Cytochrome P450 2K1-like protein

Overview
NameCytochrome P450 2K1-like protein
Smed IDSMED30028574
Length (bp)2509
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytochrome P450 2K1-like protein (SMED30028574) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytochrome P450 2K1-like protein (SMED30028574) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome P450 2K1-like protein (SMED30028574) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome P450 2K1-like protein (SMED30028574) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028574

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30028574SMESG000073604.1 Contig1511GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028574SMESG000073604.1 Contig1511GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30028574SMESG000073604.1 Contig1511GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028574SMESG000078098.1 SMESG000078094.1 SMESG000078091.1 PL08001B2F05ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30028574SMESG000078091.1 SMESG000078098.1 SMESG000078094.1 SMESG000078092.1 Contig1511GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028574SMESG000078091.1 SMESG000078098.1 SMESG000078094.1 SMESG000078092.1 Contig1511GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30028574SMESG000078091.1 SMESG000078098.1 SMESG000078094.1 SMESG000078092.1 Contig1511GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30028574SMESG000078092.1 SMESG000078091.1 dd_Smed_v4_2351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028574SMESG000078092.1 SMESG000078091.1 dd_Smed_v4_2351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30028574SMESG000078092.1 SMESG000078091.1 dd_Smed_v4_2351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028574SMESG000078092.1 SMESG000078091.1 dd_Smed_v4_2351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30028574SMESG000078092.1 SMESG000078091.1 dd_Smed_v4_2351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30028574SMESG000078092.1 SMESG000078091.1 dd_Smed_v4_2351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30028574SMESG000078092.1 SMESG000078091.1 SMED30028574smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028574SMESG000078092.1 SMESG000078091.1 SMED30028574smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30028574SMESG000078092.1 SMESG000078091.1 SMED30028574smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 4 cellSMED30028574SMESG000078092.1 SMESG000078091.1 dd_Smed_v4_2351_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028574SMESG000078092.1 SMESG000078091.1 dd_Smed_v4_2351_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2A6 (cytochrome P450 family 2 subfamily A member 6 [Source:HGNC Symbol;Acc:HGNC:2610])

HSP 1 Score: 233.417 bits (594), Expect = 3.352e-67
Identity = 156/505 (30.89%), Postives = 258/505 (51.09%), Query Frame = 2
Query:  902 LLSEMELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEP-PMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFD-NSSLICQLIYLLTS--------EWKSFIRIQ---DFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIG 2377
            L S M L   +  + + +    W  RK    KG K  P  + LP IG   ++    M++ L+K+  + GP+F I LG R++VVL  ++ +++AL+D A  FSGR        V    G+++ +G+     R F +  LRDFG+GK    E +Q E    +D L    G  +D +  +    +N+IS  +   RF                  K+K+ + L+ +M   F   S+   QL  + +S        + ++F  +Q   DF A++++ ++  LD  S   D +D FLI+  Q ++   N E ++   L+ T++ LFI G ET STTL +  L + K+P+++ KVH+EI  +IGK R P   D+  + Y +AV+ E+ R   V P+SL  R   D     F++PK + ++P L +   DP  + +P  F P+HFL    N   +++  +  +PFS+GKR C GE LAR E F+FF +++Q F++  ++   +   S   +G
Sbjct:    2 LASGMLLVALLVCLTVMVLMSVWQQRKS---KG-KLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSNGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSNVISSIVFGDRFD----------------YKDKEFLSLLRMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFQLLQGLEDFIAKKVEHNQRTLDPNSP-RDFIDSFLIRM-QEEEKNPNTEFYLK-NLVMTTLNLFIGGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRDPSFFSNPQDFNPQHFL----NEKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVG 479          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2A13 (cytochrome P450 family 2 subfamily A member 13 [Source:HGNC Symbol;Acc:HGNC:2608])

HSP 1 Score: 231.106 bits (588), Expect = 2.516e-66
Identity = 142/450 (31.56%), Postives = 234/450 (52.00%), Query Frame = 2
Query: 1013 PMESGLPIIGAIHKIEPP-MHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSE------------WKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQ 2323
            P  + LP IG   ++    M++ L+K+  + GP+F I LG R++VVL  ++ +K+AL+D A  FSGR        +    G+ + +G+     R F +  LR FG+GK    E +Q E    +D L    G  +D +  +    +N+IS  +   RF  +D                K+ + L+ +M   F  ++     +Y + S             +K    ++DF A++++ ++  LD  S   D +D FLI+  Q ++   N E ++   L+ T++ LF AG ET STTL +  L + K+P+++ KVH+EI  +IGK R P   D+  + YT+AV+ E+ R   + P+ L HR   D     F++PK + +FP L +   DP  + +P  F P+HF  LD  G  +++  +  +PFS+GKR C GE LAR E F+FF +++Q F+
Sbjct:   35 PGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYED----------------KEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSP-RDFIDSFLIRM-QEEEKNPNTEFYLK-NLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHF--LDKKG--QFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFR 461          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2J2 (cytochrome P450 family 2 subfamily J member 2 [Source:HGNC Symbol;Acc:HGNC:2634])

HSP 1 Score: 226.098 bits (575), Expect = 1.785e-64
Identity = 151/447 (33.78%), Postives = 234/447 (52.35%), Query Frame = 2
Query: 1028 LPIIGAIHKIEPPMHHYLLKL-GRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYL--------------LTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGN-VESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRF 2320
            LP +G    ++    H  ++L  +K G +F ++LG    V++    +IK+ALI    NF  R    +   +   +G+I   G+ W  QR F L  LR+FGLGK    E +Q E  +  + +   +GQ  D    I    +NII      +RF   D     + K + + T               +  +S  CQL  +              L S WK   +++ F +  I +HR   +  +E  D +D +L    ++ + TGN   SF +  LI ++++LF AG ETTSTTL W  L+M+ YP+IQEKV  EI  +IG+ + P+   ++++ YT AV+ EV R+ ++ PL++      D  + G+++PK ++I  NL A H DP  W +P TF P+HFL    NG  +++ RE  +PFS+GKR CLGE LAR+E FIFF S++Q+F
Sbjct:   50 LPFLGNFFLVDFEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVT---------------YLEASKTCQLYNVFPWIMKFLPGPHQTLFSNWK---KLKLFVSHMIDKHRKDWN-PAETRDFIDAYL---KEMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFL---ENG--QFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKF 469          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2C8 (cytochrome P450 family 2 subfamily C member 8 [Source:HGNC Symbol;Acc:HGNC:2622])

HSP 1 Score: 225.328 bits (573), Expect = 2.198e-64
Identity = 158/490 (32.24%), Postives = 244/490 (49.80%), Query Frame = 2
Query:  920 LCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIE-PPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQ-----------LILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLK---QSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEI 2344
            L  C++F+L+F  +    CR+  +P G       + LPIIG + +I+   +        +  GP+F +  GM  IVV + YE +K+ALID+   FSGR +  +   +T   GII  +GK W   R F L  LR+FG+GK    + VQ E    ++EL        D + ++     N+I   +  KRF   D N   + K   +F +N  I+            L++  FP   N  L            K+    + +  E++KEH+ +LD  +   D +D FLIK  Q K   +S  N+E+     L+ T  +LF+AG ETTSTTL +  L + K+P++  KV +EI  +IG+ R P M D+  + YT AV+ E+ R S + P  + H    D     + IPK + I   L +   D + + +P  F P HF  LD NG   ++  +  +PFS GKR C GE LAR E F+F  +++Q F +   +++
Sbjct:    7 LVLCLSFMLLFSLW-RQSCRRRKLPPG------PTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMK---RFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVL------------KNVALTRSYIREKVKEHQASLDVNNP-RDFIDCFLIKMEQEKDNQKSEFNIEN-----LVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHF--LDKNG--NFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDL 464          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2B6 (cytochrome P450 family 2 subfamily B member 6 [Source:HGNC Symbol;Acc:HGNC:2615])

HSP 1 Score: 224.172 bits (570), Expect = 5.925e-64
Identity = 143/430 (33.26%), Postives = 222/430 (51.63%), Query Frame = 2
Query: 1079 LLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDN-SSLICQLIYLLTS-----------EWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVES-FVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
             L+   K G +F + LG R +V+L   E I++AL+D A  FSGR    +        G+I+ +G  W   R F +  +RDFG+GK    E +Q E    ++EL    G ++D + L    T NII   +  KRF   D                ++ ++++ L +  F   SS+  QL  L +             +K+   I  +    +++HR  LD  S  +DL+D +L+    +++   N  S F    L   ++ LF AG ETTSTTL +  L M KYP + E+V++EI ++IG  R P ++D+  + YT+AV+ E+ R S + P+ + H      +  G+ IPKD+ +F  L     DP  +E P  F P+HF  LD+NG  K    E  IPFS+GKR CLGE +AR+E F+FF +++Q F ++
Sbjct:   55 FLRFREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQD----------------QEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLD-PSAPKDLIDTYLL---HMEKEKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHF--LDANGALKKT--EAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMA 460          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33C1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O44704])

HSP 1 Score: 214.157 bits (544), Expect = 1.114e-60
Identity = 151/490 (30.82%), Postives = 251/490 (51.22%), Query Frame = 2
Query:  914 MELCYCVTFILI-FLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIE--PPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWS-PKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPN-----VHFMEKAITKFTKNKDIIQLILLM-FPCFDNSSLICQLIYLLTSEWKSFIRIQ-DFFAEEIKEHRNALDF---TSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEE 2341
            M +   +TF+ I F+Y LYW  R  P        P    LP+ G +  I   PP +    +  +K G ++   +G    +++N ++ IK+  I DA+ ++ +   P V      + GII  +G +W   R F L  +RDFGLGK+   E +  E  +    LD   G   D  E+      N++++ +   RF     N      H ++     F K    + + L M  P F  + L+ + +Y      K+F      FF ++I+ HR+ +DF    SE  D ++ FL K+ + ++S G+ E++ + QL+   ++L+ AG  TT+ T+ W   ++  +P++Q+K+H+E+ ++IG +RL T  DK  L Y  A ++E  R  ++ PL+L H T  D  I+GF IPK + +   +     + E++  P TF P+ F  +D NG  K +  +EL PFSVGKR C GE LAR E F+F  + + R++I  ++E
Sbjct:    1 MIIILLLTFLTIYFVYELYWKRRNFP--------PGPCPLPVFGNLLSIANPPPGYKAFERWTKKYGDVYTFWIGNTPHIMINTWDKIKETFIRDADTYTNKVVLPMVTLSRGGEYGIIDSNGAMWREHRRFALSTMRDFGLGKNLMQENILMEVQDVFARLDAKLGSETDVPEVFDHAVANVVNQLLFGYRFMGPKENEYQELKHIIDSPAEIFGK----LHIFLAMNIPIF--AKLLPESLY--EGPIKTFRDTTLAFFNKQIEAHRHRIDFEDLNSESTDFVETFL-KEQKRRESEGDSETYSNIQLLNVCIDLWFAGLNTTTNTITWAISYVLHHPEVQDKIHEELDKVIGSDRLITTADKNDLPYFNASINESQRGINILPLNLQHATTRDTVIDGFKIPKGTGVVAQISTVMNNEEVFPDPYTFNPDRF--IDENG--KLKKVDELAPFSVGKRSCPGEGLARMELFLFIANFLNRYKIHPSKE 469          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-14A1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27506])

HSP 1 Score: 208.379 bits (529), Expect = 1.472e-58
Identity = 154/471 (32.70%), Postives = 243/471 (51.59%), Query Frame = 2
Query:  932 VTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPP-MHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRW--SPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQI-VDFSELIPIYTTNIISRFIMNKRFTRDDP-NVHFMEKAITKFTKN-KDIIQLILLMFPCFDNSSLICQLIYL-LTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQ 2323
            V FI+ +++  YW   K   PKG    P+   LP IG IH+  P  +  Y   L +  GP F I +    IV L +YE IK A ++  + F+ R   SP+    V   +GI+  DG  W  QR   LK+LRDFGLG++   E V       L +L+ ++ +  VD    I +   N+I+  +    +  +D        K + K  ++ +  + L++  FP   +  ++  + Y  + +   S+     F  EE+       D  SE E+ +  ++    Q+KQ TGN    +   L  T ++ ++AG ETTS +L W   FM KYP++Q+KV KEI + +G  RLP+M+DK  + YTQAV+ EV R S++ P    H+   +  I+G  +P  SL+F  L++   +  ++E P TF P  +L  D     K    E+ IPFS+GKR C+GE LAR E F+ F +++Q+++
Sbjct:    9 VIFIIFYVFHFYWKVSK--YPKG----PLP--LPFIGNIHQFPPDNVQKYFDVLSKTYGPCFTIWIPFPAIV-LTDYEHIKDAFVNQGDTFTYRAHRSPETLLPVHDHTGILASDGDHWRLQRRTSLKILRDFGLGRNLMEEQVIRSVHEMLIQLENINDKKNVDVFWPIQLCVGNVINETLFGFHYKYEDSEKFKTFVKIVDKHLRHLQGKMPLLVSAFPWLKHVPIVGDIGYHNIKNNISSY---HTFIEEEVATQVKKYDGESEPENFVHAYM---QQMKQ-TGNPGLDIT-NLCATVLDFWLAGMETTSNSLRWHLAFMMKYPEVQDKVRKEILDNVGTARLPSMSDKPNMPYTQAVIHEVQRCSNMIPFLGSHQCKEETEIHGNRVPAGSLVFAQLWSVMRNDTVFEDPETFNPSRYLQSDGKTFDK-AVLEKTIPFSIGKRNCVGEGLARMELFLIFSALIQKYE 461          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33C4 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O16362])

HSP 1 Score: 207.223 bits (526), Expect = 3.213e-58
Identity = 145/480 (30.21%), Postives = 241/480 (50.21%), Query Frame = 2
Query:  920 LCYCVTFILIFLYFLYWVCRK-PPIPKGLKEIPMESGLPIIGAIHK--IEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDS-GIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPN-----VHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTS-EGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
            L     F+    + LYW  R  PP P     IP    LP +G I    +  P +       +K G ++   +G    V++++Y+++K   + D + +  ++   ++ ++   + GI+  +G +W+T R F L  LRDFGLGK    E +  E  +   + D   G   D S ++     N+I++ I   RF  D           ME   T F   K  ++  +          L  + +  L  EW+       FF  +I+ HR  +DF S E  D  + +L K+ + +++ G  E F + QL  T ++L++AG  TT+TT+NW   ++  +PD+ +K+++E  +++G +RL TM DK  L Y  AV++E  R +++ P++L H T  D  ING+ + K + +   +    +D +I+  P  F P+ F  +D NG  K    E+LIPFS+GKRQC GE LAR E F+F  +   R++IS
Sbjct:    4 LLVFTAFLAFLFHELYWKRRNLPPGP-----IP----LPFMGNILTMLLNKPGYECFRNCTKKYGDVYTFWMGKTPFVMISSYDLLKDTFVRDGDTYKDKYPQPLNQKIRGGNYGIVESNGHLWSTHRRFALTTLRDFGLGKDLMQEKILIEVEDIFKKFDAQLGLEQDVSVVMNNAIANVINQNIFGYRFEGDKEEDFKKLRELMEYQETAFATFKVYVEAFIPKVGAL----LPGRSLNELLEEWRD--NFYTFFDTQIENHRKKIDFDSQESLDYAEAYL-KEQRKQEALGEFELFSNKQLSNTCLDLWLAGLSTTNTTVNWTICYVLNHPDVLQKMNEEFDQVVGSDRLVTMGDKNNLPYFNAVLNESQRCANIVPINLFHATTKDTVINGYPVKKGTGVIAQISTVMLDEKIFPDPYKFNPDRF--IDENG--KPIKIEQLIPFSIGKRQCPGEGLARMEMFLFLANFFNRYKIS 463          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33C2 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O44706])

