHVQLMIDSFRQGGQLHPRYLLQLLHETRLALRAKPNVHSASTSISKQVTVIGDLHGKLDDLLIVFYKNGLPDITNPYVFNGDFVDRGANSVEVAALLFACQLVWPTAVCVNRGNHEDHVMNCRYGFIKEVQTKYRHSASKIVKLFAEVFAWMPLATLIDDRILVAHGGISDKLDLELLRRLDRHRYLSALRPPGNDGEKVDY-LEWRQVLDLLWSDPKPQAGCRPNTFRGGGCYFGPDVTESFLRKNKLTLLVRSHECKQDGYEFCHDGAVLTVFSASNYYEEGSNRGAYVKFDSSGKPHIVQYMASR--SRRLPVGRRLSTVEEGALKGLRARVLASKTELLAAFQRLDPGRTGAIRLADWCQAMDETLRLDLPWRTLRPHLAELNKSGRLLYMTCFERVALDAGRLAGTKEVAASLTEAVYKNKEELETIFRIMDKDSSGQISLEEFRDSCRVLSEATGRQMADAEVEAMAKAMDLNNDGYIDFNEFLEAFRIVD 754          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ppef1 (serine/threonine-protein phosphatase with EF-hands 1 [Source:NCBI gene;Acc:103021363])

HSP 1 Score: 333.183 bits (853), Expect = 3.350e-103
Identity = 163/319 (51.10%), Postives = 219/319 (68.65%), Query Frame = 1
Query:  223 IYSTGDTGPISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTA-PTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAP 1176
            I + G    +++KAAILIQ WYRRY A+LE +RRYTW I+QSIEY+GEQDQL+L SFF+ +L    +      ++I     +H+L +A   V DE R  +Y    EQIVV  +Y G +L+FPLS+     L+ +F+++Q LHA+Y+L+LL  T+  LK  PNV   S+S +K +TICGDLHG+LDDL+ IFYKN  P   NPYI NGDFVDRG  S+EI  ILF+F LLYP  + LNRGNHEDH+MN RYGF KE+  KYK++  +I++   D+FS LP+ TIIDN +L+ HGGIS   +L+ +  ++R K  S L+ P
Sbjct:    9 IENQGRPSEVAMKAAILIQRWYRRYVARLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFSFMLDNFTQLNGNGPDLI-----SHLLDSAVDPVVDEVRQSKY----EQIVVPESYSGPRLSFPLSVTDTNVLLSAFKEQQTLHAKYVLQLLHETQKFLKQMPNVIYLSSSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSIEIIIILFAFLLLYPDHMHLNRGNHEDHIMNLRYGFTKEVMQKYKTHGREILQLLQDVFSLLPIATIIDNKVLIVHGGISDKTDLEFLASVERQKVKSALRLP 318          

HSP 2 Score: 323.168 bits (827), Expect = 1.883e-99
Identity = 151/291 (51.89%), Postives = 203/291 (69.76%), Query Frame = 1
Query: 1201 KEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            +E EW QI+D+LWSDP+ + GCS N +RGGGCYFGPD+T ++LKK+ L LLIRSHECK +GYE CH  +V+T+FSASNYY++GSN+GA++++  E   +FFQY   +  +K LTL Q V+  E SAL+ L+ K+   ++EL   F Q D+NN G I + EW  V++ VL+L LPWRTLRP LV+L+ +G VEY S FE          +     E LY+ + +LE IF I+DKD+SG IS+ EFR   KL   H   +V ++AI D+A+ +D NKDG IDFNEFLEAFR+V
Sbjct:  417 EELEWRQIVDVLWSDPKIQNGCSPNSFRGGGCYFGPDVTQNLLKKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYIKLGPELIPRFFQYQVSRSTRK-LTLQQRVSVAESSALKALQEKLFTHRSELMAFFQQYDINNTGRISINEWAQVLDTVLRLDLPWRTLRPRLVRLASDGNVEYESCFENISAGQPLPQVTPNFAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSAHLGVDVDDQAIVDMARNIDFNKDGSIDFNEFLEAFRVV 706          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ppef1 (serine/threonine-protein phosphatase with EF-hands 1 [Source:NCBI gene;Acc:103021363])

HSP 1 Score: 330.872 bits (847), Expect = 2.747e-102
Identity = 161/310 (51.94%), Postives = 216/310 (69.68%), Query Frame = 1
Query:  250 ISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTA-PTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAP 1176
            +++KAAILIQ WYRRY A+LE +RRYTW I+QSIEY+GEQDQL+L SFF+ +L    +      ++I     +H+L +A   V DE R  +Y    EQIVV  +Y G +L+FPLS+     L+ +F+++Q LHA+Y+L+LL  T+  LK  PNV   S+S +K +TICGDLHG+LDDL+ IFYKN  P   NPYI NGDFVDRG  S+EI  ILF+F LLYP  + LNRGNHEDH+MN RYGF KE+  KYK++  +I++   D+FS LP+ TIIDN +L+ HGGIS   +L+ +  ++R K  S L+ P
Sbjct:   29 LTMKAAILIQRWYRRYVARLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFSFMLDNFTQLNGNGPDLI-----SHLLDSAVDPVVDEVRQSKY----EQIVVPESYSGPRLSFPLSVTDTNVLLSAFKEQQTLHAKYVLQLLHETQKFLKQMPNVIYLSSSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSIEIIIILFAFLLLYPDHMHLNRGNHEDHIMNLRYGFTKEVMQKYKTHGREILQLLQDVFSLLPIATIIDNKVLIVHGGISDKTDLEFLASVERQKVKSALRLP 329          

HSP 2 Score: 323.168 bits (827), Expect = 2.248e-99
Identity = 151/291 (51.89%), Postives = 203/291 (69.76%), Query Frame = 1
Query: 1201 KEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            +E EW QI+D+LWSDP+ + GCS N +RGGGCYFGPD+T ++LKK+ L LLIRSHECK +GYE CH  +V+T+FSASNYY++GSN+GA++++  E   +FFQY   +  +K LTL Q V+  E SAL+ L+ K+   ++EL   F Q D+NN G I + EW  V++ VL+L LPWRTLRP LV+L+ +G VEY S FE          +     E LY+ + +LE IF I+DKD+SG IS+ EFR   KL   H   +V ++AI D+A+ +D NKDG IDFNEFLEAFR+V
Sbjct:  428 EELEWRQIVDVLWSDPKIQNGCSPNSFRGGGCYFGPDVTQNLLKKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYIKLGPELIPRFFQYQVSRSTRK-LTLQQRVSVAESSALKALQEKLFTHRSELMAFFQQYDINNTGRISINEWAQVLDTVLRLDLPWRTLRPRLVRLASDGNVEYESCFENISAGQPLPQVTPNFAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSAHLGVDVDDQAIVDMARNIDFNKDGSIDFNEFLEAFRVV 717          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ENSAMXT00000016118.2 (pep primary_assembly:Astyanax_mexicanus-2.0:14:38271079:38284894:-1 gene:ENSAMXG00000015666.2 transcript:ENSAMXT00000016118.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 313.923 bits (803), Expect = 5.991e-96
Identity = 150/307 (48.86%), Postives = 208/307 (67.75%), Query Frame = 1
Query:  256 IKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAP 1176
            ++AA+LIQ WYR+Y A+LE +RR TW I+QSIEYSGEQDQ+KL +FF  L+          + +      +H+ + +    D + +  +  K   I V   Y G  LTFPL++N +T L+E+F+ +Q LHARY+L+LL  T  LL+  PN+++ ST  SK +TICGDLHGQL+DL+ +FYKN  P    PY+ NGDFVDRG  S+EI  ILF+F L+YP  V LNRGNHEDH++N RYGF KE+  KY+ +  KI++    IFSWLPL T+ID  +L+ HGGIS   +L +I KL+R++++S L+ P
Sbjct:    1 MRAALLIQRWYRQYVARLEMRRRCTWNIFQSIEYSGEQDQIKLYNFFGFLMDHFTPASSERNLI------SHIFRESEVFQDAEWEPYFCYK--SIDVPDMYTGPHLTFPLTVNIITELVEAFKHKQHLHARYVLQLLGETWRLLRILPNINEVSTFHSKEITICGDLHGQLEDLLLVFYKNGLPSVETPYVFNGDFVDRGKDSIEILLILFAFQLVYPNDVHLNRGNHEDHIVNLRYGFTKEVLGKYRVHGKKILKLLQKIFSWLPLATVIDQKVLILHGGISDTTDLKLIAKLERNRYVSALRPP 299          

HSP 2 Score: 299.286 bits (765), Expect = 1.663e-90
Identity = 148/298 (49.66%), Postives = 199/298 (66.78%), Query Frame = 1
Query: 1195 ENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLS-KEGKVEYSSIF-EAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSS 2082
            E   EEW QI+D+LWSDP S+ GC  N+ RGGGCY+GPDIT D+L ++NL LLIRSHECK DGYE+CH  +V+T+FSASNYY+ GSN+GA++R+  + N    QY    ++ + LTL QSV + E SALR L+ ++ A K++L   + + D  + GVI ++ W    E VL+L LPWR LR  LV  S ++G + Y+  F E   +D    +    + E +Y++  NLETIFRI+D D+SG IS  EFR   KLL  H    +S++AI DLA  +D NKDG ID NEF+EAFR+VD S
Sbjct:  398 ETDAEEWKQIVDMLWSDPMSQDGCIPNEVRGGGCYWGPDITEDVLNRHNLRLLIRSHECKQDGYEFCHNRRVLTIFSASNYYEVGSNRGAYIRLGPDLNPHVVQYQA-SRSTRELTLRQSVGRTERSALRALREQVFAHKSDLTSAYEEFDPEHTGVISMKHWAVATETVLQLGLPWRVLREQLVGDSTQDGIINYNDWFRELALMDPNTELAHTGLLETMYRHHSNLETIFRIIDTDHSGLISFEEFRQTWKLLSSHLKMEISDKAISDLALSIDFNKDGSIDINEFMEAFRLVDCS 694          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: PPEF2 (protein phosphatase with EF-hand domain 2 [Source:HGNC Symbol;Acc:HGNC:9244])

HSP 1 Score: 295.049 bits (754), Expect = 2.793e-88
Identity = 146/308 (47.40%), Postives = 203/308 (65.91%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAP 1176
            +I+AA+LIQ WYR+Y A++E +RRYTW I+QSIEY+G+QDQ+KL +F   L+          + +     +  V +        D + +       I V   Y G +LTFPL+ +Q   L+E+FR +Q LH+RY+L+LL  T  LL+  PN+++ ST  SK +TICGDLHGQL+DL+ IFYKN  P     Y+ NGDFVDRG  S+EI  ILF+F L+YP  V LNRGNHEDH++N RYGF KE+  KYK +  +I++    IFSWLPL T+ID  +L+ HGGIS   +L ++ ++DRHK++S L+ P
Sbjct:   32 AIRAAVLIQRWYRQYVARMELRRRYTWNIFQSIEYAGQQDQIKLYNFLGYLVDNFTPSSNERNLISHIFRENEVCR--------DIEWERFFDYRHIEVPDIYSGPRLTFPLNADQAADLVEAFRSKQQLHSRYVLQLLGETWKLLRVLPNINRISTCHSKEITICGDLHGQLEDLLLIFYKNGMPSMEKAYVFNGDFVDRGKDSIEILLILFAFLLVYPGEVHLNRGNHEDHIINLRYGFTKEVLGKYKMHGKRILKLLQKIFSWLPLATVIDQKVLIVHGGISDTTDLALVARVDRHKYVSSLRPP 331          

HSP 2 Score: 286.189 bits (731), Expect = 5.487e-85
Identity = 138/298 (46.31%), Postives = 197/298 (66.11%), Query Frame = 1
Query: 1195 ENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNK-FLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSSL 2085
            EN + EW QILDLLWSDP    GC  N+ RGGGCY+GP++T + L K+++ L+IRSHECK DGYE+CH  KV+T+FSASNYY+ GSN+GAF+R+  +    F QY  +    + +++ QS+ + E SAL+ L+ ++ A K++L   F Q D  N G+I L +W + M  VL L LPWR LR  L+  + +  ++Y + F    +  K +  I  T+ + LYK++  LETIFRI+D DNSG IS  +FR   KLL+ +    +SEE+I DL   +D NKDG ID +EF+E+FR+VD ++
Sbjct:  436 ENVQNEWKQILDLLWSDPMIPDGCVPNEVRGGGCYWGPNVTEEFLNKHSMQLIIRSHECKQDGYEFCHNRKVLTIFSASNYYEVGSNRGAFVRLGPDLVPYFIQYQANSMT-REMSVRQSLRRTEHSALKVLREQLFAHKSDLMSAFQQHDKENTGLISLSDWGSAMSQVLHLDLPWRMLRSQLITTTTDDMLDYHNWFRNLAIKEKSYEHIEQTLLDTLYKHRSTLETIFRIVDTDNSGFISFEDFRQTWKLLNAYLKMEISEESINDLVVSIDTNKDGNIDIDEFMESFRLVDKNM 732          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ppp5c (protein phosphatase 5 catalytic subunit [Source:NCBI gene;Acc:103034548])

HSP 1 Score: 234.958 bits (598), Expect = 1.004e-68
Identity = 125/332 (37.65%), Postives = 194/332 (58.43%), Query Frame = 1
Query:  532 IEQIVVEPTYKGAKLT-FPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISA--MLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNK-QFFQYTT 1515
            IE + +E  Y G KL    +++  +  +++ F+ ++ LH +   ++L   + +L   P++ + +   ++++TICGD HGQ  DL+ IF  N  P  +NPY+ NGDFVDRGS S+E+   LF F LLYP    L RGNHE   MN  YGF  E++ KY +   ++ + F+++F WLPL   I++ +LV HGG+ +   + LD + K+DR++     Q P           +   + DLLWSDP+ + G S+++ RG  C FGPD+T   L++  L  ++RSHE K +GYE  H  K +T+FSA NY  Q  NKGA++ +     K +F Q+T 
Sbjct:  160 IENMTIEDEYAGPKLEDGKVTLKFMKEMMDWFKDQKKLHRKCAYQMLVQVKEVLSKLPSLVEITLKETEKITICGDTHGQYYDLLNIFELNGLPSPTNPYLFNGDFVDRGSFSMEVILTLFGFKLLYPDHFHLLRGNHETDNMNQMYGFEGEVKAKYTA---QMFQLFSEVFQWLPLAQCINSKVLVMHGGLFSEDGVTLDDLRKIDRNR-----QPP-----------DSGPMCDLLWSDPQPQNGRSISK-RGVSCQFGPDVTQRFLEQNKLQYIVRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAYIHLRGSDLKPEFHQFTA 471          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 239.195 bits (609), Expect = 2.752e-71
Identity = 146/408 (35.78%), Postives = 226/408 (55.39%), Query Frame = 1
Query:  274 IQNWYRRYRAKLE-AKRRYTWMIYQSIEYSGEQDQ-LKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKL-TFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISK--RVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISA--MLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRI 1476
            I+ +YRR  AK+   K +     Y+++      D+  KL            K QEC S+++    K    + A    D  + +     ++ + +E  Y G K+    ++I  +  LIE F+ ++ LH +Y  ++L   +  L+  P++ + +    +   +T+CGD+HGQ  DL+ IF  N  P  +NPY+ NGDFVDRGS SVE+  +LF F LLYP    L RGNHE   MN  YGF  E++ KY +   ++  FF+++F WLPL   I++ +L+ HGG+ +   + LD I K+DR++     Q P           +   + DLLWSDP+ +PG SV++ RG  C FGPD++   +++ NL L+IRSHE K DGYE  H+ + VT+FSA NY  Q  NKG+++ +
Sbjct:   56 IKGYYRRATAKMALGKFKEALKDYETVVKVKPNDKDAKL------------KYQEC-SKIV----KRKAFERAIASDDSKKSVADALDLDSMAIEDDYTGPKVDNGQVTITFMKELIEWFKDQKKLHRKYAYQILLQVKQSLQKLPSLVEVTIKDEQGDMITVCGDIHGQYFDLLHIFELNGLPSETNPYVFNGDFVDRGSWSVEVILVLFGFKLLYPDHFHLMRGNHETDNMNQMYGFEGEVKAKYTA---QMFDFFSEVFQWLPLAMCINSRVLIMHGGLFSEDGVTLDDIRKIDRNR-----QPP-----------DSGPMCDLLWSDPQPQPGRSVSK-RGVSCQFGPDVSRAFMEQNNLELIIRSHE-KPDGYEVAHDGRCVTVFSAPNYCDQMGNKGSYIHL 425          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 154.836 bits (390), Expect = 2.673e-42
Identity = 93/248 (37.50%), Postives = 139/248 (56.05%), Query Frame = 1
Query:  739 VTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDP-RSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRID 1479
            + ICGD+HGQ  DL+ +F    FP  SN Y+  GD+VDRG  S+E   +L ++ + YP++ FL RGNHE  + N  YGF  E + +Y     K+ + F D F+ LP+  I+D  I  CHGG+S   +L  +E++ R      +  P  D+ ++        + DLLWSDP +   G   N  RG    FG ++    L K++L L+ R+H+   DGYE+  + ++VTLFSA NY  +  N GA + +D
Sbjct:   41 LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEASI-NRIYGFYDECKRRYNI---KLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP--DLQSMEQIRR------IMRPT-DVPDQG------LLCDLLWSDPDKDTMGWGEND-RGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVD 267          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.673 bits (374), Expect = 1.841e-40
Identity = 88/244 (36.07%), Postives = 136/244 (55.74%), Query Frame = 1
Query:  751 GDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDP-RSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRID 1479
            GD+HGQ  DL+ +F    FP  +N Y+  GD+VDRG  S+E   +L ++ + YP++ FL RGNHE   +N  YGF  E + ++     K+ + F D F+ LP+  I+D  I  CHGG+S   +L  +E++ R      +  P  D+ +     +   + DLLWSDP +   G   N  RG    FG D+ +  L +++L L+ R+H+   DGYE+  + ++VTLFSA NY  +  N G  + +D
Sbjct:    1 GDIHGQYTDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNI---KLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP--DLQSMEQIRR------IMRPT-DVPDTG---DAGLLCDLLWSDPDKDVQGWGEND-RGVSFTFGGDVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVD 227          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 134.035 bits (336), Expect = 1.553e-33
Identity = 89/267 (33.33%), Postives = 130/267 (48.69%), Query Frame = 1
Query:  727 ISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAML-NLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPG--------CSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENK------VVTLFSASNYYKQGSNKGAFLRIDN 1482
            I   VT+CGD+HGQ  DL+ +F     P  +  Y+  GD+VDRG  S+E    L++  +LYP ++FL RGNHE   +   + F +E +IKY            D F  LPL  +++   L  HGG+S  + NL+ I KLDR K                +   +  + DLLWSDP    G        C  N  RG   ++      D L+  NL  +IR+HE +  GY    +++      ++T+FSA NY    +NK A L+ +N
Sbjct:   64 IEAPVTVCGDIHGQFFDLMKLFEVGGSPANTR-YLFLGDYVDRGYFSIECVLYLWALKILYPTTLFLLRGNHECRHLTEYFTFKQECKIKYTETVYDAC---MDAFDCLPLAALMNQQFLCVHGGLSPEVHNLEDIRKLDRFK----------------EPPAFGPMCDLLWSDPSEDFGNEKTQEYFCH-NTVRGCSYFYSYPAVCDFLQNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYEN 309          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 114.39 bits (285), Expect = 4.779e-29
Identity = 70/195 (35.90%), Postives = 102/195 (52.31%), Query Frame = 1
Query:  739 VTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDP-RSKPGCSVNQYRGGGCYFGPDITN 1320
            + ICGD+HGQ  DL+ +F    FP  SN Y+  GD+VDRG  S+E   +L ++ + YP++ FL RGNHE   +N  YGF  E + ++     K+ + F D F+ LP+  I+D  I  CHGG+S   +L  +E++ R             I       +   + DLLWSDP +   G   N  RG    FG D+ +
Sbjct:   45 LKICGDIHGQYTDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNI---KLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP--DLQSMEQIRR-------------IMRPTDVPDTGLLCDLLWSDPDKDVQGWGEND-RGVSFTFGADVVS 219          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPH21 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph22p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; forms nuclear foci upon DNA replication stress; PPH21 has a paralog, PPH22, that arose from the whole genome duplication [Source:SGD;Acc:S000002292])