HSP 1 Score: 204.912 bits (520), Expect = 2.808e-57
Identity = 149/484 (30.79%), Postives = 242/484 (50.00%), Query Frame = 2
Query:  962 LYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIE--PPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWS-PKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTR-DDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLI--YLLTSEWKSFIRIQ-DFFAEEIKEHRNALDFT---SEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEE--ISEDKYSQTIIG 2377
            LYW  R  P        P    LP+ G +  I   PP +    +  +K G I+   +G    +++N ++ IK+  I DA  ++ +   P +D     + GII  +G  W   R F L  +RDFGLGK+   E +  E  +    LD   G   D  E+      N++++ +   RF    +     +++ I   T       + L M     N  +I +L+  ++    +K F      FF ++I+ HR  +D     SE  D ++ FL K+ + ++S G+ E+F + QL    ++L+ AG  TT+ T+ W   ++  +P++Q+KVH+E+ ++IG +RL T  DK  L Y  A ++E  R  ++ PL+L H T  D  INGF IPK + +   +     + E++  P TF P+ F  +D +G  K +  EEL PFSVGKR C GE LAR E F+F  + + R++I  ++E   S DK +  +I 
Sbjct:   18 LYWKRRNFP--------PGPCPLPVFGNLLSIANPPPGYEAFERWTKKYGDIYTFWIGNTPHIMINTWDKIKETYIRDAETYTNKVRLPALDLFRGGEYGIIDSNGATWREHRRFALSTMRDFGLGKNLMQENILMEVQDVFARLDAKLGSETDIPEVFDHAVANVVNQLLFGYRFVGPKESEYQELKRIIEAPTDLFGKPHMFLAM-----NIPVIAKLMPEFMYEGPFKDFRDTAFAFFNKQIEAHRQEVDLNDLNSESTDFVETFL-KEQKRRESEGDSETFSNVQLSNVCMDLWFAGLNTTTNTITWAISYILHHPEVQDKVHEEMDKVIGSDRLITTADKNDLPYFNAFINEAQRGINIVPLNLQHATTRDTVINGFKIPKGTGVVAQISTVMNNEEVFPDPHTFNPDRF--IDEHG--KLKRVEELAPFSVGKRSCPGEGLARMELFLFIANFLNRYKIYPSKEGPPSMDKSNGALIA 483          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33C5 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O16671])

HSP 1 Score: 204.527 bits (519), Expect = 3.698e-57
Identity = 137/485 (28.25%), Postives = 241/485 (49.69%), Query Frame = 2
Query:  920 LCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHK--IEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDS-GIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNV-------HFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEI 2344
            L       L   + LYW  R  P        P  + LP +G      +E P +    +  ++ G ++   +G    V++ +Y+++K+  + D + +  ++    + ++     GI+  +G +W+T R F L  LRDFGLGK    E +  E  +   + D   G+  D   ++     N+I++ I   RF  D+ N        H +E    +F   K  ++  +     F     + QL+     +W++      FF  +I+ HR  +DF SE         +K+ + +++ G  E F + Q   T ++L++AG  TT+TT+NW   ++  +PD+ +K+++E  +++G +RL TM DK  L Y  AV++E  R +++ P++L H T  D  ING+ + K + +   +    +D +I+  P  F P+ F  +D NG  K    E+LIPFS+GKRQC GE LAR E F+F  +   R++IS + ++
Sbjct:    4 LLLSAAVCLFLFHELYWKRRSLP--------PGPTPLPFMGNTLAMLLEKPGYECFRRWTKQFGGVYTFWMGNIPYVIIGSYDLLKETFVRDGDTYKDKYPQPFNEKLRGGMYGIVESNGHMWSTHRRFALSTLRDFGLGKDLMQEKILIEVEDIFRKYDAQLGKEQDIQVVLNNAIANVINQTIFGYRF--DETNQEEFERMRHLVEYQEKQFATVKVYVEAFVPTIGKFLPGKSLDQLL----DDWRN--SFYTFFDTQIENHRKKIDFDSEESQDYAEAYLKEQKKQEALGEFELFSNTQFSNTCLDLWLAGVSTTNTTVNWTICYVLNHPDVLQKMNEEFDQVVGSDRLVTMGDKNNLPYFNAVLNESQRCANIVPINLFHATTKDTVINGYPVKKGTGVIAQISTVMLDEKIFPEPYKFNPDRF--IDENG--KPIKIEQLIPFSIGKRQCPGEGLARMEIFLFLANFFNRYKISPSSKV 468          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074610)

HSP 1 Score: 218.009 bits (554), Expect = 1.490e-61
Identity = 151/486 (31.07%), Postives = 245/486 (50.41%), Query Frame = 2
Query: 1013 PMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGL-----GKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVH----FMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESF----VDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDIKNFLFKRR 2431
            P   GLP+IG +  +    H   ++L ++ G +F  +LG +  VV+++Y+MI++        F+GR       +  +  GII   GK+W  QR F+   LR FG+     GK +  + +  E   F+  L    GQ VD S +I +  +N+I   +M+ RF+ DDP        +E+ +  F +   +  +  +   CF + S     I    +E      +Q F+ + I +H+ + D  +   DL+D +L +  + K    + E F     + QL++  ++LF AG ET  TTL W  +FM + P    +V  E+ +++G+ RLPT+ D + L  T++ + E +R SS+ PL+  H    D  +NG+ IP  S + P + + HMDP +WE P  F P  F  +D+ G  K +  E  IPF VG+R CLG+ LAR E F+FF S +  F I+    + E +   ++ GN G   T +      KRR
Sbjct:   55 PGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECF--RREEFTGRPDTPF-MQTLNGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQ--CFPSISTAKNKIAQNRAE------MQRFYQDVIDDHKRSFD-PNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRF--IDTEG--KVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIA----LPEGQPLPSLKGNVGATITPESFKVCLKRR 520          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074609)

HSP 1 Score: 218.009 bits (554), Expect = 1.490e-61
Identity = 151/486 (31.07%), Postives = 245/486 (50.41%), Query Frame = 2
Query: 1013 PMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGL-----GKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVH----FMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESF----VDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDIKNFLFKRR 2431
            P   GLP+IG +  +    H   ++L ++ G +F  +LG +  VV+++Y+MI++        F+GR       +  +  GII   GK+W  QR F+   LR FG+     GK +  + +  E   F+  L    GQ VD S +I +  +N+I   +M+ RF+ DDP        +E+ +  F +   +  +  +   CF + S     I    +E      +Q F+ + I +H+ + D  +   DL+D +L +  + K    + E F     + QL++  ++LF AG ET  TTL W  +FM + P    +V  E+ +++G+ RLPT+ D + L  T++ + E +R SS+ PL+  H    D  +NG+ IP  S + P + + HMDP +WE P  F P  F  +D+ G  K +  E  IPF VG+R CLG+ LAR E F+FF S +  F I+    + E +   ++ GN G   T +      KRR
Sbjct:   55 PGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECF--RREEFTGRPDTPF-MQTLNGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQ--CFPSISTAKNKIAQNRAE------MQRFYQDVIDDHKRSFD-PNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRF--IDTEG--KVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIA----LPEGQPLPSLKGNVGATITPESFKVCLKRR 520          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp305a1 (gene:FBgn0036910 transcript:FBtr0074925)

HSP 1 Score: 160.999 bits (406), Expect = 9.058e-42
Identity = 119/415 (28.67%), Postives = 211/415 (50.84%), Query Frame = 2
Query: 1118 IKLGMRKIVVLNNYEMIKKALIDDANNFSGR---WSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTR-DDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSS---LICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNAL--DFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGK---ERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQI 2326
            +KLG   +VV   +EM+K+  + +   F GR   +  ++    T   GI   DG++W   R F +K +R+ G G+S+    ++ E    L +L+    Q ++    +     N++   I  KR  R +D  +  +   + + +K  DI   +L  FP   + +       LI  L +E      +  FF + I+EHR  L  D +    DL+  +L ++ + + + G   +F + QL+ T ++ FIAG +TTS T+N   + ++  PD+QEK+  +++  +     +  P ++ ++A +Y  A + EV R   ++P++   R      + G+ IPK++ I  +L + H+D E W+ P  F PE F  +DS G  K    E  +PF +G+R+CLG++LAR+  F F V +VQ F +
Sbjct:   73 LKLGREYVVVALGHEMVKEVQLQEV--FEGRPDNFFLRLRTMGTR-KGITCTDGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSVLNVLWCLIAGKRIARQEDGTLRRLLDLMNRRSKLFDICGGLLAQFPWLRHVAPDRTGYNLIQQLNTE------LYGFFMDTIEEHRRQLAKDPSPAESDLIYAYL-QEMKDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERF--IDSAG--KCFKDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSV 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0343812)

HSP 1 Score: 159.458 bits (402), Expect = 2.983e-41
Identity = 111/418 (26.56%), Postives = 206/418 (49.28%), Query Frame = 2
Query: 1112 FRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDS--GIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELD---TLSG---QIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIR----IQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMN-DKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQI 2326
            + +K+G  K+V+    + I + + ++  +  GR         T +S  G++  DG++W  QR FIL+ L++FG  +S  ++IV NE    L +L      SG     ++  +L  +Y  N +   +  +R+    P +  + +   +  KN D++  +   FP       + + I    S +  F+     +  F ++EI+ HR       E  DLMD +L  Q +     G    F D  L+   +++F+AG ETT+ +L +C + +   P+IQE+  +EI E++G ER+P  + D+  L Y +A+  E +R+  +    + HR   D  ++G+ IPKD+++        ++P  +  P +F P+ +L    +G  K    E   PF  G+ +C+G+ L R   F+F  +++Q F++
Sbjct:   71 YGLKIGKDKVVIAYTNDAISEMMTNE--DIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFP-------LLRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKG---MFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL---FDGHLKLP--EAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM 471          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0080828)

HSP 1 Score: 159.458 bits (402), Expect = 2.983e-41
Identity = 111/418 (26.56%), Postives = 206/418 (49.28%), Query Frame = 2
Query: 1112 FRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDS--GIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELD---TLSG---QIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIR----IQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMN-DKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQI 2326
            + +K+G  K+V+    + I + + ++  +  GR         T +S  G++  DG++W  QR FIL+ L++FG  +S  ++IV NE    L +L      SG     ++  +L  +Y  N +   +  +R+    P +  + +   +  KN D++  +   FP       + + I    S +  F+     +  F ++EI+ HR       E  DLMD +L  Q +     G    F D  L+   +++F+AG ETT+ +L +C + +   P+IQE+  +EI E++G ER+P  + D+  L Y +A+  E +R+  +    + HR   D  ++G+ IPKD+++        ++P  +  P +F P+ +L    +G  K    E   PF  G+ +C+G+ L R   F+F  +++Q F++
Sbjct:   71 YGLKIGKDKVVIAYTNDAISEMMTNE--DIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFP-------LLRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKG---MFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL---FDGHLKLP--EAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM 471          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2n13 (cytochrome P450, family 2, subfamily N, polypeptide 13 [Source:ZFIN;Acc:ZDB-GENE-041001-158])

HSP 1 Score: 240.736 bits (613), Expect = 4.578e-70
Identity = 168/489 (34.36%), Postives = 260/489 (53.17%), Query Frame = 2
Query:  893 YFQLLSEMELCYCVTFILIFLYFL-YWVCRKPPIPKGLKEIPMESGLPIIGAIHKI---EPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEV-THDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFL-DELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTK-NKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAE 2338
            Y  +L  +++   + F++ FL    Y   R PP     K  P    +P++G I  +   EP  H YL KLG     IF ++LG  K V +  Y+M+K+AL+  A NF  R +  V A V + ++G+ + +G++W  QR F L  LR+FGLGK K++E+   E   FL +E+D   G   D + L+    +NII + +  +RF   D     M K I+K  +    +   I   FP     +++  L       + ++  ++ F  E I +H+  LD  SE  D +D FLI+  +       V  F +  L+   ++LF+AG E+TS TL W  +++  YPD+QEKV +EI  +IG  R P++ DK  + YT+AV+ E++R   V PL+ +     D  +   +IPK + + P L++   D   WE+P  F P HF  LD  G  K+  R+  +PFS GKR CLGE +AR E F+FFVS+ ++F+ S  E
Sbjct:    3 YTAILETLDVKGILLFMVAFLLVADYLKNRNPP-----KYPPSPFSVPLLGNIFNVDSKEP--HLYLTKLGHAYNNIFSLRLGSDKTVFITGYKMVKEALVTQAENFVDRPNSPVLARVYSGNAGLFFSNGEMWKKQRRFALSTLRNFGLGK-KTMELAICEESRFLLEEIDEQKGAAFDPTILLYNAVSNIICQMVFGQRFDYADHQFKTMLKYISKSIQLEGSVWGQIYEAFP-----AIMKHLPGPHNDIFSNYDLLKSFVHEVIVKHKAKLD-PSEPRDYIDTFLIEMKEKPHE--RVNGFEEPNLVACVLDLFLAGTESTSNTLCWGLIYLIMYPDVQEKVQEEIDRVIGNSREPSIADKPNMPYTEAVIHEIMRFGDVIPLNGLRVAARDTTLGECFIPKGTTVLPILHSVLFDENEWETPYKFNPGHF--LDKEG--KFVRRDAFMPFSAGKRVCLGEQIARIELFLFFVSLFRKFRFSATE 471          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2k16 (cytochrome P450, family 2, subfamily K, polypeptide16 [Source:ZFIN;Acc:ZDB-GENE-041010-37])

HSP 1 Score: 239.195 bits (609), Expect = 1.849e-69
Identity = 153/437 (35.01%), Postives = 236/437 (54.00%), Query Frame = 2
Query: 1070 HHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFM-EKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDL---MDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQT 2368
            H  L ++ ++ GP+F++  G +K+VVL  Y+ +K+AL++ A  F  R    +  + T   GII+ +G+ W   R F L  LRDFG+GK K  E +  E  +  +E +   G+  + ++L+    +++IS  +  +RF   DP +  M ++A      +      +  MFP           +  L   W+  ++      EEI E  N L  T   +DL   +D FL+++   + S      F +  LI T   LF+AG +TTSTTL W  L M+KYP IQ++V +EI ++IG  R P   D+K L YT AV+ E  RL+++ P+S+ H T  D   NG++I K + IFP L +   D + WE+P  F P HF  LD  G  ++  R+  +PFS G+R CLGESLAR E F+FF S++Q F+ +    +SED+   T
Sbjct:   61 HLSLCEMAKQFGPVFKVYFGPKKVVVLAGYKAVKQALVNYAEAFGDREIMPLFHDFTKGHGIIFANGESWREMRRFALTNLRDFGMGKKKIEEKIIEETCHLREEFEKFEGKPFETAQLMNYAASSVISSIVYGRRFEYTDPQLRTMVDRANESVRLSGSASVQLYNMFP----------FLGPLLKNWRQLMKNLHLDIEEISELVNGLHQTLNHQDLRGFVDSFLVRKQYAEDSGEKDSHFHEQNLIYTVGNLFVAGTDTTSTTLRWSLLLMAKYPHIQDRVQEEIDQVIGG-RQPVSEDRKNLPYTDAVIHETQRLANIVPMSIPHMTSSDITFNGYFIKKGTCIFPLLTSVLWDEDEWETPHIFNPNHF--LDEQG--RFVKRDAFMPFSAGRRICLGESLARMELFLFFTSLLQYFRFTPPPGVSEDELELT 482          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2p8 (cytochrome P450, family 2, subfamily P, polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-061030-1])

HSP 1 Score: 238.81 bits (608), Expect = 2.394e-69
Identity = 168/473 (35.52%), Postives = 247/473 (52.22%), Query Frame = 2
Query:  932 VTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIE-PPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDE-LDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTK-NKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFI----RIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
            + F+ +FL    ++  K   PK     P    LPIIG +H I+   +H    K   + G IF  +L   +IVVLN Y ++K+  I   +N + R    +  E+  D G+I   G  W  QR F L  LR+FGLGK KS+E   N    FL+E +    G+  D   L+    +N+I   +   RF   D +   + K I++       I   +  MFP          L+  L    K+ I    ++ DF  E++ EHR   D  S   D +D FL +  +LK  T     F    L   S++LF+AG ETTSTTL W  L+M KYP+IQ KV +EI  ++G  R P+++D+  + YT AV+ E+ R+ +++P++L   T  D  I  + IPK +++  NL +   D   WE+P +F P HF  LD+ G  K++ R+  +PFS+GKR CLGE LAR E F+FF S++QRF  S
Sbjct:   16 LIFLCVFLLLGDYIKNK--APKNFPPGPWS--LPIIGDLHHIDNSKIHLQFTKFAERYGNIFSFRLFGPRIVVLNGYNLVKEVYIKQGDNLADRPVLPLFYEIVGDKGLILSSGYKWKHQRRFALSTLRNFGLGK-KSLEPSINVECGFLNEAISNEQGRPFDPRLLLNNAVSNVICVLVFGNRFDYSDHHFQTLLKNISEAVYLEGSICNQLYNMFP---------WLMERLPGPHKTIITLWRKVTDFVREKVNEHRVDYD-PSNPRDYIDCFLTEMEKLKDDTA--AGFDVENLCICSLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQEEIDAVVGGSRQPSVSDRDNMPYTNAVIHEIQRMGNIAPINLARSTSEDTQIGNYSIPKGTMVTSNLTSVLFDESEWETPHSFNPGHF--LDAEG--KFRRRDAFLPFSLGKRVCLGEQLARMELFLFFSSLLQRFTFS 467          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2y3 (cytochrome P450, family 2, subfamily Y, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-050522-490])