HSP 1 Score: 190.66 bits (483), Expect = 1.307e-54
Identity = 110/309 (35.60%), Postives = 169/309 (54.69%), Query Frame = 1
Query:  589 SINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIF-YKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAML-NLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQY 1509
            +INQ+   IE   K + L    +  L     ++L+ + NV      I+  VTICGD+HGQ  DL+ +F      PDT+  Y+  GD+VDRG +SVE  + L +  + YP  + + RGNHE   +   YGF  E   KY S AN + + F D+F + P+  ++DN I   HGG+S M+  +D + +L+R          ++++ +E        + DLLWSDP  + G  ++  RG G  FG D++       +LSL+ R+H+  ++GY W H+  VVT+FSA NY  +  N+ A + +D  HN+QF QY
Sbjct:   66 NINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVK----PINVPVTICGDVHGQFHDLLELFKIGGPCPDTN--YLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGS-AN-VWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNR----------IQEVPHEGP------MCDLLWSDPDDRGGWGISP-RGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQY 349          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPH22 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph21p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; protein abundance increases in response to DNA replication stress; dephosphorylates Tel1p/Mec1p-phosphorylated Cdc13p to promote telomerase release from telomeres at G2/M; PPH22 has a paralog, PPH21, that arose from the whole genome duplication [Source:SGD;Acc:S000002347])

HSP 1 Score: 189.889 bits (481), Expect = 2.993e-54
Identity = 111/309 (35.92%), Postives = 168/309 (54.37%), Query Frame = 1
Query:  589 SINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIF-YKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAML-NLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQY 1509
            +INQ+   IE   K + L    +  L     ++L+ + NV      I+  VTICGD+HGQ  DL+ +F      PDT+  Y+  GD+VDRG +SVE  + L +  + YP  + + RGNHE   +   YGF  E   KY S AN + + F D+F + P+  ++DN I   HGG+S M+  +D +  L+R          ++++ +E        + DLLWSDP  + G  ++  RG G  FG DI+       +LSL+ R+H+  ++GY W H+  VVT+FSA NY  +  N+ A + +D  HN+QF QY
Sbjct:   74 NINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVK----PINVPVTICGDVHGQFHDLLELFKIGGPCPDTN--YLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGS-AN-VWKMFTDLFDYFPVTALVDNKIFCLHGGLSPMIETIDQVRDLNR----------IQEVPHEGP------MCDLLWSDPDDRGGWGISP-RGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYSWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQY 357          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPT1 (Protein serine/threonine phosphatase; regulates Hsp90 chaperone by affecting its ATPase and cochaperone binding activities; has similarity to human phosphatase PP5; present in both the nucleus and cytoplasm; expressed during logarithmic growth [Source:SGD;Acc:S000003355])

HSP 1 Score: 178.718 bits (452), Expect = 5.572e-49
Identity = 105/314 (33.44%), Postives = 166/314 (52.87%), Query Frame = 1
Query:  556 TYKGAKLTFPLSINQVTALIES-FRKEQILHARYLLELLDHTRNLLKTKPNVSQA--STSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEH 1488
             +KGAK+   +S   ++ ++   F K + L  +Y+  ++ H   L + +P++ +   +++   ++++CGD HGQ  D++ +F K       + Y+ NGDFVDRGS S E+A + +   +L+P + FLNRGNHE   MN  YGF  E + KY   + +I   FA  F  LPL T+I+N  LV HGG+ +    D    L   K +     P  D             ++LLW+DP+   G   +Q RG G  FGPDIT+  L+   L  + RSHE ++ G ++  + K++T+FSA NY     N G  + +   H
Sbjct:  181 AFKGAKIK-NMSQEFISKMVNDLFLKGKYLPKKYVAAIISHADTLFRQEPSMVELENNSTPDVKISVCGDTHGQFYDVLNLFRKFGKVGPKHTYLFNGDFVDRGSWSCEVALLFYCLKILHPNNFFLNRGNHESDNMNKIYGFEDECKYKY---SQRIFNMFAQSFESLPLATLINNDYLVMHGGLPS----DPSATLSDFKNIDRFAQPPRD----------GAFMELLWADPQEANGMGPSQ-RGLGHAFGPDITDRFLRNNKLRKIFRSHELRMGGVQFEQKGKLMTVFSAPNYCDSQGNLGGVIHVVPGH 475          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPH3 (Catalytic subunit of protein phosphatase PP4 complex; Pph3p and Psy2p form active complex, Psy4p may provide substrate specificity; regulates recovery from the DNA damage checkpoint, the gene conversion- and single-strand annealing-mediated pathways of meiotic double-strand break repair and efficient Non-Homologous End-Joining (NHEJ) pathway; involved in activation of Gln3p to alleviate nitrogen catabolite repression; Pph3p and Psy2p localize to foci on meiotic chromosomes [Source:SGD;Acc:S000002482])

HSP 1 Score: 166.777 bits (421), Expect = 8.516e-47
Identity = 109/298 (36.58%), Postives = 163/298 (54.70%), Query Frame = 1
Query:  610 LIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISA-MLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQF 1500
            +I S R  + +    +  L  +++ LL  + NV+Q  T     VTICGD+HGQL DL+T+F K+   + +  YI  GDFVDRG +S+E   +L  + L YP  + L RGNHE   +   YGF  E+  KY  N+N + R+  ++F +L L  II+NSI   HGG+S  M  +D I  +DR              K E   E  M   DLLWSDP      S++  RG G  FG    +  L+K N+ L+ R+H+  ++GY+   +  +VT++SA NY  +  N  A L+ID++ N+++
Sbjct:    7 IIASLRDGKHIPEETVFRLCLNSQELLMNEGNVTQVDTP----VTICGDIHGQLHDLLTLFEKSGGVEKTR-YIFLGDFVDRGFYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKVYGFYDEVVRKY-GNSN-VWRYCCEVFDYLSLGAIINNSIFCVHGGLSPDMTTVDEIRTIDR--------------KQEVPHEGAM--CDLLWSDPEDVDTWSLSP-RGAGFLFGKREVDQFLEKNNVELIARAHQLVMEGYKEMFDGGLVTVWSAPNYCYRCGNVAAVLKIDDDLNREY 280          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: GLC7 (Type 1 S/T protein phosphatase (PP1) catalytic subunit; involved in glycogen metabolism, sporulation and mitotic progression; interacts with multiple regulatory subunits; regulates actomyosin ring formation; subunit of CPF; recruited to mating projections by Afr1p interaction; regulates nucleocytoplasmic shuttling of Hxk2p; import into the nucleus is inhibited during spindle assembly checkpoint arrest; involved in dephosphorylating Rps6a/b and Bnr1p [Source:SGD;Acc:S000000935])

HSP 1 Score: 160.614 bits (405), Expect = 1.780e-44
Identity = 97/248 (39.11%), Postives = 140/248 (56.45%), Query Frame = 1
Query:  739 VTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDP-RSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRID 1479
            + ICGD+HGQ  DL+ +F    FP  SN Y+  GD+VDRG  S+E   +L ++ + YP++ F+ RGNHE   +N  YGF  E + +Y     K+ + F D F+ LP+  IID  I   HGG+S  LN   +E++ R      +  P  DI +         + DLLWSDP +   G S N  RG    FGPD+ N  L+K ++ L+ R+H+   DGYE+  + ++VTLFSA NY  +  N GA + +D
Sbjct:   58 IKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNI---KLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN--SMEQIRR------VMRPT-DIPDVG------LLCDLLWSDPDKDIVGWSEND-RGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVD 285          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO47034 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RNB7])

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 322/662 (48.64%), Postives = 448/662 (67.67%), Query Frame = 1
Query:  112 MGCAQSNSPKHEYDNIYNSPKENIIENSKKTSHHVKKIYSTGDTGPISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLT---NKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAP--VEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSS 2082
            MGC  S     EYD   NS     +  S+K                 ++++A+LIQNW+RRYRA+LEA+RR TW I+QSIEYSGEQDQLKL +FF D+L+     N G    + + + LS+     +    S     L+  T    I VEPTY G  +  P+++  V  +IE  +  +++HA+Y+L +L   R   +  PNV + +T I+K++TICGDLHG+LDDL  IF+KN  P   NPYI NGD VDRG  S+EI  ILF+F +LYP  V++NRGNHEDH+MN RYGFVKE+  KYK +A+KI+R F DIF WLPL TI++N I V HGGIS + +LD+IE++DRHK++SVL+ P  V+D  + +  +EW Q+LDLLWSDP+  PGC  N +RGGGCYFGPD+T+ +L+K+N  LL+RSHECK +GYE+ H  KV+T+FSASNYY+QGSN+GA+++I  +    F QY    + +KHLTL Q V  +EESA+R+LK K+ A K+ L E F ++D  + G +   +W   +E+ L L +PW  LR  L  ++ +GKV+Y S  E   ++ K      ++TE LY+N+ NLETIFR+MDKDNSGH+S+ EF+ +C+LL++H+   + E++I+DLA+ +D++KDG IDFNEFLEAFR+VD S
Sbjct:    1 MGCGTSVDAYKEYDGHKNSLS---LSKSEK-----------------ALRSAVLIQNWFRRYRARLEARRRCTWKIFQSIEYSGEQDQLKLFNFFTDMLTHVQPDNTGASRANIIEDTLSRNGSASST--SSKSSTTLEAATDPSDIKVEPTYTGHVVKLPITLMSVRNIIEQCKLNKLVHAKYVLLILREARERFRALPNVIRVTTRIAKQMTICGDLHGKLDDLFMIFHKNGLPSPENPYIFNGDLVDRGPRSIEICIILFAFTILYPNGVYINRGNHEDHIMNLRYGFVKEVMDKYKDHASKIIRLFEDIFGWLPLATIVNNKIFVAHGGISNITDLDIIERIDRHKYVSVLKPPNIVKDNPSLSSLKEWRQVLDLLWSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRSHECKYEGYEYMHNKKVITIFSASNYYEQGSNRGAYMKIGPDMTPYFVQYQV-SRTKKHLTLKQRVGIVEESAIRELKEKLYANKSALMEAFTKRDEQHTGYLTCSQWAAAIESTLHLDVPWNMLRHQLAYVAPDGKVDYRSCLEQYAIEGKTKKNGPSITEALYRNRSNLETIFRLMDKDNSGHVSMEEFQASCRLLNQHSETEIPEDSIQDLARSIDMDKDGYIDFNEFLEAFRLVDVS 639          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 184.882 bits (468), Expect = 7.387e-53
Identity = 107/312 (34.29%), Postives = 169/312 (54.17%), Query Frame = 1
Query:  631 EQILHARYLLE-----LLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIF-YKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLN-LDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQY-TTHKKNQKHLT 1542
            EQ++  + L E     L +  + +L  + NV +        VT+CGD+HGQ  DL+ +F    K PDT+  Y+  GD+VDRG +SVE   +L +  + +P  + + RGNHE   +   YGF  E   KY  NA+ + ++F D+F +LPL  ++DN I   HGG+S  ++ LD I  LDR          ++++ +E        + DLLWSDP  + G  ++  RG G  FG DI+        L+L+ R+H+  ++GY WCH+  VVT+FSA NY  +  N+ A + +D+     F Q+    ++ + H+T
Sbjct:   16 EQLMECKQLTEAQVKTLCEKAKEILSKESNVQEVKCP----VTVCGDVHGQFHDLMELFRIGGKSPDTN--YLFMGDYVDRGYYSVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKY-GNAS-VWKYFTDLFDYLPLTALVDNQIFCLHGGLSPSIDTLDHIRALDR----------IQEVPHEGP------MCDLLWSDPDDRGGWGISP-RGAGYTFGQDISETFNHTNGLTLITRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDALKYSFLQFDPAPRRGEPHVT 302          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 163.31 bits (412), Expect = 8.901e-45
Identity = 96/248 (38.71%), Postives = 140/248 (56.45%), Query Frame = 1
Query:  739 VTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDP-RSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRID 1479
            + ICGD+HGQ  DL+ +F    FP  SN Y+  GD+VDRG  S+E   +L ++ + YP++ FL RGNHE   +N  YGF  E + +Y     K+ + F D F+ LP+  I+D  I  CHGG+S   +L  +E++ R      +  P  D+ ++        + DLLWSDP +   G   N  RG    FGPDI    L K++L L+ R+H+   DGYE+  + ++VTLFSA NY  +  N GA + +D
Sbjct:   59 LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNI---KLWKTFTDCFNCLPVAAILDEKIFCCHGGLSP--DLQSMEQIRR------IMRPT-DVPDQG------LLCDLLWSDPDKDVQGWGEND-RGVSFTFGPDIVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVD 286          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 159.844 bits (403), Expect = 8.235e-44
Identity = 103/298 (34.56%), Postives = 151/298 (50.67%), Query Frame = 1
Query:  613 IESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIF-YKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLN-LDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQF 1500
            IE  R  +++  + + +L    R +L  + NV +  +     VT+CGD+HGQ  DL  +F      PDT+  Y+  GDFVDRG +SVE   +L +  + YP  + L RGNHE   +   YGF  E   KY S    + R+ A+IF +L L  IIDN +   HGG+S  ++ LD I  +DR              K E   +  M   DLLWSDP    G  V+  RG G  FG D+        ++ L+ R+H+  ++GY+W     V+T++SA NY  +  N  A L +D    ++F
Sbjct:   11 IEKLRNCELITEKEVKQLCAKAREILVEESNVQRVDSP----VTVCGDIHGQFYDLKELFKVGGDVPDTN--YLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKYGSIT--VWRYCAEIFDYLSLSAIIDNRVFCVHGGLSPSISTLDQIRSIDR--------------KQEVPHDGPM--CDLLWSDPEDIQGWGVSP-RGAGYLFGSDVVAQYNAANDIDLICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLKREF 283          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO36272 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SJ38])

HSP 1 Score: 129.798 bits (325), Expect = 4.347e-32
Identity = 86/266 (32.33%), Postives = 132/266 (49.62%), Query Frame = 1
Query:  727 ISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLN-LDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPG-------CSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENK------VVTLFSASNYYKQGSNKGAFLRIDN 1482
            +   +T+CGD+HGQ  DLV +F     P T+  Y+  GD+VDRG  S+E    L++   LY  ++FL RGNHE   +   + F  E +IKY   +  +     + F  LPL  +++   L  HGG+S  ++ LD ++KLDR K                +   +  + DLLWSDP    G        S N  RG   ++    T + L+  NL  +IR+HE +  GY    +++      ++T+FSA NY    +NK A L+ +N
Sbjct:   59 VDAPITVCGDIHGQFYDLVKLFEVGGSPATTR-YLFLGDYVDRGYFSIECVLYLWTLKCLYTNTLFLLRGNHECRHLTEYFTFKTECKIKY---SEAVYDACMESFDCLPLAALMNQQFLCVHGGLSPEIHTLDDVKKLDRFK----------------EPPAFGPMCDLLWSDPLEDYGNEKTSEHFSHNTVRGCSYFYSYPATCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAVLKYEN 304          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ppef1 (protein phosphatase with EF-hand domain 1 [Source:NCBI gene;Acc:101174574])