HSP 1 Score: 238.424 bits (607), Expect = 2.754e-69
Identity = 150/421 (35.63%), Postives = 227/421 (53.92%), Query Frame = 2
Query: 1079 LLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIR----IQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
             +K  +  G +  + LG +++VVL  YE +K+AL+D A++F+ R        +    G+   +G+ W   R F L  LRDFG+G+ +  + +Q E    L   +    + VD +       +N+I   +  +RF  +D N   + + I+K         L  L  P     ++  Q++   +S   + ++    I+ F   ++KEH   LDF S+  D +D FLI+  Q K        F    L+ T + LF+AG ETTSTTL +  + + K+P IQE++ +EI  +IG+ R+PTM D+K+L +T AV+ EV R   + PLSL H    D    G+ IPKD++I P L++   D   WE+P TF PEHF  LDSNG  K  P    +PFS GKR C+GESLAR E F+F VS++Q+F  S
Sbjct:   55 FMKWRKTYGSVMTVHLGPQRMVVLVGYETVKEALVDQADDFAPRAPIPFMNRIVKGYGLAISNGERWRQLRRFTLTTLRDFGMGRKRMEQWIQEESRYLLKSFEETKSKPVDPTFFFSRTVSNVICSLVFGQRFDYEDKNFLQLLQIISKL--------LRFLSSPWGQLYNIFPQVMESFSSRHHAILKDVENIRTFIRNKVKEHEQRLDF-SDPSDFIDCFLIRLTQEKDKLDT--EFHKDNLMATVLNLFVAGTETTSTTLRYALMLLIKHPQIQEQMQREIDRVIGQNRIPTMEDRKSLPFTDAVIHEVQRYMDIVPLSLPHYAMKDITFRGYKIPKDTVIIPMLHSVLRDEGHWETPWTFNPEHF--LDSNGNFKKNP--AFMPFSAGKRVCVGESLARMEIFLFIVSLLQKFSFS 460          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2y3 (cytochrome P450, family 2, subfamily Y, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-050522-490])

HSP 1 Score: 236.113 bits (601), Expect = 2.147e-68
Identity = 149/421 (35.39%), Postives = 226/421 (53.68%), Query Frame = 2
Query: 1079 LLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIR----IQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
             +K  +  G +  + LG +++VVL  YE +K+AL+D A++F+ R        +    G+   +G+ W   R F L  LRDFG+G+ +  + +Q E    L   +    + VD +       +N+I   +  +RF  +D N   + + I+K         L  L  P     ++  Q++   +S   + ++    I+ F   ++KEH   LDF S+  D +D FLI+  Q K        F    L+ T + LF+AG ETTSTTL +  + + K+P IQE++ +EI  +IG+ R+PTM D+K+L +T AV+ EV R   + PLSL H    D    G+ IPKD++I P L++   D   WE+P TF PEHF  LDSNG  K  P    +PFS GKR C+GESLA  E F+F VS++Q+F  S
Sbjct:   55 FMKWRKTYGSVMTVHLGPQRMVVLVGYETVKEALVDQADDFAPRAPIPFMNRIVKGYGLAISNGERWRQLRRFTLTTLRDFGMGRKRMEQWIQEESRYLLKSFEETKSKPVDPTFFFSRTVSNVICSLVFGQRFDYEDKNFLQLLQIISKL--------LRFLSSPWGQLYNIFPQVMESFSSRHHAILKDVENIRTFIRNKVKEHEQRLDF-SDPSDFIDCFLIRLTQEKDKLDT--EFHKDNLMATVLNLFVAGTETTSTTLRYALMLLIKHPQIQEQMQREIDRVIGQNRIPTMEDRKSLPFTDAVIHEVQRYMDIVPLSLPHYAMKDITFRGYKIPKDTVIIPMLHSVLRDEGQWETPWTFNPEHF--LDSNGNFKKNP--AFMPFSAGKRSCVGESLASMELFLFTVSLLQKFTFS 460          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 243.432 bits (620), Expect = 6.904e-71
Identity = 169/473 (35.73%), Postives = 251/473 (53.07%), Query Frame = 2
Query:  947 IFLYFLYWVCRK-----PPIPKGLKEIPMESGLPIIGAIH--KIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEV---THD----SGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLI-YLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRF 2320
            IFLY +++   K     PP PK L         P+IG +H   ++ P   ++ +L  K GP+F ++LG +K+VVL   + +K AL++ A+ FSGR  PK+   V   TH     SG+I+ DG+ W   R F L  LRDFG+GK    + +  E    ++   +  G+  D + ++     NII   ++N RF   DP    + K I   ++N  I    ++M   ++    I Q +     S +++   + +F  E   EHR+ LD   +  DL+D FL+KQ + K S+   + F D  L      LF AG ETTSTTL W  L M KYPDIQ+KV  EI ++IG    P +  +K + YT AV+ E+ R ++++P  L H T  D    G++IPK + + P L +   D   ++ P  FYPEHF  LDS G  K+   E  +PFS GKR C GE+LA+ E F+FF  ++Q F
Sbjct:   14 IFLYKVFYGGEKESQNFPPGPKPL---------PLIGNLHIMNMKKPFLTFM-ELAEKYGPVFSVQLGTKKVVVLCGTDAVKDALVNHADEFSGR--PKIPIYVFSLTHVIPICSGVIFADGENWKVMRRFTLSTLRDFGMGKKTLEDRIGEESGCLVETFKSHEGKPFDNTMILNASVANIIVHILLNHRFEYQDPT---LLKLIKSVSENVRIGGRPIVML--YNTYPSIMQWVPGSHKSIYENSQNLLNFLKETFTEHRHQLDVNDQ-RDLIDTFLVKQQEEKSSS--TKFFHDENLTILLSNLFGAGMETTSTTLRWGILLMMKYPDIQKKVQDEIDQVIGSAE-PRLEHRKQMPYTDAVIHEIQRFANLAPNGLPHATTTDVTFRGYFIPKGTQVIPVLTSVLRDKAYFKKPEEFYPEHF--LDSEG--KFLKNEAFLPFSAGKRICAGETLAKMELFLFFTKLLQNF 461          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: slc35b2 (solute carrier family 35 member B2 [Source:Xenbase;Acc:XB-GENE-1009913])

HSP 1 Score: 242.276 bits (617), Expect = 1.515e-70
Identity = 155/439 (35.31%), Postives = 234/439 (53.30%), Query Frame = 2
Query: 1013 PMESGLPIIGAIHKI--EPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILL-MFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRF 2320
            P    LPIIG IH I  + P   YL +L +K GPIFR+++G +K+VVL  YE +K AL++ A  FS R    +  +V  + GII+  G+ W   R F L  LRDFG+G+    + +  EC   +++  +  G+  D + ++     NII   ++  RF   DP    +   I +  +      ++L  +FP     S++  L     +  K+    Q F  E   +H+  LD   +  +L+D FL+KQ + K   GN   F D  L      LF+AG ETTST++ W  L M KYP+IQ+ V  EI ++IG+ R P    +K++ YT AV+ E+ R  ++ P++L H T  D    G+++PK + + P L +   D   +E P  FYP+HFL  + N +      E  +PFS GKR C GE+LAR E F+FF S++Q F
Sbjct:   36 PGPKPLPIIGNIHNINLKRPYLTYL-ELWKKYGPIFRVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVVPIFLDVVKEYGIIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPKFLRLMSLINENLRLTGSPTVMLYNVFP-----SVMRWLPGNHQTVGKNAAENQRFIRETFIKHKEKLDVNDQ-RNLVDAFLVKQQEKK---GNAVYFHDDNLTMLVSNLFVAGMETTSTSVRWGLLLMMKYPEIQKNVQNEIEKVIGQSR-PQTEHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPKGTFVIPLLTSVLYDQTRFEKPKEFYPQHFLDSEGNFVKN----EAFLPFSAGKRSCAGENLARMELFLFFTSLLQNF 459          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: slc35b2 (solute carrier family 35 member B2 [Source:Xenbase;Acc:XB-GENE-1009913])

HSP 1 Score: 242.276 bits (617), Expect = 1.515e-70
Identity = 155/439 (35.31%), Postives = 234/439 (53.30%), Query Frame = 2
Query: 1013 PMESGLPIIGAIHKI--EPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILL-MFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRF 2320
            P    LPIIG IH I  + P   YL +L +K GPIFR+++G +K+VVL  YE +K AL++ A  FS R    +  +V  + GII+  G+ W   R F L  LRDFG+G+    + +  EC   +++  +  G+  D + ++     NII   ++  RF   DP    +   I +  +      ++L  +FP     S++  L     +  K+    Q F  E   +H+  LD   +  +L+D FL+KQ + K   GN   F D  L      LF+AG ETTST++ W  L M KYP+IQ+ V  EI ++IG+ R P    +K++ YT AV+ E+ R  ++ P++L H T  D    G+++PK + + P L +   D   +E P  FYP+HFL  + N +      E  +PFS GKR C GE+LAR E F+FF S++Q F
Sbjct:   36 PGPKPLPIIGNIHNINLKRPYLTYL-ELWKKYGPIFRVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVVPIFLDVVKEYGIIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPKFLRLMSLINENLRLTGSPTVMLYNVFP-----SVMRWLPGNHQTVGKNAAENQRFIRETFIKHKEKLDVNDQ-RNLVDAFLVKQQEKK---GNAVYFHDDNLTMLVSNLFVAGMETTSTSVRWGLLLMMKYPEIQKNVQNEIEKVIGQSR-PQTEHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPKGTFVIPLLTSVLYDQTRFEKPKEFYPQHFLDSEGNFVKN----EAFLPFSAGKRSCAGENLARMELFLFFTSLLQNF 459          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 241.891 bits (616), Expect = 1.966e-70
Identity = 167/468 (35.68%), Postives = 249/468 (53.21%), Query Frame = 2
Query:  947 IFLYFLYWVCRK-----PPIPKGLKEIPMESGLPIIGAIH--KIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIE--IVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLI-YLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRF 2320
            IFLY +++  +      PP PK L         P+IG +H   ++ P H   ++L  K GP+F + LG  K VVL   + +K ALI+ A+ FSGR    +  +    +GI++ DG+ W   R F +  LRDFG+GK K+IE  I++  C   ++   +  G+  D + ++     NII   ++N RF   DP    + K I   ++N  I    ++M   ++    I Q +     S +++   + +F  E   EHR+ LD   +  DL+D FL+KQ + K S+   + F D  L      LF AG ETTSTTL W  L M KYPDIQ+KV  EI ++IG    P +  +K + YT AV+ E+ R ++++P  L H T  D    G++IPK + + P L +   D   ++ P  FYPEHF  LDS G  K+   E  +PFS GKR C GE+LA+ E F+FF  ++Q F
Sbjct:   14 IFLYKVFYGGKGASQNFPPGPKPL---------PLIGNLHMMNMKKP-HLTFMELAEKYGPVFSVHLGANKAVVLCGTDAVKDALINYADEFSGRPKTPLFEQTFKGNGIVFADGENWKVMRRFTISTLRDFGMGK-KTIEDRIIEESCC-LVETFKSHKGKPFDNTMILNASVANIIVHILLNHRFEYQDPT---LLKLIKSVSENVRIGGRPIVML--YNTYPSIMQWVPGSHKSIYENSQNLLNFLKETFTEHRHQLDVNDQ-RDLIDTFLVKQQEEKSSS--TKFFHDENLTILLSNLFGAGMETTSTTLRWGILLMMKYPDIQKKVQDEIDQVIGSAE-PRLEHRKQMPYTDAVIHEIQRFANLAPNGLPHATTTDVTFRGYFIPKGTQVIPVLTSVLRDKAYFKKPEEFYPEHF--LDSEG--KFLKNEAFLPFSAGKRICAGETLAKMELFLFFTKLLQNF 456          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 240.736 bits (613), Expect = 4.677e-70
Identity = 153/465 (32.90%), Postives = 249/465 (53.55%), Query Frame = 2
Query:  947 IFLYFLYWVCRK-----PPIPKGLKEIPMESGLPIIGAIH--KIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRF 2320
            IFLY +++  +      PP PK L         P+IG +H   ++ P H   ++  +K GP+F I+LG+ K +VL   + +K ALI+  + FSGR    V  +++   G+++ DG+ W   R F L  LRDFG+G+    + +  E    ++   +   +  D + ++     NII   ++N RF   DP +  + K++++  K       I++++  +   S++  +     + +++F ++ +F  E   + R+ LD   +  DL+D FL+KQ + K S+     F D  L     +LF AG ETTSTTL W  L M KYPDIQ+KV  EI  +IG    P +  +K + YT AV+ E+ R +++ P+ L H    D    G+++PK + + P L +   D + ++ P  FYPEHF  LDS G   +   E  +PFSVGKR C+GE+LA+ E F+FF  ++Q F
Sbjct:   14 IFLYKVFYGGKGASQNFPPGPKPL---------PLIGNLHMMNMKKP-HLTFMEFSKKYGPVFSIQLGLNKAIVLCGADAVKDALINHGDEFSGRPKIPVFDQISKGYGVVFADGENWKVMRRFALSTLRDFGMGRKTIEDTIVEESGCLVETFKSHEAKPFDNTLILNAAVANIIVHILLNHRFEYQDPTLIKLIKSVSENVKIAG--SPIVMLYNTY--PSIMGWIPGSHKTVFENFQKLSNFLKETFTKRRDQLDVNDQ-RDLIDAFLVKQQEEKSSSKKF--FHDENLKVLLGDLFAAGMETTSTTLRWGILMMMKYPDIQKKVQDEIDRVIGSAE-PRLEHRKQIPYTDAVIHEIQRFANLVPIVLPHSITEDVTFRGYFLPKGTQVIPLLISVMQDKDYFQKPEEFYPEHF--LDSKG--NFVKNEAFLPFSVGKRSCVGETLAKMELFLFFTKLLQNF 456          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2j6 (cytochrome P450, family 2, subfamily j, polypeptide 6 [Source:MGI Symbol;Acc:MGI:1270148])

HSP 1 Score: 239.58 bits (610), Expect = 1.605e-69
Identity = 166/482 (34.44%), Postives = 256/482 (53.11%), Query Frame = 2
Query:  920 LCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLK-LGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTK-NKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFI---RIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISE 2350
            L   VTF+L+  YF      K   PK     P   GLP +G I +++    H  ++ L +K G IF + LG    VV+    +IK+AL     N   R    +   +++ +G+I+  G+IW  QR F L  LR+FGLGK    E +Q E  + ++ +    G+  +    I    +NII      +RF   D     M + + +       +I  +  +FP          + Y+  S  K F    +++ F +  I +HR   +   E  D +D FL +  +  + T    SF +  LI ++++LF AG ETTSTTL W  L+M+ YP++QEKV  EI  +IG++R   + D++++ YT AV+ EV R+ ++ PL++      D N+NGF++PK +++  NL A H DP+ W +P  F PEHFL    NG  +++ RE  +PFS+GKR CLGE LARSE FIFF S++Q+F  +F   I+E
Sbjct:   22 LVAAVTFLLLADYF------KNRRPKNYPPGPW--GLPFVGNIFQLDFGQPHLSIQPLVKKYGNIFSLNLGDITSVVITGLPLIKEALTQMEQNIMNRPLSVMQERISNKNGLIFSSGQIWKEQRRFALMTLRNFGLGKKSLEERMQEEASHLVEAIREEEGKPFNPHFSINNAVSNIICSVTFGERFDYHDSRFQEMLRLLDEVMYLETTMISQLYNIFPWI--------MKYIPGSHQKVFRNWEKLKLFVSCMIDDHRKDWN-PDEPRDFIDAFLKEMTKYPEKT---TSFNEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEVQEKVQAEIDRVIGQKRAARLADRESMPYTNAVIHEVQRMGNIIPLNVPREVAMDTNLNGFHLPKGTMVLTNLTALHRDPKEWATPDVFNPEHFL---ENG--QFKKRESFLPFSMGKRACLGEQLARSELFIFFTSLMQKF--TFNPPINE 476          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b9 (cytochrome P450, family 2, subfamily b, polypeptide 9 [Source:MGI Symbol;Acc:MGI:88600])