HSP 1 Score: 318.931 bits (816), Expect = 1.371e-97
Identity = 150/311 (48.23%), Postives = 206/311 (66.24%), Query Frame = 1
Query: 1162 VLQAPVED-------IKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIV 2073
            VLQ P  D             E+EW QI+D+LWSDP+++ GCS N +RGGGCYFGPD+T  +L ++ L +LIRSHECK +GYE CH  KV+T+FSASNYY++GSN+GA++++  E   +F+QY   +  +K LTL Q +   E SALR LK K+ A ++EL   F Q D +N G + + EW  V+E VL+L LPWRTLRPHL +L+ +G VEY S FE  +       +   + E L++ + ++E IF I+DKD+SG IS+ EFR   +L   H    + + AI+DLA+ +D NKDG IDF EFLEAFR+V
Sbjct:  417 VLQVPYLDSLSSIPLPSPPQHEQEWKQIVDILWSDPKTQEGCSPNLFRGGGCYFGPDVTQKLLLQHGLQMLIRSHECKQEGYEICHGGKVITIFSASNYYEEGSNRGAYIKLGRELVPRFYQYQVSRITRK-LTLTQRIRAAEGSALRALKEKLFAHRSELVGSFQQYDPDNTGTVSVCEWAQVLECVLRLDLPWRTLRPHLARLASDGSVEYQSCFEDMEPGATLPKVTPNLAETLFRYRTDIEIIFNIIDKDHSGLISIEEFRHTWRLFSAHLGVAIDDRAIDDLARSIDFNKDGSIDFTEFLEAFRVV 726          

HSP 2 Score: 293.123 bits (749), Expect = 6.132e-88
Identity = 149/313 (47.60%), Postives = 213/313 (68.05%), Query Frame = 1
Query:  250 ISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLL----SLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAP 1176
            ++IKAA+LIQ WYRRY A+LE +RRYTW I+QSIEY+GEQDQL+L SFF+ +L     L+  G +  +++++ +    +          DR++ Y      + V  +Y G +++FPL ++    L+ +F+++QILHARY+L+LL   + LLK  PN++  STS +K +TICGDLHG LDDL+ IFYKN  P    PY+ NGDFVDRG  SVE+  +LF++FLLYP  + LNRGNHED +MN RYGF KE+  KYK +  +I++ F D+FS LP+ T+ID  +L+ HGGIS   +L+++  + RHK  S L+ P
Sbjct:   29 LTIKAAVLIQRWYRRYMARLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFSFMLDNFTQLSGNGPDLITQLLDPVVDPWL----------DREICY----NLVPVPDSYTGPRISFPLGVSDTNTLLSAFKEQQILHARYVLQLLYEAKKLLKQMPNINHLSTSYTKDITICGDLHGHLDDLLLIFYKNGLPSAETPYVFNGDFVDRGKKSVEVVIMLFAYFLLYPDYMHLNRGNHEDPIMNLRYGFTKEVMQKYKIHGREILQLFQDVFSLLPIATVIDGKVLIVHGGISDQTDLNLLSSIKRHKVKSALRFP 327          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: PPEF2 (serine/threonine-protein phosphatase with EF-hands 2 [Source:NCBI gene;Acc:101170112])

HSP 1 Score: 300.056 bits (767), Expect = 1.046e-90
Identity = 155/322 (48.14%), Postives = 213/322 (66.15%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAP--VEDIKNENKEEE 1212
            +I+AA+LIQ WYR+Y A+LE +RR TW I+QSIEY+GEQDQ+KL SFF  L+          + +      +H+        D + +  +  K   I V  +Y G  LTFP++   V+ L+E+F+ +Q LHARY+L++L  T  LL+  PN++  S S +K +TICGDLHGQL+DL+ IFYKN  P +  PYI NGDFVDRG  S+EI  ILF F L+YP  + LNRGNHEDH++N RYGF KEI  KY+ +  KI++    IFSWLPL T+I++ +LV HGGIS   +L V+ ++DRH+++SVL+ P  V    N NK E+
Sbjct:   25 AIRAALLIQRWYRQYVARLEMRRRCTWNIFQSIEYAGEQDQIKLYSFFGFLMDHFTPASSERNLI------SHIFHENEICRDTEWERYFCYK--DIEVPDSYTGPHLTFPMTFCGVSKLVEAFKHKQQLHARYVLQILGETWRLLRILPNINYVSVSQTKEITICGDLHGQLEDLLLIFYKNGLPSSEKPYIFNGDFVDRGKSSLEILLILFGFLLVYPNDLHLNRGNHEDHIVNLRYGFTKEILGKYRVHGKKILKLLQKIFSWLPLATVINDKVLVVHGGISNSTDLCVVSRVDRHRYVSVLRPPKTVHQTLNGNKNED 338          

HSP 2 Score: 288.886 bits (738), Expect = 1.534e-86
Identity = 142/292 (48.63%), Postives = 193/292 (66.10%), Query Frame = 1
Query: 1210 EWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGT-MTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSS 2082
            +W QI++LLWSDP  + GC  N+ RGGGCY+GPD+T ++L ++NL LLIRSHECK DGYE+CH  +V+T+FSASNYY+ GSN+GA++R+  +      QY    +  + LTL QSV   E SALR L+ ++   K++L   + + D +  G I ++ W +  E+VLKL LPWR LR  LV  +  G V+Y    +   +    L ++ T + E +YKN  NLETIFRI+D D+SG ISL EFR   KLL  H    +S++AI DLA  +D NKDG ID NEF+EAFR+VD S
Sbjct:  424 DWKQIVNLLWSDPMPQNGCISNEVRGGGCYWGPDVTEEVLGRHNLQLLIRSHECKQDGYEFCHNRRVLTIFSASNYYEVGSNRGAYIRMGADLVPHLIQYQA-SRTCRELTLRQSVGWTERSALRALREQLFVHKSDLIRAYQEFDPHQTGKISMRHWASATESVLKLGLPWRVLRSQLVSRTHYGMVDYQQWIKELSITEPKLEVSDTSILETMYKNHSNLETIFRIIDTDHSGLISLEEFRQTWKLLSSHLKMEISDKAIADLAHSIDFNKDGSIDINEFMEAFRLVDLS 714          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ENSORLT00000036394.1 (serine/threonine-protein phosphatase with EF-hands 2-like [Source:NCBI gene;Acc:101171918])

HSP 1 Score: 298.901 bits (764), Expect = 4.136e-90
Identity = 159/334 (47.60%), Postives = 216/334 (64.67%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLL-SLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPR 1251
            +I+AA+LIQ WYR+Y A+ E +RRYTW I+QSIEYSGEQ Q+KL +F   L+ + T    E    +I     +H+ +      D + +  +  K   I V   Y G  LTFPL++ Q   L+++FR ++ LH+RY+L+LL  T  LL+  PN+++ ST  SK VTICGDLHGQL+DL+ IFYKN  P    PY+ NGDFVDRG  S+EI  ILFSF L+YP  V+LNRGNHEDH++N RYGF KE+  KY+ +  +I++    IFSWLPL T+ID  +LV HGGIS   +L V+ KLDRH ++S L+ P +  ++ +     M I D  W   R
Sbjct:   18 AIRAAVLIQRWYRQYVARTEMRRRYTWNIFQSIEYSGEQAQIKLYNFLGYLMDNFTPSSSE--RNLI-----SHIFRENDICRDAEWERYFCYK--NIEVPEVYSGPHLTFPLTLEQAIGLLDAFRNKKQLHSRYVLQLLLETWRLLRMLPNINRISTCHSKEVTICGDLHGQLEDLLLIFYKNGMPSLEKPYVFNGDFVDRGKDSIEILLILFSFLLIYPSDVYLNRGNHEDHIINLRYGFTKEVLTKYRVHGKRILKLLQKIFSWLPLATVIDQKVLVLHGGISDTTDLAVLAKLDRHSYVSALRPPKKRNQSLSGLSMDMDIGDEGWGTSR 342          