HSP 1 Score: 237.654 bits (605), Expect = 4.843e-69
Identity = 150/428 (35.05%), Postives = 227/428 (53.04%), Query Frame = 2
Query: 1082 LKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDN-SSLICQLIYLLTSEWKSFIRIQ-----------DFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
            ++L  K G +F + LG R +VVL   + I++AL+D A  FSGR +      V  D GI +  G+ W T R F L  +++FG+GK    E ++ E    ++EL    G  +D + L    T NII   +  +RF   D                   + L+ LM+  F   SS   Q+  L +   K F  +            D+ A  +++H+  LD  S   D +D +L++  + ++S  N E F    L+ + + LF AG ETTS TL++  L M KYP + EKV KEI ++IG  RLPT++D+  + YT AV+ E+ R S + P+ L H+   D    G+ +PK++ ++P L +   DP+ +E P  F PEHF  LD+NG  K    E  +PFS GKR CLGES+AR+E FIFF +++Q F ++
Sbjct:   56 IQLQEKHGDVFTVHLGPRPVVVLCGTQTIREALVDHAEAFSGRGTIAAAQLVMQDYGIFFASGQRWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQGVPLDPTFLFQCITANIICSIVFGERFDYTD----------------DQFLHLLNLMYKIFSLLSSFSGQMFELFSGFLKYFPGVHRQIVKKQQELLDYIAHSVEKHKATLD-PSAPRDYIDTYLLRM-EKEKSNHNTE-FHHQNLMMSVLSLFFAGTETTSATLHYGVLLMLKYPHVTEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLVPIGLPHKVIKDTLFRGYLLPKNTEVYPVLSSALHDPQYFEQPDKFNPEHF--LDANGALK--KCEAFLPFSTGKRICLGESIARNELFIFFTTILQNFSVA 460          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b13 (cytochrome P450, family 2, subfamily b, polypeptide 13 [Source:MGI Symbol;Acc:MGI:88599])

HSP 1 Score: 236.498 bits (602), Expect = 1.352e-68
Identity = 149/431 (34.57%), Postives = 227/431 (52.67%), Query Frame = 2
Query: 1079 LLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDN-SSLICQLIYLLTSEWKSFIRIQ-----------DFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCC--LFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
             + L  K G +F + LG R +VVL   + I++AL+++A  FSGR +      V  D GI +  G+ W T R F L  +++FG+GK    E ++ E    ++EL    G  +D +      T NII   +  +RF   D                +  ++L+ LM+  +    S  CQ+  L +   K F  +            +F    +++HR  LD  SE  D +D +L++  + ++S  N E F    L+ + + LF AG ETTSTTL  CC  L M  YP + EKV KEI ++IG  RLPT++D+  + YT AV+ E+ R S + P    HR   D    G+ +PK++ ++P L +   DP+ +E P +F P+HF  LD+NG  K    E  +PFS GKR CLGES+AR+E F+FF S++Q F ++
Sbjct:   55 FIHLQEKHGDVFTVHLGPRPVVVLCGTQTIREALVNNAEAFSGRGTIAAAQLVMQDYGIFFSSGERWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQGAPLDPTFFFQCVTANIICSIVFGERFDYTD----------------EQFLRLLNLMYQIYSLLRSFSCQMFELFSGLLKYFPGVHRQIAKNQQEILNFITHRVEKHRATLD-PSEPRDFIDTYLLRM-EKEKSNHNTE-FHHQNLMMSVLSLFFAGTETTSTTL--CCGFLLMLMYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDIVPTGAPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFEQPDSFNPDHF--LDANGALKKS--EAFLPFSTGKRICLGESIARNELFLFFTSILQNFSVA 460          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b19 (cytochrome P450, family 2, subfamily b, polypeptide 19 [Source:MGI Symbol;Acc:MGI:107303])

HSP 1 Score: 234.958 bits (598), Expect = 4.833e-68
Identity = 160/508 (31.50%), Postives = 255/508 (50.20%), Query Frame = 2
Query:  914 MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEP-PMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFD-NSSLICQLIYLLTSEWKSFI-----------RIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRT 2398
            ME    +   L   + ++ V +  P   G    P    LP +G + +++   +    ++L  K G +F + LG R +V+L   + I++AL++ A  FSGR +  V   +    G+I+  G+ W T R F L  +RDFG+GK    E ++ E    ++EL    G  ++ +        NII   +  +RF                  K+   + L+ L++  F   SSL  Q+  L ++  K F             I D+    +++HR  LD  S   D +D +L++    K+ + +   F    L+ + + LF AG ETTSTTL +  L M KYP + EKV KEI ++IG  RLPT++D+  + YT AV+ E+ R + ++P+ L H+   D    G+ IPK++ ++P L +   DP  +E P +F PEHF  LD+NG  K    E  +PFS GKR CLGE +AR+E F+FF +++Q F  S A  ++ +     I  N G  +T
Sbjct:    1 MEFSVLLLLALTTGFLIFLVSQSQPKTHG-HFPPGPRPLPFLGNLLQMDRRGLLSSFIQLQEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANIICSIVFGERFDY----------------KDHQFLHLLNLIYQTFSLMSSLSSQVFELFSAILKYFPGAHRQISKNLQEILDYIGHSVEKHRATLD-PSAPRDFIDTYLLRME--KEKSNHHTEFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHDPRYFEQPDSFNPEHF--LDANGALKTN--EAFMPFSTGKRICLGEGIARNELFLFFTTILQNF--SLASPVAPENID-LIPNNSGATKT 481          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2a4 (cytochrome P450, family 2, subfamily a, polypeptide 4 [Source:MGI Symbol;Acc:MGI:88596])

HSP 1 Score: 234.958 bits (598), Expect = 5.182e-68
Identity = 155/499 (31.06%), Postives = 251/499 (50.30%), Query Frame = 2
Query:  902 LLSEMELCYCVTFILIFLYFLYWVCRK-----PPIPKGLKEIPMESGLPIIGAIHKIEP-PMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPN-VHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIG 2377
            L S + L   V F+ + +    W  RK     PP P         + LP +G   ++    M++ L+K+ ++ GP+F I LG R+IVVL   E +K+AL+D A  FSGR        +    GI +  G+     R F +  LRDFG+GK    E +Q E    +D     +G  +D +  +    +N+IS  +   RF  +D   +  +   +         +  +  MF     SS++  L       +K    ++DF  ++++ ++  LD  S   D +D FLI+  + K++  N E ++   L+ T++ LF AG ET STTL +  L + KYPDI+ KVH+EI  +IG+ R P   D+  + YT+AV+ E+ R + + P+ L  R   D     F +PK + +FP L +   DP+ + +P  F P+HF  LD  G  +++  +  +PFS+GKR C GE LAR E F+F  +++Q F     +E  +   S  ++G
Sbjct:    2 LTSGLLLVAAVAFLSVLVLMSVWKQRKLSGKLPPGP---------TPLPFVGNFLQLNTEQMYNSLMKISQRYGPVFTIYLGSRRIVVLCGQETVKEALVDQAEEFSGRGEQATFDWLFKGYGIAFSSGERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGFLIDSFRKTNGAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSLQFTATSMGQVYEMF-----SSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSP-RDFIDSFLIRMLEEKKNP-NTEFYMK-NLVLTTLNLFFAGTETVSTTLRYGFLLLMKYPDIEAKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQRFADLIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHF--LDDKG--QFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFHFKSTQEPQDIDVSPRLVG 479          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P00178|CP2B4_RABIT (Cytochrome P450 2B4 OS=Oryctolagus cuniculus OX=9986 GN=CYP2B4 PE=1 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 4.266e-71
Identity = 152/441 (34.47%), Postives = 233/441 (52.83%), Query Frame = 2
Query: 1013 PMESGLPIIGAIHKIE-PPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPN-VHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
            P  S LP++G + +++   +    L+L  K G +F + LG R +VVL   + I++AL+D A  FSGR    V   +    G+I+ +G+ W   R F L  +RDFG+GK    E +Q E    ++EL    G ++D + L    T+NII   +  KRF   DP  +  ++     F+        +  +FP F     +          +++   I  F  + +++HR  LD  S   D +D +L++  + K    +   F    LI T + LF AG ETTSTTL +  L M KYP + E+V KEI ++IG  R P ++D+  + YT AV+ E+ RL  + P  + H    D    G+ IPK++ +FP L +   DP  +E+P TF P HF  LD+NG  K    E  +PFS+GKR CLGE +AR+E F+FF +++Q F I+
Sbjct:   32 PGPSPLPVLGNLLQMDRKGLLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVIFANGERWRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFPGF-----LKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLD-PSNPRDFIDVYLLRMEKDKSDPSS--EFHHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHF--LDANGALKRN--EGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIA 460          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P24460|CP2BB_CANLF (Cytochrome P450 2B11 OS=Canis lupus familiaris OX=9615 GN=CYP2B11 PE=2 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 2.922e-70
Identity = 158/452 (34.96%), Postives = 235/452 (51.99%), Query Frame = 2
Query: 1013 PMESGLPIIGAIHKIE-PPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDN-SSLICQLIYLLTSEWKSFI-----------RIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
            P    LPI+G   +++   +    L+L  K G +F + LG R+ V+L   + I++AL+D+A  FSGR    V   V    G+++ +G+ W T R F L  +RDFG+GK    E +Q E    ++EL    G + D +      T NII   +  KRF   DP                + ++L+ L +  F   SS   Q+  L  S  K F             I+ F A  +++HR  LD  S   D +D +LI+  + K    +   F    LI T++ LF AG ETTSTTL +  L M KYP I E+++KEI ++IG  RLP+++D+  + YT AV+ E+ R   + P+ + H    D    G+ IPK + +FP L++   DP  +E P  F P+HF  LD+NG  K    E  IPFS+GKR CLGE +AR E F+FF +++Q F ++
Sbjct:   32 PGPRPLPILGNFLQMDRKGLLKSFLRLQEKYGDVFTVYLGPRRTVMLCGIDAIREALVDNAEAFSGRGKIAVVEPVFQGYGVVFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKTEGVLQDPTFFFHSMTANIICSIVFGKRFGYKDP----------------EFLRLMNLFYVSFALISSFSSQMFELFHSFLKYFPGTHRQVYNNLQEIKAFIARMVEKHRETLD-PSAPRDFIDAYLIRMDKEKAEPSS--EFHHRNLIDTALSLFFAGTETTSTTLRYGFLLMLKYPHIAERIYKEIDQVIGPHRLPSLDDRAKMPYTDAVIHEIQRFGDLLPIGVPHMVTKDICFRGYIIPKGTEVFPILHSALNDPHYFEKPDVFNPDHF--LDANGALKKN--EAFIPFSIGKRICLGEGIARMELFLFFTTILQNFSVA 460          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|O54750|CP2J6_MOUSE (Cytochrome P450 2J6 OS=Mus musculus OX=10090 GN=Cyp2j6 PE=2 SV=2)

HSP 1 Score: 239.58 bits (610), Expect = 1.122e-68
Identity = 166/482 (34.44%), Postives = 256/482 (53.11%), Query Frame = 2
Query:  920 LCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLK-LGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTK-NKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFI---RIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISE 2350
            L   VTF+L+  YF      K   PK     P   GLP +G I +++    H  ++ L +K G IF + LG    VV+    +IK+AL     N   R    +   +++ +G+I+  G+IW  QR F L  LR+FGLGK    E +Q E  + ++ +    G+  +    I    +NII      +RF   D     M + + +       +I  +  +FP          + Y+  S  K F    +++ F +  I +HR   +   E  D +D FL +  +  + T    SF +  LI ++++LF AG ETTSTTL W  L+M+ YP++QEKV  EI  +IG++R   + D++++ YT AV+ EV R+ ++ PL++      D N+NGF++PK +++  NL A H DP+ W +P  F PEHFL    NG  +++ RE  +PFS+GKR CLGE LARSE FIFF S++Q+F  +F   I+E
Sbjct:   22 LVAAVTFLLLADYF------KNRRPKNYPPGPW--GLPFVGNIFQLDFGQPHLSIQPLVKKYGNIFSLNLGDITSVVITGLPLIKEALTQMEQNIMNRPLSVMQERISNKNGLIFSSGQIWKEQRRFALMTLRNFGLGKKSLEERMQEEASHLVEAIREEEGKPFNPHFSINNAVSNIICSVTFGERFDYHDSRFQEMLRLLDEVMYLETTMISQLYNIFPWI--------MKYIPGSHQKVFRNWEKLKLFVSCMIDDHRKDWN-PDEPRDFIDAFLKEMTKYPEKT---TSFNEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEVQEKVQAEIDRVIGQKRAARLADRESMPYTNAVIHEVQRMGNIIPLNVPREVAMDTNLNGFHLPKGTMVLTNLTALHRDPKEWATPDVFNPEHFL---ENG--QFKKRESFLPFSMGKRACLGEQLARSELFIFFTSLMQKF--TFNPPINE 476          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P12790|CP2B9_MOUSE (Cytochrome P450 2B9 OS=Mus musculus OX=10090 GN=Cyp2b9 PE=1 SV=2)

HSP 1 Score: 237.654 bits (605), Expect = 3.388e-68
Identity = 150/428 (35.05%), Postives = 227/428 (53.04%), Query Frame = 2
Query: 1082 LKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDN-SSLICQLIYLLTSEWKSFIRIQ-----------DFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
            ++L  K G +F + LG R +VVL   + I++AL+D A  FSGR +      V  D GI +  G+ W T R F L  +++FG+GK    E ++ E    ++EL    G  +D + L    T NII   +  +RF   D                   + L+ LM+  F   SS   Q+  L +   K F  +            D+ A  +++H+  LD  S   D +D +L++  + ++S  N E F    L+ + + LF AG ETTS TL++  L M KYP + EKV KEI ++IG  RLPT++D+  + YT AV+ E+ R S + P+ L H+   D    G+ +PK++ ++P L +   DP+ +E P  F PEHF  LD+NG  K    E  +PFS GKR CLGES+AR+E FIFF +++Q F ++
Sbjct:   56 IQLQEKHGDVFTVHLGPRPVVVLCGTQTIREALVDHAEAFSGRGTIAAAQLVMQDYGIFFASGQRWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQGVPLDPTFLFQCITANIICSIVFGERFDYTD----------------DQFLHLLNLMYKIFSLLSSFSGQMFELFSGFLKYFPGVHRQIVKKQQELLDYIAHSVEKHKATLD-PSAPRDYIDTYLLRM-EKEKSNHNTE-FHHQNLMMSVLSLFFAGTETTSATLHYGVLLMLKYPHVTEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLVPIGLPHKVIKDTLFRGYLLPKNTEVYPVLSSALHDPQYFEQPDKFNPEHF--LDANGALK--KCEAFLPFSTGKRICLGESIARNELFIFFTTILQNFSVA 460          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P12789|CP2B5_RABIT (Cytochrome P450 2B5 OS=Oryctolagus cuniculus OX=9986 GN=CYP2B5 PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 5.806e-68
Identity = 145/418 (34.69%), Postives = 219/418 (52.39%), Query Frame = 2
Query: 1079 LLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPN-VHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
             L+L  K G +F + LG R +VVL   + I++AL+D A  FSGR    V   +    G+ + +G+ W   R F L  +RDFG+GK    E +Q E    ++EL    G ++D + L    T+NII   +  KRF   DP  +  ++     F+        +  +FP F     +          +++   I  F  + +++HR  LD  S   D +D +L++  + K    +   F    LI T + LF AG ETTSTTL +  L M KYP + E+V KEI ++IG  R P ++D+  + YT AV+ E+ RL  + P    H    D    G+ IPK++ +FP L +   DP  +E+P TF P HF  LD++G  K    E  +PFS+GKR CLGE +AR+E F+FF +++Q F I+
Sbjct:   55 FLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVFFANGEHWRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSVTSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFPGF-----LKHFPGTHRQIYRNLQEINTFIGQTVEKHRATLD-PSNPRDFIDVYLLRMEKDKSDPSS--EFHHRNLILTVLTLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLVPFGAPHMVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHF--LDADGALKRN--EGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIA 460          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A4P8NYX5 (P450 2B-like protein OS=Dugesia japonica OX=6161 GN=p4502B PE=2 SV=1)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 314/489 (64.21%), Postives = 401/489 (82.00%), Query Frame = 2
Query:  965 YWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDIKNFLFKRR 2431
            Y   ++  IPKGLKE P+E GLPI+G IHKI+ PMH+YLLKL +K GPIFRIKLGMR +++L+NY++IKKAL+DD  NFSGRW  K+ + +THDSGII+KDG+ W+TQRSF+LKVLRDFGLGKSKS+++VQNEC   L+EL++L G+I+DFS++IPIYT NIIS+FIMNKRF R++P +  +EK +++  K KDIIQL+ +MFP  D S L C+LI   TS+WK F+ IQ++F EEI EH   +DF SEGEDLMDRFLIKQ QLKQ   +V SF DWQLIR+S+ELF AGYETTSTTL W  LFMSK+ DIQ+KVH EI EIIGKERLPTMNDKK++NYTQAVMDE+ R+SSV+PL+LIHRT +DANI+G++IPK++LIFPNLYACH D +IWE P  FYPEHFL+ D NG  KY PR+ELI FS+GKRQCLGESLAR E+FIFF S++QRF++   +E++E +Y + ++G +G+IR S + +F+F ++
Sbjct:   18 YGFQKRNSIPKGLKETPIEYGLPILGIIHKIKEPMHNYLLKLSKKHGPIFRIKLGMRDVLILSNYDIIKKALVDDGQNFSGRWRMKLISLITHDSGIIFKDGQDWSTQRSFVLKVLRDFGLGKSKSVDLVQNECSFLLEELESLEGKIIDFSKIIPIYTANIISKFIMNKRFERENPKIARIEKMLSEEIKKKDIIQLLHIMFPKCDTSGLFCELIINFTSKWKEFLEIQNYFKEEIDEHLKTIDFNSEGEDLMDRFLIKQNQLKQQNIDVGSFNDWQLIRSSLELFYAGYETTSTTLCWSFLFMSKHQDIQQKVHNEIIEIIGKERLPTMNDKKSMNYTQAVMDEIFRMSSVAPLALIHRTLNDANIDGYFIPKNTLIFPNLYACHFDRDIWEKPMIFYPEHFLTEDDNGNLKYTPRDELILFSIGKRQCLGESLARMEFFIFFTSILQRFRVKLVKELNEKEYEEALLGKDGIIRGSIVNDFIFTKQ 506          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A2U8U473 (Cytochrome P450 2K1-like protein OS=Dugesia japonica OX=6161 GN=P450 PE=2 SV=1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 303/502 (60.36%), Postives = 391/502 (77.89%), Query Frame = 2
Query:  938 FIL-IFLYFLYWVC-----RKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDIKNFLFK 2425
            FIL IF  F+ W C     ++  IP GLKE P+E G PI+G I KI+ PM +YLL+L RK GPIFRI+LGMR +V+L NY+ I+KAL+DDA  FSGRW  K+ + VTHDSGI++KDG +W+TQRSFILKVLRDFG+GKS S +IVQ EC   L+ELD+L G+I+DFS++IPIYT NIIS+FIMNKRF R DP + F+E AI + +K  DI+Q + LMFP FD S++I +    +TS+ + F +++  F +EI+EH+  LD+ SEG+DL+DRFL++Q +L QSTG VESF D QLI  + E+F AGYETTSTTL W  LFMS+Y DIQ+KV++EI  +IG+ER+PTMNDKK+LNYTQAVMDE+LRLSSV+PL + HRTF+D +++ ++IPK+SL+F N YACH DP+IW  P  FYPEHFL    N   KY PREELIPF +GKRQC+GESLAR EYFIFFVS++QR+Q+ F+E IS+  + +T+ GNEG+IR S IKNF+FK
Sbjct:    3 FILSIFGLFIIWYCFSRVFKRRSIPNGLKETPIEYGWPILGIIPKIKGPMQNYLLELSRKHGPIFRIRLGMRDVVILGNYQTIRKALVDDAQIFSGRWKMKLVSVVTHDSGIVFKDGPVWSTQRSFILKVLRDFGMGKSISQDIVQGECLFLLNELDSLQGEIIDFSKIIPIYTANIISKFIMNKRFDRSDPRIKFIEYAIFQTSKQSDIVQRLHLMFPIFDKSTIISKFNLWITSKLQLFSKVERVFHDEIEEHKTNLDYNSEGDDLIDRFLLEQNRLSQSTGIVESFTDKQLIFMTFEMFGAGYETTSTTLGWSMLFMSRYKDIQKKVYEEILNVIGEERMPTMNDKKSLNYTQAVMDEILRLSSVAPLGIFHRTFNDTSVDNYFIPKNSLVFANYYACHTDPDIWLKPVEFYPEHFLIKCENDELKYSPREELIPFGIGKRQCIGESLARMEYFIFFVSILQRYQVDFSENISDSLFEETLRGNEGIIRYSKIKNFIFK 504          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A267DEG0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002316g1 PE=4 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 5.995e-81
Identity = 170/504 (33.73%), Postives = 281/504 (55.75%), Query Frame = 2
Query:  956 YFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPP-MHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSEL--IPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFD--------NSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNAL-DFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDIKNFLFKRR 2431
            Y LY+  +   +P G    P+  GLP+IG +   +P  +H  + K+  K G I    LG R ++VLN+Y M+K+ L  D  NF+GR   ++  ++T D GII+ +G +W+  R   L+ LRDFG  +++++E+V ++  +    LD  +  +     L    + + +II+   +  RF R+DP    + K I K  + + I+Q    +FP  +        +SS++  + YL      SFIR      +EI++    + D ++E E L D + I + +  +  G+ E+F ++QLIR  +E F+AG +TT+ ++ W  L+M+ YP++Q++V  E+  +IG+ R P M D+  L+YT AV+DE  R +S++ + + HR   + + +G+ IP D+ I PN+Y  H   E WE P  FYPEHF  LD+ G  +Y+    LIPF +G+R C+GESLAR E  +FF +++QR+++  A E S  K    + G  G +R       +F RR
Sbjct:   41 YVLYYWRQGRDLPPG----PV--GLPLIGRLPWTDPKNLHLTMQKVAEKYGDITSFYLGSRLLIVLNSYPMMKEML--DDYNFAGRPRLRLFLKLTRDCGIIFTEGDMWSQHRRLSLRTLRDFGFARAQTVEMVDDQLDSIFQTLDEAATSVTPMEVLGTFILASNSIITEMTLGHRFERNDPEFQKVNKLIKKLLE-EGIVQTASALFPAVERFIVLFPLSSSVVHDVEYL-----HSFIR------KEIQQREKVMVDESTEPECLCDVY-IHEKRKAEKAGDFETFKEFQLIRVILEFFLAGTDTTARSIEWLLLYMAFYPEVQDRVQNELDSVIGQSRRPRMQDRTELHYTSAVIDETYRKASLAAIGVFHRAVEETHFHGYRIPSDAFIIPNVYGVHHRVEYWERPNEFYPEHF--LDNEG--RYRSSPYLIPFLIGRRSCVGESLARMEIVLFFTAIMQRYRVRPAPE-SAAKKDDILSGWMGSLRIPGEYRLIFDRR 518          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A1I8HZ60 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 3.604e-80
Identity = 163/485 (33.61%), Postives = 268/485 (55.26%), Query Frame = 2
Query:  974 CRKPPIPKGLKEI------------PMESGLPIIGAIHKIEPP-MHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSEL--IPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFD--------NSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNAL-DFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDK 2356
            CR PP+   L               P   GLP+IG +   +P  +H  + K+  K G I    LG R  +VLN+Y M+K+ L  D  NF+GR   ++  ++T D GII+ +G +W+  R   L+ LRDFG  +++++E+V ++  +    LD  +  +     L    + + +II+   +  RF R+DP    + K I K  + + I+Q    +FP  +        +SS++  + YL      SFIR      +EI++    + D ++E E L D + I + +  +  G+ E+F ++QLIR  +E F+AG +TT+ ++ W  L+M+ YP++Q++V  E+  +IG+ R P M D+  L+YT AV+DE  R +S++ + + HR   + + +G+ IP D+ I PN+Y  H   E WE P  FYPEHF  LD+ G  +Y+    LIPF +G+R C+GESLAR E  +FF +++QR+++  A E +  K
Sbjct:    4 CRDPPLSAALGAYVLYYWRQGRDLPPGPVGLPLIGRLPWTDPKNLHLTMQKVAEKYGDITSFYLGSRLFIVLNSYPMMKEML--DDYNFAGRPRLRLFLKLTRDCGIIFTEGYMWSQHRRLSLRTLRDFGFARAQTVEMVDDQLDSIFQTLDEAATSVTPMEVLGTFILASNSIITEMTLGHRFERNDPEFQKVNKLIKKLLE-EGIVQTASALFPAVERFIVLFPLSSSVVHDVEYL-----HSFIR------KEIQQREKVMVDESTEPECLCDVY-IHEKRKAEKAGDFETFKEFQLIRVILEFFLAGTDTTARSIEWLLLYMAFYPEVQDRVQNELDSVIGQSRRPRMQDRTELHYTSAVIDETYRKASLAAIGVFHRAVEETHFHGYRIPSDAFIIPNVYGVHHRVEYWERPNEFYPEHF--LDNEG--RYRSSPYLIPFLIGRRSCVGESLARMEIVLFFTAIMQRYRVRPAPESAAKK 469          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A267FBR2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026066g1 PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 1.044e-79
Identity = 171/504 (33.93%), Postives = 277/504 (54.96%), Query Frame = 2
Query:  956 YFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPP-MHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSEL--IPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFD--------NSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNAL-DFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDIKNFLFKRR 2431
            Y LY+  +   +P G    P+  GLP+IG +   +P  +H  + K+  K G I    LG R  +VLN+Y M+K+ L  D  NF+GR   ++  ++T D GII+ +G +W+  R   L+ LRDFG  +++++E+V ++  +    LD  +  +     L    + + +II+   +  RF R+DP    + K I K  + + I+Q    +FP  +        +SS++  + YL      SFIR      +EI++    + D ++E E L D + I + +  +  GN E+F ++QLIR  +E F+AG +TT+ ++ W  L+M+ YP +Q +V  E+  +IG+ R P M D+  L+YT AV+DE  R +S++ + + HR   + + +G+ IP D+ I PN+Y  H   E WE P  FYPEHF  LD  G  +Y+    LIPF +G+R C+GESLAR E  +FF +++QR+++  A E S  K    + G  G +R       +F RR
Sbjct:   79 YVLYYWRQGRDLPPG----PV--GLPLIGRLPWTDPKNLHLTMQKVAEKYGDITSFYLGSRLFIVLNSYPMMKEML--DDYNFAGRPRLRLFLKLTRDCGIIFTEGYMWSQHRRLSLRTLRDFGFARAETVEMVDDQLDSIFQTLDEAATSVTPMEVLGTFILASNSIITEMTLGHRFERNDPEFQKVNKLIKKLLE-EGIVQTASALFPAVERFIVLFPLSSSVVHDVEYL-----HSFIR------KEIQQREKVMVDESTEPECLCDVY-IHEKRKAEKAGNFETFKEFQLIRVILEFFLAGTDTTARSIEWLLLYMAFYPVVQNRVQNELDSVIGQSRRPRMQDRTELHYTSAVIDETYRKASLAAIGVFHRAVEETHFHGYRIPSDAFIIPNVYGVHHRAEYWERPNEFYPEHF--LDDEG--RYRSSPYLIPFLIGRRSCVGESLARMEIVLFFTAIMQRYRVRPAPE-SAAKKDDILSGWMGSLRIPGEYRLIFDRR 556          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: cyp2n13 (cytochrome P450 2J6-like [Source:NCBI gene;Acc:103035066])

HSP 1 Score: 254.218 bits (648), Expect = 3.906e-75
Identity = 162/454 (35.68%), Postives = 256/454 (56.39%), Query Frame = 2
Query: 1025 GLPIIGAIHKIEPPMHH-YLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGR-WSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFL-DELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIG 2377
             LP +G I  I  P  H YL KLG+    IF +++G +K+++L  Y+M+K+AL++  +NF  R +SP  +   + + G+   +G +W  QR F L  LR+FGLGK K++E+   E  +FL DE+D   GQ  D S L     +NII + +  +R+   D +   M K  ++    +  I   L  +  F N  ++  L       + ++  I +F  + + +H+  LD  S   D MD FLI++   + S    + F D  L+R +++LF+AG ETT+T+L W  ++++K P+IQ+KV +EI  +IG+ R P M DK  + YT+AV+ E+LR   + PLS       D  + G+ IPK + I P L++   D + WE+P +F P+HF  LD  G  K+  R+  + FS GKR CLGE LAR E F+FF  + Q+F+  F+E   E+  ++ I+G
Sbjct:   43 ALPFLGNILDIASPQPHIYLTKLGKAYNNIFSMRIGQQKMILLTGYKMVKEALVNQTDNFVDRPYSPLAERIYSGNGGLFTSNGNLWKKQRRFALSTLRNFGLGK-KTMELAICEESHFLLDEMDRHKGQAFDPSGLFNNAVSNIICQLVFGQRYDYADYDFQQMLKYTSEAIHLEGSIWGRL--YESFPN--IMKHLPGRHNVIFSNYEHISEFIKKNLDKHKANLD-PSNPRDYMDSFLIEK---ENSHDPADGFSDKNLVRCTLDLFLAGTETTTTSLGWALIYLAKNPEIQDKVQEEIDRVIGQSRQPGMADKPNMPYTEAVIHEILRRGDIVPLSGPRVAAKDTTLGGYAIPKGTTIMPILHSVLFDEDEWETPNSFNPQHF--LDKEG--KFVRRDAFLAFSAGKRVCLGEQLARMELFLFFTCLFQKFR--FSEVEGEELDTEGILG 481          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000048412.1 (cytochrome P450 2K1-like [Source:NCBI gene;Acc:103034605])

HSP 1 Score: 236.113 bits (601), Expect = 1.998e-68
Identity = 162/482 (33.61%), Postives = 247/482 (51.24%), Query Frame = 2
Query:  992 PKGLKEIPMESGLPIIGAIHKIE-PPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILL-MFP-CFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQT-IIG------NEGLIRTSDI 2407
            PK  +E P    LPI+G + ++    +H  L  L +K GP+F+I LG +KI+VL  Y+ +K+AL++ A  F  R    V  ++    GI++ +G+ W   R F L  LRD G+GK    E +  E  +      +  G+  D ++ + +  +N+I   I   RF  +DP    M +   +  KN   + + L  +FP  F NS             W   +        E+K+    L  +   ED    F+   Y  K S  N   F +  L+ T   LFIAG +TTSTT+ W   +M+KYP IQE+V +EI  +IG +R P + D+K L YT AV+ E  RL+++ P+SL H T  D   NG++I K + + P L +   D   WE+P +F P HFL  D     ++  R+  +PFS G+R CLGESLAR E F+FF S++Q F+++    ++E +   T ++G      N+GL     I
Sbjct:   37 PKEGQEPPGPRPLPILGNLLQLNLKTLHLSLCDLSKKYGPVFKIHLGPKKIIVLAGYKTVKQALVNCAEEFGERDILPVFHDIMKKLGILWANGENWKVMRRFTLTALRDLGMGKRGVEEKIIEEIQHLKAVFKSFDGKPFDATQTVNVAISNVICAIIYGSRFDYEDPLFKAMVQRSNENMKNAGSVPIQLYNVFPKLFKNS-----------KTWMKVMENHRINRCEMKQLMMGLKDSLNVEDCRG-FIDYFYICKASGENSVHFHEENLLATVSNLFIAGTDTTSTTIRWGLQYMAKYPQIQERVQQEIDRVIG-DRQPKVQDRKNLPYTDAVIHETQRLANIVPMSLPHVTSCDVTFNGYFIKKGTSVMPLLSSVLWDESEWETPKSFNPAHFLDAD----GRFVNRDAFMPFSAGRRVCLGESLARMELFLFFTSLLQHFRLTPPPGLTEGQLDLTPVVGFTLNPANQGLCAVPRI 501          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000019508.2 (cytochrome P450 2K1-like [Source:NCBI gene;Acc:111191063])