HSP 2 Score: 282.722 bits (722), Expect = 4.911e-84
Identity = 137/307 (44.63%), Postives = 197/307 (64.17%), Query Frame = 1
Query: 1162 VLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKL-SKEGKVEYSSIFEAQQVDNKFL-MIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVD 2076
             L    + ++++N  EEW QILDLLWSDP ++ GC  N+ RGGGCY+GPDIT D L ++N+ L+IRSHECK +GYE+CH  +V+TLFSASNYY  GSN+GA++++  +      QY       + LT  QS+ + E SAL+ L+ ++ A K++L   F   D  N G++ L +W   +E+V+ L LPWR LR  LV     +G ++Y++ F    +       I  T+ E LY+++  LETIFRI+D DNSG IS+ +FR   KLL  +    +++EAI DLA  +D N+DG ID +EF+EAFR+ D
Sbjct:  403 ALNVSTDSVRSDNSNEEWRQILDLLWSDPMTQNGCKPNEVRGGGCYWGPDITEDFLNRHNMQLIIRSHECKQEGYEFCHNRRVLTLFSASNYYDVGSNRGAYVKMGPDLEPYVIQYQASSMT-RELTAKQSIGRTERSALKVLREQLFAHKSDLICAFRGFDTENAGLVSLSDWACAVESVMHLNLPWRMLRCQLVTCKGSDGMIDYNAWFHELAIKGPNTDHIEQTLLETLYRHRSTLETIFRIVDTDNSGFISMEDFRQTWKLLSVYLKMEITDEAISDLAVTIDSNQDGSIDIDEFMEAFRLTD 708          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ENSORLT00000000429.2 (serine/threonine-protein phosphatase with EF-hands 2-like [Source:NCBI gene;Acc:101171918])

HSP 1 Score: 282.337 bits (721), Expect = 2.627e-84
Identity = 137/307 (44.63%), Postives = 197/307 (64.17%), Query Frame = 1
Query: 1162 VLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKL-SKEGKVEYSSIFEAQQVDNKFL-MIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVD 2076
             L    + ++++N  EEW QILDLLWSDP ++ GC  N+ RGGGCY+GPDIT D L ++N+ L+IRSHECK +GYE+CH  +V+TLFSASNYY  GSN+GA++++  +      QY       + LT  QS+ + E SAL+ L+ ++ A K++L   F   D  N G++ L +W   +E+V+ L LPWR LR  LV     +G ++Y++ F    +       I  T+ E LY+++  LETIFRI+D DNSG IS+ +FR   KLL  +    +++EAI DLA  +D N+DG ID +EF+EAFR+ D
Sbjct:  366 ALNVSTDSVRSDNSNEEWRQILDLLWSDPMTQNGCKPNEVRGGGCYWGPDITEDFLNRHNMQLIIRSHECKQEGYEFCHNRRVLTLFSASNYYDVGSNRGAYVKMGPDLEPYVIQYQASSMT-RELTAKQSIGRTERSALKVLREQLFAHKSDLICAFRGFDTENAGLVSLSDWACAVESVMHLNLPWRMLRCQLVTCKGSDGMIDYNAWFHELAIKGPNTDHIEQTLLETLYRHRSTLETIFRIVDTDNSGFISMEDFRQTWKLLSVYLKMEITDEAISDLAVTIDSNQDGSIDIDEFMEAFRLTD 671          

HSP 2 Score: 271.166 bits (692), Expect = 4.509e-80
Identity = 147/313 (46.96%), Postives = 199/313 (63.58%), Query Frame = 1
Query:  316 KRRYTWMIYQSIEYSGEQDQLKLQSFFNDLL-SLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPR 1251
            +RRYTW I+QSIEYSGEQ Q+KL +F   L+ + T    E    +I     +H+ +      D + +  +  K   I V   Y G  LTFPL++ Q   L+++FR ++ LH+RY+L+LL  T  LL+  PN+++ ST  SK VTICGDLHGQL+DL+ IFYKN  P    PY+ NGDFVDRG  S+EI  ILFSF L+YP  V+LNRGNHEDH++N RYGF KE+  KY+ +  +I++    IFSWLPL T+ID  +LV HGGIS   +L V+ KLDRH ++S L+ P +  ++ +     M I D  W   R
Sbjct:    2 RRRYTWNIFQSIEYSGEQAQIKLYNFLGYLMDNFTPSSSE--RNLI-----SHIFRENDICRDAEWERYFCYK--NIEVPEVYSGPHLTFPLTLEQAIGLLDAFRNKKQLHSRYVLQLLLETWRLLRMLPNINRISTCHSKEVTICGDLHGQLEDLLLIFYKNGMPSLEKPYVFNGDFVDRGKDSIEILLILFSFLLIYPSDVYLNRGNHEDHIINLRYGFTKEVLTKYRVHGKRILKLLQKIFSWLPLATVIDQKVLVLHGGISDTTDLAVLAKLDRHSYVSALRPPKKRNQSLSGLSMDMDIGDEGWGTSR 305          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ppp5c (protein phosphatase 5 catalytic subunit [Source:NCBI gene;Acc:101158545])

HSP 1 Score: 243.817 bits (621), Expect = 5.660e-72
Identity = 131/332 (39.46%), Postives = 198/332 (59.64%), Query Frame = 1
Query:  532 IEQIVVEPTYKGAKL-TFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISA--MLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNK-QFFQYTT 1515
            IE + +E  Y G KL    ++++ +T ++E F++++ LH +   ++L   +++L   P++ + +   + ++TICGD HGQ  DL+ IF  N  P  +NPY+ NGDFVDRGS S+E+   LF F LLYP +  L RGNHE   MN  YGF  E++ KY +   ++ + F+++F WLPL   I++ +LV HGG+ +   + LD I K+DR++     Q P           +   + DLLWSDP+ + G SV++ RG  C FGPD+T   L+K  L  +IRSHE K +GYE  H  K +T+FSA NY  Q  NKGA++ +     K +F Q+T 
Sbjct:  159 IESMTIEDDYAGPKLEDGKVTVSFMTDMMEWFKEQKKLHRKCAYQILVQVKDVLSKLPSLVEITLKETDKLTICGDTHGQYYDLLNIFKLNGLPSDANPYLFNGDFVDRGSFSLEVILTLFGFKLLYPDNFHLLRGNHETDNMNQMYGFEGEVKAKYTA---QMFQLFSEVFQWLPLAQCINSKVLVMHGGLFSEDGVTLDDIRKIDRNR-----QPP-----------DSGPMCDLLWSDPQPQNGRSVSK-RGVSCQFGPDVTESFLEKNKLDYIIRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAYIHLRGSDLKPEFHQFTA 470          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000042202.1 (SMESG000042202.1)

HSP 1 Score: 1367.06 bits (3537), Expect = 0.000e+0
Identity = 658/658 (100.00%), Postives = 658/658 (100.00%), Query Frame = 1
Query:  112 MGCAQSNSPKHEYDNIYNSPKENIIENSKKTSHHVKKIYSTGDTGPISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSSL 2085
            MGCAQSNSPKHEYDNIYNSPKENIIENSKKTSHHVKKIYSTGDTGPISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSSL
Sbjct:    1 MGCAQSNSPKHEYDNIYNSPKENIIENSKKTSHHVKKIYSTGDTGPISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSSL 658          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000042202.1 (SMESG000042202.1)

HSP 1 Score: 1298.11 bits (3358), Expect = 0.000e+0
Identity = 631/658 (95.90%), Postives = 632/658 (96.05%), Query Frame = 1
Query:  112 MGCAQSNSPKHEYDNIYNSPKENIIENSKKTSHHVKKIYSTGDTGPISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSSL 2085
            MGCAQSNSPKHEYDNIYNSPK                          +IKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSSL
Sbjct:    1 MGCAQSNSPKHEYDNIYNSPK--------------------------AIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRIVDSSL 632          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000076282.1 (SMESG000076282.1)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 325/612 (53.10%), Postives = 437/612 (71.41%), Query Frame = 1
Query:  250 ISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQE---CDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFE-AQQVDNK-FLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRI 2070
            I +K+ I IQ WYR Y+A+LEA+R+ +WMIYQSIEYSGEQDQLKL +FF DL++L   GQ+    DS   +AL+K+  +K +    ++            I +E  Y G  + FPL++  +T+LI +F  EQILH  YL ELL  TR +LKTKPN+S+   SI K +TICGDLHGQL DL+ IF +N++PD SNPY+ NGDF+DRG HSVEIA ILFSF +LYP  VFLNRGNHED +MN RYGF+KE+Q KYK++AN I+  FADIF WLPL TII N I +CHGGIS  + L+ ++ +DR K++S L  P +   +E  + EW+Q+LD+LWSDP+ + GC  N +RGGGCYFGPDIT+  L+KY   LLIRSHECK  GYEWCH+++V+T+FSASNYY  GSNKGAF+++      +   +   K+ QKH+ + + ++ IEESALR+L+ KIL  +++L  EF+  D +N G+IE Q WC +M  VL+L LPWRTLR  L  ++  G + YSS FE   ++D+K   M   ++++E+YK ++ LET+FRI+D DNSG IS+ EF++ CK+L  H+  N++ EA+EDLA+ +DINKDG ID NEFLEAFRI
Sbjct:   30 IMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM--GQQNLSSDSLFTKALNKSTSIKRSSEYEND------------IPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSD---SELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 624          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000076282.1 (SMESG000076282.1)