HSP 1 Score: 236.113 bits (601), Expect = 2.189e-68
Identity = 162/482 (33.61%), Postives = 250/482 (51.87%), Query Frame = 2
Query:  992 PKGLKEIPMESGLPIIGAIHKIE-PPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILL-MFP-CFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQT-IIG------NEGLIRTSDI 2407
            PK  +E P    LPI+G + ++    +H  L  L +K GP+F+I  G +KIVVL  Y+M+K+AL++ A  F  R    V  ++++  GI++ +G+ W   R F L  LRD G+GK    E +  E  +      +  G+  + ++ + +  +N+I   I   RF  +DP    M +   +  KN   + + L  +FP  F NS +           W   ++       E+K+    L  +   ED    F+   Y  K S  N     +  L+ T   LFIAG +TTSTT+ W   +M+KYP IQE+V +EI  +IG +R P + D+K L YT AV+ E  RL+++ P+SL H T  D   NG++I K + + P L +   D   WE+P +F P HFL  D     ++  R+  +PFS G+R CLGESLAR E F+FF S++Q F+ +    ++ED+   T ++G      N+GL     I
Sbjct:   37 PKEGQEPPGPRPLPILGNLLQLNLKTLHLSLCDLSKKYGPVFKIHFGPKKIVVLAGYKMVKQALVNCAEEFGERDILPVFHDMSNKLGILWANGENWKVMRRFTLTALRDLGMGKRGVEEKIIEEIQHLKAVFKSFDGKPFETTQPVNVAISNVICAIIYGSRFDYEDPLFKAMVQRSNENMKNAGSVPIQLYNVFPKLFKNSKM-----------WVKVMKDYRINRCEMKQLVMGLKDSLNVEDCRG-FIDYFYICKASGENSVHLHEENLLATVSNLFIAGTDTTSTTIRWGLQYMAKYPQIQERVQQEIDRVIG-DRQPKVQDRKNLPYTDAVIHETQRLANIVPMSLPHVTSCDVTFNGYFIKKGTSVMPLLSSVLWDESEWETPKSFNPAHFLDAD----GRFVTRDAFMPFSAGRRVCLGESLARMELFLFFTSLLQHFRFTPPPGLTEDQLDLTPVVGFTLNPANQGLCAVPRI 501          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000019474.2 (cytochrome P450 2K1-like [Source:NCBI gene;Acc:103034280])

HSP 1 Score: 231.106 bits (588), Expect = 1.377e-66
Identity = 147/438 (33.56%), Postives = 238/438 (54.34%), Query Frame = 2
Query: 1070 HHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFM-EKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQT-IIG 2377
            H  L +L +  G +F++  G +K+VVL  Y+ +K+AL++ A  F  R    +  +   + GI++ +G+ W   R F L  LRDFG+GK  S E +  E     +  ++  G+  D ++ +    +NIIS  +   RF   DP    M  +A            L+  MFP       +  +  L  +  K+ ++I++     +K  +  L+ T E    +D FL+++ Q+ +S      F +  LI T   LF+AG +T+ TTL W  L M+K P IQ++VH+EI  +IG  ++  + D+K+L YT AV+ E+ R +++ P+SL H T  D + NGF+I K + ++P L +   D   WESP TF P+HF  LD  G  ++  ++  +PFS G+R CLGESLAR E F+FF S++Q F+ +    ++ED+   T +IG
Sbjct:   63 HESLCELAKTYGSVFKVYFGPKKVVVLAGYKTVKQALVNHAEEFGEREVSPMFKKYNEEHGILFSNGENWREMRRFALSNLRDFGMGKRGSEEKIIEEIQYLKEVFESFGGKAFDTTQPVNNAVSNIISSIVYGSRFEYSDPQFKEMVNRANENVRIGGSASVLVYNMFPW--TGRFLRSVQKLFVNNEKNRVQIREL----VKGLQETLN-TEERRGFVDSFLLRK-QIDESNEKASYFNEKNLIVTVGNLFVAGTDTSGTTLRWGLLLMAKNPHIQDRVHEEIDRVIGGRQV-VVEDRKSLPYTDAVIHEIQRCANIVPMSLPHVTSCDVHFNGFFIKKGTTVYPLLTSVLRDESEWESPRTFNPDHF--LDKQG--QFLKKDAFMPFSAGRRVCLGESLARMELFLFFTSLLQHFRFTPPPGLTEDQLDLTPVIG 487          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: cyp2v1 (cytochrome P450, family 2, subfamily V, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040912-139])

HSP 1 Score: 226.868 bits (577), Expect = 6.073e-65
Identity = 161/472 (34.11%), Postives = 250/472 (52.97%), Query Frame = 2
Query:  932 VTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIE-PPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDE-LDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILL-MFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFL--IKQYQLKQSTG-NVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
            ++FI+  L F     RKP   K     P  + LP+ G    ++   +H +L K+ RK G I+ ++LG    VV+N+Y ++K+AL+D A  F+ R    V  ++    GI + +G  W  QR F L  L+ FG+GK +++E    + F+FL + +  + G+  +    I    +NII   +  +RF   D     M   I++  + +  +   L   FP F     +  +       + +F +++ F  EEI++HR   D  S   D +D +L  I++ +  +  G N E      L  + ++LF+AG ETTSTTL W  +FM KYP+IQEKV  EI  +IG  R P+M D+  + YT AV+ EV R  ++ PL++   +  +  + G+ IPK + I PNL +   D   W+SP +F P++FL    N   ++   +  IPFS GKR CLGESLAR E FIFF S++Q F  S
Sbjct:   22 LSFIVFLLIFDQLKNRKP---KNFP--PGPTSLPLFGNFFNLDHKQLHIHLTKMSRKYGRIYSLQLGGTHFVVVNSYSLVKEALVDQAETFADRPPNAVFHKINKCQGIAFNNGYSWKQQRRFTLSTLKSFGIGK-RNLESSITQEFDFLHQAIINMKGESFNPHFFINNAVSNIICSLVFGRRFEYTDKKFLTMLSLISRAIQLEGSVWAQLYNAFPHF-----MGLMPGPHQEMFSNFKQVEVFLNEEIEKHRAEWD-PSSPRDYIDCYLSEIEKRRDDEEAGFNTEG-----LCYSVLDLFVAGTETTSTTLLWAFVFMMKYPEIQEKVQAEIDRVIGHSRQPSMADRPNMPYTDAVIHEVQRRGNIVPLNVPRMSTKETTLGGYSIPKGTQIIPNLTSVLFDETQWKSPHSFDPQNFL----NNQGEFIRPDAFIPFSAGKRLCLGESLARMELFIFFTSLLQAFTFS 472          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011205.1 (pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1 gene:ENSPMAG00000010178.1 transcript:ENSPMAT00000011205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.83 bits (512), Expect = 1.331e-56
Identity = 145/478 (30.33%), Postives = 235/478 (49.16%), Query Frame = 2
Query:  926 YCVTFILIFLYFLYWVCRKPPI--PKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKD-GKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVH-FMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEIS 2347
            +C+ F+++          K P+  P G K IP       +G +   + P    L ++ ++ G +  + +G   +V ++ Y+ +K+ L+   + F+ R +   + +V    GII+   GK W   R F L  LR+FGLGKS   + +Q E   FL E     G   D    +     NII   +  KR+   D     F+            ++  +  +FP   +     Q+I+   ++ K FIR       +I   R+A     +   L+D +L    QL++      SF +  LI  +++LFIAG ETTSTTL W  L+M  +P+IQ + H+EI +I+G +RLP M D+ +L Y  AV+ E+ R S++ P    H T  D     + IPK ++I  N+ +   D   W++P  F PE+FL  D     K+   +  +PFS G R CLGE+LA+ E F+FF S++Q F+  + + +S
Sbjct:   30 FCIIFLVLRAILQEVKATKRPLDFPPGPKVIPF------LGNVSLFKKP-DVALDEVTKQYGEVCSVMVGKISMVFVSGYQAVKEVLVHQGHEFADRPNTPFNKKVNGGLGIIFAPYGKYWMQHRRFTLSTLRNFGLGKSSIEQTIQAEV-GFLIEAFKQKGSAFDPHYDLNSAVGNIICSMVKGKRYEYSDKQFQDFLHLVENNLQLQSGLLGTLCNIFPFLMDFPGPQQIIFKSMAKSKQFIR-------DIISERHATRDPIKPMCLIDAYL---SQLEKEDNPNSSFSEQSLIMLALDLFIAGAETTSTTLRWGLLYMMMHPEIQAQCHEEIDKIVGSDRLPCMEDRHSLPYLDAVIHEIQRFSNIVPFGAPHATTADVKFRQYLIPKGTIIMVNMKSVLSDENHWKTPYEFSPENFLDED----GKFVKPDAFLPFSAGPRVCLGENLAKMELFLFFASLLQHFEFYWPDLVS 485          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001876.1 (pep scaffold:Pmarinus_7.0:GL477372:10316:22460:-1 gene:ENSPMAG00000001674.1 transcript:ENSPMAT00000001876.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 1.685e-54
Identity = 138/468 (29.49%), Postives = 226/468 (48.29%), Query Frame = 2
Query:  944 LIFLYFLYWVCRK-----PPIPKGLKEIPMESGLPIIGAIHKIE-PPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWS-PKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPN-VHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFS-VGKRQCLGESLARSEYFIFFVSMVQRF 2320
            ++FL+  +W  R+     PP P+GL         P++G + +++   +   L KL    GPI+ + LG  ++VVL   E+IK+AL+  A  F  R   P     + +  G++   G  W  +R F L +LR+FG+G     E +  E    +  ++    +  D    I     N+I       R+  ++   V  M+        + +    I   FP         Q I       K+ + +  F    I+EH  A     E  D +D F+ K+  ++ S     +F D  LI T+  LF+AG ETTS TL W  L M  YP +QE+V +EI  ++G  R P   D+  + YT A + E+ R +++ P++  H T  D  + G+++PK + +   +++   +  +WE+P  F P HFL +D N    +  R + + FS VG R CLG++LAR E F+FF +++QRF
Sbjct:   23 VLFLWLGFWWLRREQRGFPPGPRGL---------PLVGNLFQLDLKALPASLDKLSETYGPIYSVSLGQTRVVVLVGNEIIKEALVTQAEMFIDRPEIPVFKKSLGNYEGLLLSHGWQWRARRRFTLMMLRNFGMGTKSIEEKIAEEAEFLVRAIENKQEKPFDAHSEINKSAANVICSITFGDRYDWNNKTFVKLMDIITENVELSGNDWSQIFNSFPVLKYFPGPHQRIN------KNKVVLNAFIQARIEEHDMA-RIQGEPRDYLDAFIDKR--IEDSMNPDTAFSDIALINTTANLFVAGSETTSATLKWGILLMLTYPKVQEQVQEEIDRVVGSNRRPACADRACMPYTNATVHEIQRYANILPMAFPHATTCDTKLRGYFLPKGTQVIALIHSALREKSLWEAPEQFNPGHFLDIDGN----FYNRNDFMAFSAVGPRICLGKNLARMEVFLFFTALLQRF 468          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011254.1 (pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 gene:ENSPMAG00000010227.1 transcript:ENSPMAT00000011254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.2 bits (487), Expect = 2.168e-53
Identity = 135/446 (30.27%), Postives = 215/446 (48.21%), Query Frame = 2
Query: 1070 HHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKD-GKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTT--NIISRFIMNKRFTRDDPNVHFMEKAITKFTK-NKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRI----QDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEIS----EDKYSQTI 2371
            H  + +L +K G +  I LG   +V+++ YE +K+ L++  + F+ R    +  ++T + GI     G  W  QR F L  LR+FG GK+   + +  E   +L  ++T   +   F   + +     NII   +   R+  D+     +   +    +   + + ++  +FP           +  L   W+    I    Q    + + EHR   D      DL+D +L +  + K +  +  SF    LI+  +ELFI G ETTS TL W  LFM   PDIQ + H EI  ++G ER P M D+++L Y  AV+ E+ R  +V PL ++H T  D   N +  PK + +  NL +   D   W++P  F P+HFL  D   I      +  +PFS G R CLGESLA+ E F+FF S++Q F+  +   +S      K+S T+
Sbjct:   60 HIAMQELAKKYGEVCTIMLGSTPVVLVSGYEAVKEVLVNRGHEFADRPITPIFTKLTQNIGIALAPYGDPWKQQRRFALSTLRNFGFGKATIADKISIEA-KYL--IETFKQETSAFDPHLNLNNALGNIICCLLNRNRYDYDNEQFQKLTHLLEYLVQLQAEPLVILCNVFP----------FLLKLPGPWQKVFHIHSKLQCLLNDIVSEHRATKD-QHNPRDLIDSYLAQIDKEKDNPNS--SFTHQSLIQILIELFIGGLETTSNTLRWGLLFMMMNPDIQARCHGEIDRVVGSERPPCMTDRRSLPYLDAVIHEIQRFGNVLPLGVLHATSKDVQFNDYLFPKGTHVMVNLMSALHDDIHWKTPNKFNPDHFLDKDGQCIQS----DAFLPFSAGPRVCLGESLAKMEIFLFFTSLLQHFEFYWPNSVSPPTLAAKFSTTL 485          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: cyp1d1 (cytochrome P450, family 1, subfamily D, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-041114-179])

HSP 1 Score: 181.8 bits (460), Expect = 2.181e-49
Identity = 127/458 (27.73%), Postives = 224/458 (48.91%), Query Frame = 2
Query:  998 GLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYK---DGKIWATQRSFILKVLRDFGLGKSKSI-------EIVQNECFNFLDELDTLSGQIVDFSEL--IPIYTTNIISRFIMNKRFTRDDPN----VHFMEKAITKFTKNKDIIQLILLMFPCF---DNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQ 2314
            G + +P     PI+G I ++ P  H  L ++  + G +FR+ LG   +VVL+  E IK+AL+ + + F+GR      + V +   + +    DG  W   +      LR+F    ++         E V  E    L        Q   F  +  I     N++   +  KR+   DP     V F E+A ++ +   +++      FP      N+ L  + + +L++      R+  F    IKEH ++        D+ D  +    + + +   V    D +++ T++++F AG++T  T L WC L++  +PD+Q K+ +EI E IG++R P   D+  L   +A + E+ R S+  P ++ H T  D  +NG +IP+D+ +F NL+  + DP +W  P  F P+ FLS D   ++K +  E++  F +GKR+CLG+ +AR E F+  V+++Q
Sbjct:   54 GARPLPGPVRWPIVGNILQLWPDPHLKLTRMCDRYGDVFRVHLGSVPVVVLSGLETIKRALVKNGDAFAGRPPFYSLSLVGNGDTLTFTRAYDG-CWKAHKRLARSALRNFCAAPARREGYACLLEECVCEEAERLLLACKGGGAQPGGFDPVPSITCAVANVMCALVFGKRYPHGDPTFLQIVGFNEEA-SQLSGAGNLVDF----FPFLRHVPNAQL--RALKVLSA------RLLAFMEGHIKEHYSSYQ-KGHVRDITDALIAMCAEQEHALREV-GLSDERVVATALDIFGAGFDTIITGLTWCLLYLCIHPDVQHKLQREIDETIGRDRTPRFEDRANLRRVEAFLTEMFRHSAFVPFTIPHSTTQDVVLNGMFIPRDTCVFVNLHQVNHDPTVWSDPERFDPDRFLSHDGKEVNK-EMVEKVQIFGLGKRRCLGDMVARQELFVVLVTLLQ 494          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011204.1 (pep scaffold:Pmarinus_7.0:GL477378:78074:79555:1 gene:ENSPMAG00000010177.1 transcript:ENSPMAT00000011204.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.785 bits (434), Expect = 2.795e-46
Identity = 128/452 (28.32%), Postives = 211/452 (46.68%), Query Frame = 2
Query: 1013 PMESGLPIIGAIHKIEPPMHHYLLK-LGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKD-GKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTK-NKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRI----QDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEIS 2347
            P    LP++G I        H  ++ L +K G +  I LG   +V+++ Y+ +K+ L++  + F+ R    +  ++TH+ GI     G  W  QR F L  LR+FG GK+   + +  E    ++     + +  D   ++     NII   +   R+  ++     +   +    +   + + ++  +FP           +  L   W+    I    Q    + + EHR   D      DL+D +L   +  K+      SF D  LI   +ELFI G ETTS TL W  LFM   PDIQ + H+EI +++G +R P M D+++L Y  AV+ E+ R  ++ P  ++H T  D   N +  PK + +  NL +   D   W++P  F P++FL  D   I      +  +PF  G   C GESLA+ E F+FF S++Q F+  +    S
Sbjct:   36 PGPKPLPLLGNITAFSCKNPHIGMQELAKKYGEVCTIMLGSTPVVLVSGYQAVKEVLVNRGHEFADRPITPLFTKLTHNIGIALAPYGDTWKQQRGFALSTLRNFGFGKATITDKISIEARYLIETFKQETSEF-DPKFILNSAVGNIICSLLNGIRYDYNNEQFQKLTHLLEHLVQLQAEPLVILCNVFP----------FLIKLPGPWQKVFHIHTKLQCLLKDIVSEHRATKD-QHNPRDLIDSYL--AHIDKEKDNPNRSFTDQTLILLLIELFIGGMETTSNTLCWGLLFMMMNPDIQARCHEEIDKVVGSQRPPCMKDRRSLPYLDAVIHEIQRFGNILPFGVLHPTSKDVQFNEYVFPKGTHVMVNLMSAFYDDIHWKTPHKFNPDNFLDKDGQCIKS----DAFLPFPAGPCVCFGESLAKMELFLFFTSLLQHFEFYWPNSAS 469          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Match: DIT2 (N-formyltyrosine oxidase; sporulation-specific microsomal enzyme involved in the production of N,N-bisformyl dityrosine required for spore wall maturation, homologous to cytochrome P-450s; SWAT-GFP and mCherry fusion proteins localize to the endoplasmic reticulum and vacuole respectively [Source:SGD;Acc:S000002810])