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 324/610 (53.11%), Postives = 436/610 (71.48%), Query Frame = 1
Query:  256 IKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQE---CDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFE-AQQVDNK-FLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRI 2070
            +K+ I IQ WYR Y+A+LEA+R+ +WMIYQSIEYSGEQDQLKL +FF DL++L   GQ+    DS   +AL+K+  +K +    ++            I +E  Y G  + FPL++  +T+LI +F  EQILH  YL ELL  TR +LKTKPN+S+   SI K +TICGDLHGQL DL+ IF +N++PD SNPY+ NGDF+DRG HSVEIA ILFSF +LYP  VFLNRGNHED +MN RYGF+KE+Q KYK++AN I+  FADIF WLPL TII N I +CHGGIS  + L+ ++ +DR K++S L  P +   +E  + EW+Q+LD+LWSDP+ + GC  N +RGGGCYFGPDIT+  L+KY   LLIRSHECK  GYEWCH+++V+T+FSASNYY  GSNKGAF+++      +   +   K+ QKH+ + + ++ IEESALR+L+ KIL  +++L  EF+  D +N G+IE Q WC +M  VL+L LPWRTLR  L  ++  G + YSS FE   ++D+K   M   ++++E+YK ++ LET+FRI+D DNSG IS+ EF++ CK+L  H+  N++ EA+EDLA+ +DINKDG ID NEFLEAFRI
Sbjct:   28 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM--GQQNLSSDSLFTKALNKSTSIKRSSEYEND------------IPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSD---SELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 620          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000003989.1 (SMESG000003989.1)

HSP 1 Score: 378.252 bits (970), Expect = 1.700e-121
Identity = 235/615 (38.21%), Postives = 339/615 (55.12%), Query Frame = 1
Query:  253 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLT-NKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRK-EQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNN----RGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLS-KEGKVEYSSIFEAQQVD--NKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRI 2070
            ++KA +LIQ +YRRYRAK EAKR+  W I+Q +EYS EQ+Q+ +Q     LLS+T +   E   +V    SK + +           D Q +   +   ++ ++ G KL +P++   V  L+E ++     L  R L+ELL   + +L+  PNV + S      +TICGD+HG  DDLVTIF KN  P TSNPY+ NGDFVDRGS SVE+ ++L   FL  P +VFLNRGNHEDH MN RYGF KE+                                                   +++KF SVLQ   +++ NE +  EW Q+L+LLWSDPR   GC +N YRGGGCYFGPD+T   L+K  + L+IRSHECK++G+++CHE+KV+TLFSASNYY+ GSN GAF  ID   N +  QY    K+Q+ +   ++    EE ++R L  +I   +N L ++F + D++      GVI + +W T M  ++ + LPWR L+ +L+  S  E  V Y ++    ++   NK +   G +         N+E +F ++D   SGH++  EF +  +      N  + +E +  L K  D+N DG ID  EFL+  RI
Sbjct:   98 TLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQK----LLSITLHNNPERHFDVKCKFSKFNDILPP--------DKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELN--------------------------------------------------NKYKFKSVLQYESDNM-NECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQY----KSQEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSDKYSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRF---DSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNP-LQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 634          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPEF10.000e+043.53protein phosphatase with EF-hand domain 1 [Source:... [more]
PPEF16.117e-14739.48protein phosphatase with EF-hand domain 1 [Source:... [more]
PPEF21.667e-9446.25protein phosphatase with EF-hand domain 2 [Source:... [more]
PPEF21.088e-9246.25protein phosphatase with EF-hand domain 2 [Source:... [more]
PPP5C3.497e-6736.04protein phosphatase 5 catalytic subunit [Source:HG... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pef-10.000e+044.58Serine/threonine-protein phosphatase with EF-hands... [more]
pef-10.000e+044.81Serine/threonine-protein phosphatase with EF-hands... [more]
pef-19.763e-17245.07Serine/threonine-protein phosphatase with EF-hands... [more]
pph-58.489e-7336.03Serine/threonine-protein phosphatase 5 [Source:Un... [more]
C47A4.34.596e-5135.03Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rdgC6.464e-17442.16gene:FBgn0265959 transcript:FBtr0342946[more]
rdgC1.536e-17342.16gene:FBgn0265959 transcript:FBtr0473730[more]
rdgC6.070e-17342.16gene:FBgn0265959 transcript:FBtr0342949[more]
rdgC6.070e-17342.16gene:FBgn0265959 transcript:FBtr0342947[more]
rdgC6.070e-17342.16gene:FBgn0265959 transcript:FBtr0342948[more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppef13.903e-10349.25protein phosphatase, EF-hand calcium binding domai... [more]
ppef19.192e-10351.28protein phosphatase, EF-hand calcium binding domai... [more]
ppef19.192e-10351.28protein phosphatase, EF-hand calcium binding domai... [more]
CU695117.11.912e-8448.32protein phosphatase with EF-hand domain 2a [Source... [more]
ppp5c9.448e-7138.29protein phosphatase 5, catalytic subunit [Source:Z... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp431.818e-9651.21ubiquitin specific peptidase 43 [Source:Xenbase;Ac... [more]
PPEF22.460e-8951.37protein phosphatase, EF-hand calcium binding domai... [more]
ppp5c1.970e-6836.26protein phosphatase 5, catalytic subunit [Source:N... [more]
ppp5c1.626e-6335.16protein phosphatase 5, catalytic subunit [Source:N... [more]
ppp5c7.709e-5935.07protein phosphatase 5, catalytic subunit [Source:N... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppef10.000e+046.23protein phosphatase with EF hand calcium-binding d... [more]
Ppef24.141e-9547.19protein phosphatase, EF hand calcium-binding domai... [more]
Ppef24.141e-9547.19protein phosphatase, EF hand calcium-binding domai... [more]
Ppef17.952e-6951.42protein phosphatase with EF hand calcium-binding d... [more]
Ppp5c6.364e-6637.65protein phosphatase 5, catalytic subunit [Source:M... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5EBX9|PPE_CAEEL0.000e+044.81Serine/threonine-protein phosphatase with EF-hands... [more]
sp|Q3SWT6|PPE1_RAT0.000e+045.26Serine/threonine-protein phosphatase with EF-hands... [more]
sp|O14829|PPE1_HUMAN0.000e+043.53Serine/threonine-protein phosphatase with EF-hands... [more]
sp|O35655|PPE1_MOUSE0.000e+046.23Serine/threonine-protein phosphatase with EF-hands... [more]
sp|P40421|RDGC_DROME6.479e-17342.16Serine/threonine-protein phosphatase rdgC OS=Droso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DFW70.000e+050.14Serine/threonine-protein phosphatase with EF-hands... [more]
A0A1I8F2Q40.000e+051.17Serine/threonine-protein phosphatase with EF-hands... [more]
A0A1I8HDQ70.000e+050.47Serine/threonine-protein phosphatase with EF-hands... [more]
A0A2B4SS400.000e+052.37Serine/threonine-protein phosphatase with EF-hands... [more]
A0A1I8IY930.000e+052.31Serine/threonine-protein phosphatase OS=Macrostomu... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppef13.350e-10351.10serine/threonine-protein phosphatase with EF-hands... [more]
ppef12.747e-10251.94serine/threonine-protein phosphatase with EF-hands... [more]
ENSAMXT00000016118.25.991e-9648.86pep primary_assembly:Astyanax_mexicanus-2.0:14:382... [more]
PPEF22.793e-8847.40protein phosphatase with EF-hand domain 2 [Source:... [more]
ppp5c1.004e-6837.65protein phosphatase 5 catalytic subunit [Source:NC... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp5c2.752e-7135.78protein phosphatase 5, catalytic subunit [Source:Z... [more]
ppp1cab2.673e-4237.50protein phosphatase 1, catalytic subunit, alpha is... [more]
ENSPMAT00000010086.11.841e-4036.07pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
ppp3cb1.553e-3333.33protein phosphatase 3, catalytic subunit, beta iso... [more]
ppp1cb4.779e-2935.90protein phosphatase 1, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PPH211.307e-5435.60Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
PPH222.993e-5435.92Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
PPT15.572e-4933.44Protein serine/threonine phosphatase; regulates Hs... [more]
PPH38.516e-4736.58Catalytic subunit of protein phosphatase PP4 compl... [more]
GLC71.780e-4439.11Type 1 S/T protein phosphatase (PP1) catalytic sub... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470340.000e+048.64Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297597.387e-5334.29Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO446488.901e-4538.71Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO499368.235e-4434.56Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO362724.347e-3232.33Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppef11.371e-9748.23protein phosphatase with EF-hand domain 1 [Source:... [more]
PPEF21.046e-9048.14serine/threonine-protein phosphatase with EF-hands... [more]
ENSORLT00000036394.14.136e-9047.60serine/threonine-protein phosphatase with EF-hands... [more]
ENSORLT00000000429.22.627e-8444.63serine/threonine-protein phosphatase with EF-hands... [more]
ppp5c5.660e-7239.46protein phosphatase 5 catalytic subunit [Source:NC... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042202.10.000e+0100.00SMESG000042202.1[more]
SMESG000042202.10.000e+095.90SMESG000042202.1[more]
SMESG000076282.10.000e+053.10SMESG000076282.1[more]
SMESG000076282.10.000e+053.11SMESG000076282.1[more]
SMESG000003989.11.700e-12138.21SMESG000003989.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028575 ID=SMED30028575|Name=Serine/threonine-protein phosphatase with EF-hands|organism=Schmidtea mediterranea sexual|type=transcript|length=2226bp
AAATGAACTAAATCTAACCTATTGCATAAGTAATTTTAAAATGGATTATA
ATAATTTGTTAACAGATAATTAAATTATCATTTAACAAAGTTAGTTAAAG
TATTATAACAAATGGGCTGTGCTCAATCAAATAGTCCGAAACACGAGTAC
GACAATATTTACAATTCCCCTAAAGAAAATATAATTGAAAATTCTAAAAA
AACCAGTCATCATGTCAAAAAGATCTATTCAACTGGAGATACCGGACCAA
TTTCCATCAAAGCTGCCATTCTAATTCAAAATTGGTACAGGCGCTATAGA
GCAAAGTTAGAGGCTAAAAGAAGATACACATGGATGATTTACCAGTCTAT
TGAATATTCTGGCGAGCAAGACCAATTAAAACTACAAAGCTTTTTTAATG
ATCTCTTATCACTGACAAATAAAGGCCAAGAATGTGATTCAGAAGTGATT
GAAGCTCTATCTAAAACTCATGTTTTAAAAACAGCTCCTACAGTATCCGA
CGAAGATCGAGATTTGCAATATTTAACAAAAATAGAACAAATAGTAGTAG
AACCGACTTACAAAGGAGCGAAGCTTACATTTCCGTTGTCAATAAATCAA
GTCACTGCACTTATTGAATCCTTCCGAAAAGAACAAATTCTTCACGCAAG
ATATTTATTGGAATTACTAGATCACACAAGAAATCTACTAAAAACTAAGC
CAAACGTCAGCCAAGCATCTACGTCGATTTCTAAAAGAGTTACTATTTGT
GGAGATTTGCATGGGCAACTGGATGACCTAGTGACAATATTCTACAAAAA
TAAATTTCCGGATACTTCAAACCCTTATATAATCAATGGGGATTTTGTCG
ATAGGGGCAGCCATTCAGTTGAGATAGCCGCAATTTTGTTCAGTTTTTTC
CTGCTTTATCCACAATCAGTTTTTCTGAACAGAGGCAACCACGAAGACCA
TGTTATGAATTATAGATATGGTTTCGTGAAGGAAATTCAAATAAAATATA
AATCAAATGCCAACAAAATAGTCAGATTCTTTGCAGACATTTTCAGTTGG
TTGCCATTAATGACAATAATTGATAATTCTATTCTTGTCTGCCACGGAGG
AATATCTGCGATGCTTAATTTGGACGTAATTGAAAAGCTCGACAGACACA
AATTTTTATCAGTTCTTCAAGCTCCAGTAGAAGACATAAAAAATGAAAAT
AAGGAAGAAGAATGGATGCAGATTCTAGATCTTCTCTGGAGCGATCCGCG
TTCTAAGCCAGGCTGCAGTGTGAATCAGTATAGAGGAGGAGGATGTTACT
TTGGTCCCGATATAACAAACGATATTCTTAAAAAGTACAACTTATCTCTC
CTCATTCGATCGCATGAATGCAAAATTGATGGTTATGAATGGTGCCATGA
AAACAAAGTGGTCACACTTTTCTCTGCCTCTAATTATTACAAGCAAGGCA
GTAATAAAGGAGCGTTTTTGAGAATAGACAATGAACACAATAAACAATTT
TTCCAATATACAACTCACAAAAAGAATCAGAAACATTTGACCCTTATTCA
AAGTGTAAATCAGATTGAAGAATCGGCTCTTAGAGATTTAAAAGGAAAGA
TCTTAGCTTTCAAAAATGAACTCGCTGAAGAATTTATACAAAAGGATGTT
AATAATAGAGGAGTAATAGAACTCCAAGAATGGTGCACTGTGATGGAGAA
CGTATTGAAATTGCCATTACCCTGGAGAACCCTTCGGCCTCATCTTGTCA
AACTTAGTAAAGAAGGCAAAGTAGAATATTCTTCAATCTTTGAAGCTCAA
CAAGTTGACAATAAATTTCTAATGATAGCTGGAACTATGACAGAAGAACT
CTACAAAAATAAAGAAAATTTGGAAACGATATTTCGAATTATGGATAAAG
ACAATTCTGGTCACATTTCTCTCTCGGAATTCCGAGATGCTTGCAAACTT
TTACATAGGCATACAAATCGCAATGTTAGTGAAGAAGCTATTGAAGATTT
AGCAAAATGTTTGGACATTAATAAAGATGGTCAGATAGACTTTAATGAAT
TTCTAGAAGCATTTCGAATAGTAGATAGCTCTTTGTAGATTTATTTATTA
TTGTGTTCTTTCCTTGTTATTCCTATATATGATTAAGAATGTGATTTCTA
TTTCTCTAAACTATTTATTATTTTTGCGTCATTTACTAGTGTAATAAATT
TGTGAATTTTTTATGAAATTTATAGG
back to top

protein sequence of SMED30028575-orf-1

>SMED30028575-orf-1 ID=SMED30028575-orf-1|Name=SMED30028575-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=659bp
MGCAQSNSPKHEYDNIYNSPKENIIENSKKTSHHVKKIYSTGDTGPISIK
AAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLS
LTNKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTY
KGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVS
QASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGS
HSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNA
NKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLS
VLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPD
ITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKG
AFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAF
KNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSK
EGKVEYSSIFEAQQVDNKFLMIAGTMTEELYKNKENLETIFRIMDKDNSG
HISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEA
FRIVDSSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0016787hydrolase activity
GO:0005509calcium ion binding
GO:0004721phosphoprotein phosphatase activity
GO:0005506iron ion binding
GO:0030145manganese ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR012008Ser/Thr-Pase_EF-hand_contain
IPR006186Ser/Thr-sp_prot-phosphatase
IPR002048EF_hand_dom
IPR029052Metallo-depent_PP-like
IPR004843Calcineurin-like_PHP_ApaH
IPR013235PPP_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0050906detection of stimulus involved in sensory perception
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePRINTSPR00114STPHPHTASEcoord: 410..430
score: 37.89
coord: 239..266
score: 43.35
coord: 353..380
score: 26.61
coord: 209..236
score: 42.66
coord: 272..296
score: 47.45
coord: 309..335
score: 42.45
coord: 432..448
score: 49.23
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphataseSMARTSM00156pp2a_7coord: 177..470
e-value: 3.7E-108
score: 375.3
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePROSITEPS00125SER_THR_PHOSPHATASEcoord: 273..278
IPR002048EF-hand domainSMARTSM00054efh_1coord: 503..531
e-value: 3.0
score: 13.9
coord: 626..654
e-value: 0.0067
score: 25.6
coord: 586..614
e-value: 2.1E-4
score: 30.6
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 585..652
e-value: 2.7E-15
score: 56.6
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 582..617
score: 15.155
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 622..657
score: 12.951
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 499..534
score: 8.042
IPR002048EF-hand domainCDDcd00051EFhcoord: 587..652
e-value: 1.32729E-14
score: 66.8025
IPR012008Serine/threonine-protein phosphatase with EF-handsPIRSFPIRSF000912PPEFcoord: 25..366
e-value: 1.1E-128
score: 427.6
coord: 358..657
e-value: 1.6E-124
score: 413.8
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 126..485
e-value: 4.2E-108
score: 362.8
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 495..655
e-value: 4.8E-23
score: 84.1
NoneNo IPR availablePANTHERPTHR45668FAMILY NOT NAMEDcoord: 48..352
NoneNo IPR availablePANTHERPTHR45668:SF2SERINE/THREONINE-PROTEIN PHOSPHATASE WITH EF-HANDS 2coord: 48..352
NoneNo IPR availablePANTHERPTHR45668:SF2SERINE/THREONINE-PROTEIN PHOSPHATASE WITH EF-HANDS 2coord: 361..656
NoneNo IPR availablePANTHERPTHR45668FAMILY NOT NAMEDcoord: 361..656
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 142..543
IPR013235PPP domainPFAMPF08321PPP5coord: 127..199
e-value: 6.9E-7
score: 29.5
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 209..420
e-value: 9.7E-31
score: 107.9
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 635..647
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 595..607
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 501..652