HSP 1 Score: 50.0618 bits (118), Expect = 1.045e-6
Identity = 65/240 (27.08%), Postives = 101/240 (42.08%), Query Frame = 2
Query: 1697 DFTSEGEDLMDRF---LIKQYQLKQST--------GNVESFVDW-QLIRTSVELFIAGYETTSTTLNWCCLFMSKYPD-IQEKVHKEISEII---GKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANING-FYIPKDSLIFPNLYACHMDPEIWESPTT-FYPEHFLSLDSNGISK----YQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISE 2350
            D  S  E L+ R    L+  Y+ +Q+T         +    +D+ QL    V + +AG+E      N     ++KY +  QEK+ KE++ I    G   LP +N         A + EV+R+       +   T     +     IPK   +  N +    DP+ W +    F PE + S D   I K     + R  +  F  G+R CLGE LA +E  I    M+++F+ S   E  E
Sbjct:  237 DVVSFRELLVKRVQDELVNNYKFEQTTFAASDLIRAHNNEIIDYKQLTDNIVIILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDPKGLADLPLLN---------AFLFEVVRMYPPLSTIINRCTTKTCKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTADDFKPERWGS-DIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQFRWSLDPEWEE 466          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Match: ERG5 (C-22 sterol desaturase; a cytochrome P450 enzyme that catalyzes the formation of the C-22(23) double bond in the sterol side chain in ergosterol biosynthesis; may be a target of azole antifungal drugs [Source:SGD;Acc:S000004617])

HSP 1 Score: 46.9802 bits (110), Expect = 9.482e-6
Identity = 37/170 (21.76%), Postives = 76/170 (44.71%), Query Frame = 2
Query: 1829 AGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDK--KALNYTQAVMDEXXXXXXXXXXX--XIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQI 2326
            A  + +S+   W    ++  PD+  K+ +E   +   +    +N    + + YT  V+ E LR      +   ++ + F  +    +  PK +++ P LY    DPE++E+P  F PE ++     G    + ++  + F  G   CLG++       I F +++ +F +
Sbjct:  336 ASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSP--NYTAPKGAMLIPTLYPALHDPEVYENPDEFIPERWV----EGSKASEAKKNWLVFGCGPHVCLGQTYV----MITFAALLGKFAL 495          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO48207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK94])

HSP 1 Score: 187.963 bits (476), Expect = 1.473e-51
Identity = 127/438 (29.00%), Postives = 225/438 (51.37%), Query Frame = 2
Query: 1037 IGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGR--WSPKVDAEVTHDSGIIYKD-GKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQ----DFFAEEIKEHRNALDFTSEGEDLMDRFL-IKQYQLKQSTGNVESFVDWQLIRTSVE-LFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQ 2323
            IG ++ +   MH    +L +  G ++R+ LG +  +VL+  + IK+AL+    NF+GR   +P++ + +    G+   D G+ W   R      ++ +G  +++  +++++E     + L++ +G+  D ++   I  TN+I   +   R+  DDP    + +   K ++      L+  +FP   +       I   + + +  I+I     +    + +EH    D      D  D  L  KQ   ++   + E   +  +I   +  LFIAG ETTSTTL W  +++   PD+QE++HKEI ++IG++  P ++ +K L   +A   E LRL++++PL++ H+    + + GF IP+ + +F NL++ H DP +W+ P TF  + F  LD  G  K       +PF  G R CLGE LARSE F+F   M+QRF+
Sbjct:   37 IGNLNLLSKQMHLSFTELEKTYGKVYRLYLGHKLAIVLSG-DAIKEALVRQPRNFAGRPVLNPQLKSALNRGPGLTVMDYGETWKLFRKLGHSTIKVYG--ENRLQDVIKDEVLELCNRLESSAGKPFDITQQSGIAVTNVICTKLFGTRYQIDDPEFLRVYEIHDKLSRIGFGGNLVTNIFPSLAS-------ILPFSEKQRDLIQIGQERYEILERKYQEHVKTFD-PENIRDYTDALLKAKQDAEQEDKSSKEHLQESTIIMAGLATLFIAGSETTSTTLGWAVIYLLHNPDVQERLHKEIDDVIGRDAFPQLSKRKELPVLEAFTAETLRLANLAPLAIPHKARERSTLQGFEIPEGTTVFANLWSLHHDPTVWKDPFTFNLDRF--LDEEGKFKAPVGGTFLPFGAGPRVCLGEVLARSELFLFLSRMLQRFE 461          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO48191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK60])

HSP 1 Score: 181.8 bits (460), Expect = 7.948e-50
Identity = 123/434 (28.34%), Postives = 217/434 (50.00%), Query Frame = 2
Query: 1052 KIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHD-SGIIYKD-GKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEE----IKEHRNALDFTSEG--EDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQIS 2329
            ++ P  H  L +L +  G +FR+K+G  +IVV+N+ E  ++AL+  AN+F+GR      + ++ + + I + D G +W  QR      LR FG G     E +  E    +  L  + G+  +  + + +   NII  F+   R+  DDP  H +     +F +              F  +SL+    +L     K   +I++          K+++  L     G   DL D  L      ++ +  +    D  +I T  ++F AG ETT+T++ W  +++ + P +QE++H++I E++G++R P ++D++ L   +A + EVLR SS+ PL   H T  D ++ G+ +PKD+++  N++  H DP+ W +P  F P  F  LD  G          +PFS G+R CL ESL + + F+F   ++ +F+ S
Sbjct:    3 QMGPTPHLGLTELAKSYGEVFRLKVGSHRIVVVNSIEAAREALVRRANDFAGRPMLYTASLISRNGTDIAFGDFGPLWKQQRKIAHSALRMFGSGLKPLEEKITVEADELIKRLSLVEGRAHNPKDDVNLAVLNIICSFVFGSRYDMDDPEFHTVVDYTEQFVQG-------------FRAASLVDYFPWLRHLPNKGLRQIKEACQNRDVVLQKKYQEHLVTYEHGVIRDLTDALLSANKASQEESAYLPMTED-HIIMTMNDIFSAGLETTATSILWSLVYLIRNPKVQEQLHQQIDEVVGRDRAPELSDRENLPLIEATIAEVLRSSSLVPLLFPHSTTTDTHLRGYEVPKDTIVLFNVWNMHHDPQRWSNPDEFDPTRF--LDDKGKFICPATLSYLPFSAGRRVCLAESLGKMQLFLFISRLLHKFRFS 420          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO29403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3R2])

HSP 1 Score: 169.088 bits (427), Expect = 6.536e-45
Identity = 137/482 (28.42%), Postives = 231/482 (47.93%), Query Frame = 2
Query:  914 MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKI--EPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWS--PKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDP---NVHFMEKAITKFTKNK----DIIQLILLMFPCFDNSSLICQLIY-LLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSV-ELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRF 2320
            +ELC     I + L ++++  RK  +P G       +  PIIG +  +  +  ++     L  K G +FR+ LG + +VVLN  + I  +L    + F+GR +  P +D  +  D G++   G +W   +      +R  G  +    E ++ E       LD+L GQ VD S+   I TTN+I   +   R+   DP    ++ +   I++   +     D+   ++ + P       + +L+    T  W+ +   +  F   +       D+T    DL+          K S  N     +  +I T +   F+AG ETT++TL+W  +++    D+QE++H E+ ++IGK +LP ++ KK L   +A   E LRLS + PL + H+T  D  + G  IPK + + PNL++ H D   W+ P  F    FL    +G+ +    +  +PFS G R CLGE LARSE F+F   ++Q+F
Sbjct:    2 IELCVPALLISLALIYIFY-SRKERLPPG------PAPWPIIGNLDLLIRKEALYKTFTNLSHKYGGVFRLYLGSKPVVVLNG-KAIYDSLARQPSVFAGRPTLPPSLDFGMDPDYGVL-DYGPLWKFYKKLGHSAVRVHGTDRLN--EAIRVEVDEVCRRLDSLDGQPVDISKEFGIATTNVICARLFGSRYDVHDPEFLRIYEIHNKISRVVMSSRSLSDVFPFLVNILPESKERRELRELLQERYTIIWRKYKEHEQTFTPGVIR-----DYT----DLL-------IDAKLSEKNSHKLTENGIISTGLASQFLAGSETTASTLSWSVVYLLNDSDVQERIHNELDDVIGKGQLPQLSHKKKLPVLEAFTAETLRLSCIGPLGMPHKTTRDTFLRGHAIPKGTTVVPNLWSLHHDSTEWKDPFKFDINRFL---EDGVFRAPANDAYLPFSAGPRVCLGEELARSELFLFLARLLQKF 453          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO46605 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPN7])

HSP 1 Score: 167.933 bits (424), Expect = 8.509e-45
Identity = 131/448 (29.24%), Postives = 219/448 (48.88%), Query Frame = 2
Query: 1031 PIIGAIHKIEPPMHHYLLKLGRKLG-PIFRIKLGMRKIVVLNNYEMIKKALID-DANNFSGRWSPKV-DAEVTHDSGIIY-KDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDP---NVHFMEKAITKFT--KNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQD-FFAEEIKEHRNALDFTSEGE--DLMDRFLIKQYQLKQSTGNVESFV--DWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISF 2332
            P +G   +I P +H  L  LG++ G  +F+++L  ++ V+++N ++ ++ L+  +  + + R S  V DA   +   +I+ K    W  QR  +   LR +G G      ++  E  N  D      G  VD    + +   N+I   +  KR+  DD    ++    +++ K    +N  I    L  FP              +  + K  +  +D     +I EHR       EGE  DL D  L      KQ   N  S +  D  LI  + ++F+AG+ETT+T L W  L+++ YP++Q ++H+E+ ++I   R P + D+K+L Y +A + EVLR+S V PL    +     NI G+ IP+++ ++ NL+A H D   W  P  F P  FL   +N  S Y     ++PF  G R C+GESLA+ E F+F   ++ RF+++ 
Sbjct:   36 PFVGNFPQIGPVLHKSLTSLGKQYGRGVFQVQLLGKRFVIIDNIKLARQVLLKKNGRDVADRTSAYVIDAISRNGCSVIFGKYSPTWKLQRRVVHSALRMYGSGVRILEALILQEVDNLCDIFANSQGAPVDTKLPLTLSVMNVICALVFGKRYGLDDAEFTDIVATTESMAKLASPENPLIYMPWLRFFPL------------QVVKKMKETVTARDRLIQRKITEHRETY---KEGEIRDLTDALLKSLEDAKQEDNNAMSLLTEDHLLIAIN-DVFMAGFETTTTALRWIFLYVAAYPEVQARIHQELDDVISFGRDPLIADRKSLPYLEATILEVLRISPVFPLIR-RKARKQLNIGGYCIPEETFVYVNLWAIHHDEAEWVDPYKFRPSRFLE-GTNSASAY----SMLPFGAGVRVCVGESLAKMELFLFVSRLLHRFKLNL 461          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO40300 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7U4])

HSP 1 Score: 166.007 bits (419), Expect = 4.163e-44
Identity = 129/446 (28.92%), Postives = 213/446 (47.76%), Query Frame = 2
Query: 1013 PMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTH---DSGIIYKD-GKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDP---NVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFL-IKQYQLKQSTGNVESFVDWQLIRTS-VELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQ 2323
            P    LP+IG ++ +   MH     L +  G IFR+ L  + I+VL+  + IK+AL+    NF+GR    +  E+        +   D G+ W   R      ++ +G  + +  E++  E       L+    + +D ++      TN+I   I   R+  +DP    ++++    T+    +  ++        F   S   + I  L  E    +R +        EH    D  +   D  D  L  KQ   ++   + E F +  +I    V LF+AG ETT+TTL+W   ++   P +Q ++HKEI ++IGK+  P ++ +K +   +A   E  RLS++ PLSL H+T  D  + G+ I K + +F NL++ H DP IW+ P TF  + F  LD+ G  +       +PF  G R CLGE LARSE F+F  +++Q F+
Sbjct:    2 PGPRPLPLIGNLNLLSNQMHLDFAALEKTYGKIFRVYLAHKPIIVLSG-DAIKEALVRQPRNFAGRPLLPITEEIVDKRWGPALFAMDYGERWRIFRKLGHSTIKVYG--EDRLQEVINEEVSELCKRLEESDEKPIDITKQFGTAVTNVICTKIFGNRYDINDPEFQRLYYINDKSTRLNIGEGWLKEAFPFLKPFLPYSQQVKEIKELDQERFVIMRAK------YDEHVETFD-PNHIRDYTDALLKAKQEAEEEDKSSKEHFGEGPIIMAGLVTLFLAGSETTTTTLSWAIAYLLHNPGVQARLHKEIDQVIGKDVSPKLSQRKNIPVLEAFTAETQRLSNLVPLSLPHKTTSDCTLLGYEIAKGTTVFTNLWSLHHDPSIWKEPDTFNLDRF--LDAKGKFQAPVGGTFLPFGAGPRVCLGEVLARSELFLFLATLLQHFE 435          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: cyp2n13 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101156965])

HSP 1 Score: 257.299 bits (656), Expect = 2.844e-76
Identity = 157/448 (35.04%), Postives = 242/448 (54.02%), Query Frame = 2
Query: 1013 PMESGLPIIGAIHKIEPPMHH-YLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEV--THDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILL-MFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEI 2344
            P   GLP +G    I+    H Y  K+    G +F ++LG +  V ++ Y+M+K+AL+  A NF  R   ++       + +G+ + +G+ W  QR F L  LR FGLGK+   + +  E  +   +++   G     + L     +NII + +M KRF  DD N   M K I++  + +  I  IL   FP      L+  L       ++++  +QDF A+EIK H+  LD  +   D +D F+I+  + + S      F D  L   S++LF+AG ETTSTTL W  +++ K+PD+Q KV +EI  +IG+ RLP+M D+  L YT AV+ E+ R+ ++ PL+ +     D  + G++IPK + + P L +   D   WE+P TF PEHFL  D     K+  +E  +PFS GKR CLGE LAR E F+F V ++Q+F  S  E +
Sbjct:   39 PGPLGLPFVGNFLTIDGKHPHIYFSKMAESYGNVFSVRLGSQATVFVSGYKMVKEALVTQAENFVDRPFSEIGGRFYEGNSNGLFFSNGEKWKKQRRFALSTLRTFGLGKNTMEQSICEEIRHLQQQIENEKGGPFSPAGLFNNAVSNIICQLVMGKRFDYDDNNFQVMMKYISEAVQLEGSIWGILYESFP-----GLMKHLPGSHNKIFRNYKIVQDFLAQEIKIHKQDLD-PNNPRDYIDSFIIEMEKHQNSD---LGFNDANLAFCSLDLFVAGTETTSTTLMWALIYLIKHPDVQVKVQQEIDRVIGQNRLPSMADRPNLPYTDAVVHEIQRIGNIVPLNGLRVAAKDTTLGGYFIPKGTALMPMLTSVLFDKTEWETPDTFNPEHFLDAD----GKFVKKEAFLPFSAGKRVCLGEGLARMELFLFLVGLLQKFSFSVPEGV 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000020799.2 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101155419])

HSP 1 Score: 249.21 bits (635), Expect = 5.229e-73
Identity = 158/429 (36.83%), Postives = 229/429 (53.38%), Query Frame = 2
Query: 1070 HHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLI----YLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEI 2344
            H    KL  + G ++ ++ G R  VVLN ++ +K+AL+   ++   R    +  E+    G+I+ +G  W  QR F L  LR FG GK     ++ NE  +  +EL    G+ +D   +I    +NII   +   RF   D      +K +  F +   I   I      +++ +LI + +      L   W+    +QDF  EE+KEH+ + D  S+  D +D +L +  + K   G+  +F +  LI   ++LF+AG ETTSTTL W  L+M+KYP+IQEKV  EI ++IGK R P M D+  L YT AV+ EV R+ ++ PLSL H T  D  + GF IPK  LI PNL +   D + WE+P  F P HFL+ D     K+  R   IPFS GKR CLGE+LAR E F+FF S +Q F  S    +
Sbjct:   86 HESFSKLAAEYGDLYSLRFGQRWTVVLNGHKALKEALVTKGDSVVDRPHLPLQDEIAKGLGVIFSNGANWTEQRRFALSTLRYFGFGKKSLEPVILNEFAHCAEELKRFKGEPLDPHLIINNTVSNIICHLVFGHRFNYGDKK---FKKLMLLFDRALQIEASIWAQL--YNSFTLIMRCLPGPHKTLQHIWR---EVQDFIGEELKEHKKSWD-PSDARDYIDFYLTEIQKTKGQEGS--TFDEENLIMCVLDLFVAGSETTSTTLRWAFLYMAKYPEIQEKVQAEIHKVIGKSRPPCMEDRAELPYTDAVIHEVQRIGNIVPLSLPHATNKDVQLGGFTIPKGVLIIPNLTSVLFDEKEWETPHAFNPGHFLNKD----GKFVKRGAFIPFSAGKRLCLGENLARMELFLFFTSFMQHFSFSMPAGV 499          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: cyp2n13 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101156566])

HSP 1 Score: 247.284 bits (630), Expect = 1.561e-72
Identity = 153/449 (34.08%), Postives = 239/449 (53.23%), Query Frame = 2
Query: 1070 HHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGR-WSPKVDAEVTHDS-GIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTK-NKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDI 2407
            H Y  KL    G +F ++ G    V ++ Y+M+K+AL+  A NF  R +SP         + GI   +G+ W  QR F L  LR FGLGK+   + +  E  +   E+++  GQ+   + L     +NI+ + +M KRF  +D + H M K +++  +    +  L+   FP      L+  L       +K F  ++DF  +EIK H+  LD  +   D +D FLI   ++++   +   F +  L   S++LF+AG ETTSTTL W  +++ K+PD+Q KV +EI  +IG+ RLP+M D+  L YT AV+ E+ R  ++ PL+ +     D  + G++IPK + + P L +   D   WE+P TF PEHFL  D     K+  +E  +PFS GKR CLGE LAR E F+F V ++Q+F  S  E +         +  EG+  T+ +
Sbjct:   59 HIYFTKLAETYGNVFSVRFGSETSVFVSGYKMVKEALVTQAENFVDRPYSPMATRFYQGPTNGIFMSNGEKWKKQRRFALSTLRTFGLGKNTMEQCICEEIRHLQAEIESEKGQLFTPTGLFNNAVSNIVCQLVMGKRFDYNDHDFHTMIKYLSEVLRLEGSVWGLLYEAFP-----GLMKHLPGPHNEMFKDFDILRDFLDQEIKMHKKDLD-RNNPRDYIDSFLI---EMEKHQNSDLGFNEANLAFCSLDLFLAGTETTSTTLMWALIYLIKHPDVQVKVQQEIDRVIGQNRLPSMADRPNLPYTDAVIHEIQRFGNIVPLNGLRVAAKDTTLGGYFIPKGTALMPMLTSVLFDKTEWETPDTFNPEHFLDAD----GKFVKKEAFLPFSAGKRVCLGEGLARMELFLFLVGLLQKFSFSVPEGVE--------LSTEGITGTTRV 486          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000018818.2 (cytochrome P450 2J2 [Source:NCBI gene;Acc:101157767])

HSP 1 Score: 242.662 bits (618), Expect = 7.067e-71
Identity = 153/443 (34.54%), Postives = 229/443 (51.69%), Query Frame = 2
Query: 1013 PMESGLPIIGAIHKIEPPMHHYLLK-LGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTK-NKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFA 2335
            P    LP IG +H+I P + H   K    K G +F + +   K VVLN  +++K+ALI   ++F  R    + +++  + GI+  +G  W  QR F L  LR+FGLGK    + +Q EC           G+  D   L+    +NII   +  +RF   D     + + +T+  K       L   +FP      L+ +    L   +    +I DF   +I+EH+  LD     +D +D FLI   +++++ G    F    L   +++LF AG ETT+TTL W  LFM  YPDIQE+VH EI  +IG  R P+M DK+ + YT AV+ E+ R+  + P+ +      D  ++ + IPK ++I P L+    D  +WE+P +F P+HFL+ D      ++ RE   PF  GKR CLGE LAR E F+FF S +QRF  S A
Sbjct:   42 PGPRSLPFIGDLHRIRPTILHLQFKEFAAKYGNVFSLNIFGGKTVVLNGTKLLKEALIQKGDDFVDRPQIPLFSDLIENKGIVMTNGIQWKHQRRFALHTLRNFGLGKKTMEKYIQEECHYITQAFAEHQGKPFDAQPLLNSAVSNIICCLVFGERFEYSDKEYQQILQDLTEVVKLQGSFSALAYNVFPW-----LMKRFPGPLQKLFTLVDKIMDFVKIKIEEHKENLDPACP-KDYIDSFLI---EMEKNQGEDFGFDIKNLCACTLDLFGAGSETTTTTLYWGLLFMIHYPDIQEEVHAEIDAVIGSSRQPSMADKENMPYTDAVIHEIQRMGDIVPIGVARMASRDTMLDNYTIPKGTMIMPALHTVLHDESVWETPHSFNPQHFLNQDGT----FKKREAFFPFGAGKRVCLGEQLARMELFLFFTSFLQRFSFSTA 471          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000019638.2 (cytochrome P450 2K1 [Source:NCBI gene;Acc:101157991])

HSP 1 Score: 241.891 bits (616), Expect = 1.543e-70
Identity = 157/466 (33.69%), Postives = 240/466 (51.50%), Query Frame = 2
Query: 1004 KEIPMESGLPIIGAIHKIEPPMHHYLLK-LGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEG------EDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGN 2380
            +E P    LPIIG + +I+    +  L+   +  GP+F +  G  K+VVL  Y+ +K AL++    F  R  P +  E+    G+++ +G IW   R F L  LRDFG+GK    + +  EC   L+      G   D ++ +    +NII   +   RF  DDP    M   + +  +N   IQL     P     +++  L   + S  +    + +  A   K++++      E          +D FL+K   L++S     +F D  L+ T + LF AG ETTSTTL W  L M+KYP IQ++V  E+  +IG +R+  ++D+K L +T AV+ E+ RL+S+ P +L H+T  D    G++I K + +FP L +   D   WE P TFYP HFL  D     K+  RE  IPFS G+R CLGESLAR E F+FF +++Q F  +    +S+++ S T  G 
Sbjct:   39 QEPPGPRPLPIIGNLMQIDLKRPYKTLEEFSKTYGPVFTVFFGGEKVVVLAGYKTVKNALVNHDEEFGERAIPPIIQELNKGLGVLWSNGDIWRDIRRFALTNLRDFGMGKKACEDKITEECQYLLEVFKKFKGNAFDTTKPLNYAVSNIICSMVYGSRFEYDDPKFTSM---VDRTNRN---IQLS--GSPTLQAYNMVPWLFKWVASRRE----VHECAAANRKQNQSIFSHLKETLNPQMCRGFVDAFLVKGQTLEKSGVTNSAFNDENLLMTVIHLFAAGTETTSTTLRWGLLLMAKYPKIQDQVQDELRRVIG-DRMVQVSDRKNLPFTDAVIHEIQRLASIVPTALPHKTSKDVTFQGYFIKKGTTVFPLLTSVLHDANEWEKPHTFYPAHFLDKD----GKFVKREAFIPFSAGRRICLGESLARMELFMFFTTLLQNFCFTPPPGVSKEELSLTPCGG 487          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078092.1 (SMESG000078092.1)

HSP 1 Score: 1000.73 bits (2586), Expect = 0.000e+0
Identity = 493/506 (97.43%), Postives = 499/506 (98.62%), Query Frame = 2
Query:  914 MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDIKNFLFKRR 2431
            MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDI QLILLMFPCFDNSSLICQLIYLLTSEWKSFIR QDFFA+EIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAG+ETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSV P++LIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWE P T YPEHFLSLDSNGISKYQPREELIPFSVGKRQC+GESLARSEYFIFFVSMVQRFQISF EEISED+YSQTIIGNEGLIRTSDIKNFLFKRR
Sbjct:    1 MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIFQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRTQDFFADEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGFETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSVVPMALIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWEFPKTLYPEHFLSLDSNGISKYQPREELIPFSVGKRQCIGESLARSEYFIFFVSMVQRFQISFGEEISEDRYSQTIIGNEGLIRTSDIKNFLFKRR 506          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078091.1 (SMESG000078091.1)

HSP 1 Score: 961.829 bits (2485), Expect = 0.000e+0
Identity = 473/506 (93.48%), Postives = 490/506 (96.84%), Query Frame = 2
Query:  914 MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDIKNFLFKRR 2431
            MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWS +   E+THDSGII+KDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPN+  +E+ I   TKNKDIIQLILLMFPCFDNSSLICQLIYLLTS+WKSF++IQ++F EEI+EHR  LD TSEGEDLMDRFLIKQ++LKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSV+P+ LIHRTF DANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEG+IRTSDIKNFLFKRR
Sbjct:    1 MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSQRFIKEITHDSGIIFKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNIQLIEETINNSTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSKWKSFVKIQNYFGEEIEEHRTNLDLTSEGEDLMDRFLIKQHELKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSVAPMGLIHRTFDDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGVIRTSDIKNFLFKRR 506          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078094.1 (SMESG000078094.1)

HSP 1 Score: 915.99 bits (2366), Expect = 0.000e+0
Identity = 448/506 (88.54%), Postives = 477/506 (94.27%), Query Frame = 2
Query:  914 MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDIKNFLFKRR 2431
            MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPK+  EV+HDSGI++KDG+  ATQRSFILKVLRDFGLGK+KS+EI+QNEC N LDELDT S QIVDFSE  PIYTTNIISRFIMNKRFTRDDPN+ F+ K +    KNKDI  LILLMFPC D S ++ +L++L  S+WK F++IQD+FAEEIKEHRNALDFTSEGED+MDRFLIKQ++LKQSTGNVESFVDWQLIR SVELFIAG+ETTSTTLNWCCLFMSKYPDIQEKV+KEISEIIGKERLPTMNDKKA+NYTQ+VMDEVLRLSSVSPLSLIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFV+MVQRFQISF EEISE+KY QTIIGNEGLIRTSDIKNFLFKRR
Sbjct:    1 MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKIITEVSHDSGIMFKDGQGLATQRSFILKVLRDFGLGKAKSLEIIQNECLNLLDELDTFSDQIVDFSEFFPIYTTNIISRFIMNKRFTRDDPNIQFIWKTMDNLAKNKDIFHLILLMFPCLDQSFIVARLLFLFVSDWKRFVKIQDYFAEEIKEHRNALDFTSEGEDIMDRFLIKQHELKQSTGNVESFVDWQLIRNSVELFIAGFETTSTTLNWCCLFMSKYPDIQEKVYKEISEIIGKERLPTMNDKKAMNYTQSVMDEVLRLSSVSPLSLIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVTMVQRFQISFGEEISEEKYLQTIIGNEGLIRTSDIKNFLFKRR 506          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078100.1 (SMESG000078100.1)

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 444/506 (87.75%), Postives = 472/506 (93.28%), Query Frame = 2
Query:  914 MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDIKNFLFKRR 2431
            MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPK+  EV+HDSGI++KDG+  ATQRSFILKVLRDFGLGKSKS+EI+QNEC N LDELDTLS QIVDFSE  PIYTTNIISRFIMNKRFTRDDPN+ F+ K +    KNKDI  LILLMFPC D S ++ +L++L  S+WK F++IQD+FAEEIKEHRNALDFTSEGEDLMDRFLIKQ++LKQSTGNVESFVDWQLIR S+EL IAGYETTSTTLNWCCLFMSKYPDIQEKVH+EISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSV+P+ L+HRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQC+GESLARSEYFIFFVSMVQRFQISFAEEISE+KY QTIIGNEG IRTSDI  F FK R
Sbjct:    1 MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKIITEVSHDSGIMFKDGQGLATQRSFILKVLRDFGLGKSKSLEIIQNECLNLLDELDTLSDQIVDFSEFFPIYTTNIISRFIMNKRFTRDDPNIQFIWKTMDNLAKNKDIFHLILLMFPCLDQSFIVARLLFLFVSDWKRFVKIQDYFAEEIKEHRNALDFTSEGEDLMDRFLIKQHELKQSTGNVESFVDWQLIRNSLELIIAGYETTSTTLNWCCLFMSKYPDIQEKVHEEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSVAPMGLMHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCIGESLARSEYFIFFVSMVQRFQISFAEEISEEKYLQTIIGNEGHIRTSDITKFKFKNR 506          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078098.1 (SMESG000078098.1)

HSP 1 Score: 865.144 bits (2234), Expect = 0.000e+0
Identity = 427/506 (84.39%), Postives = 459/506 (90.71%), Query Frame = 2
Query:  914 MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFFAEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEXXXXXXXXXXXXIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDIKNFLFKRR 2431
            MELCY VTFILI L+F YW  +K  IPKGLKEIP+ESGLPIIGAIHKIE P+  Y  KL RKLGPIFRIKLGMRKIVVLNNYEMIKK LIDDANNFSGRW PKV  +  HDSGI++KDG IWA QRSF+LKVLRDFGLGK+KS+EI+QNEC NFLDELDTLSGQIV+FSELIPIYTTNIISRFIMNKRFTRDDP V F+ K IT  TK+KDI+QLIL+MFPCFD SSL  +L++LL ++WK F+ I+++F EEI+EHR  LD TSEGEDLMDRFLIKQ QLKQSTGNVESFVDWQLIR SVE+FIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSV P++LIHRTF+DANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSN ISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISE+KY QTIIGNEG IRTSDI  F FK+R
Sbjct:    1 MELCYYVTFILISLFFYYWTFKKTQIPKGLKEIPVESGLPIIGAIHKIEMPISRYFQKLSRKLGPIFRIKLGMRKIVVLNNYEMIKKTLIDDANNFSGRWLPKVFTDAAHDSGIMFKDGHIWAIQRSFLLKVLRDFGLGKAKSLEIIQNECLNFLDELDTLSGQIVEFSELIPIYTTNIISRFIMNKRFTRDDPKVQFIGKTITNLTKSKDILQLILIMFPCFDTSSLFSKLVFLLNTKWKRFVTIENYFWEEIEEHRTNLDLTSEGEDLMDRFLIKQRQLKQSTGNVESFVDWQLIRNSVEIFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSVVPMALIHRTFYDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNEISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEEKYLQTIIGNEGHIRTSDITKFKFKKR 506          
The following BLAST results are available for this feature:
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP2A63.352e-6730.89cytochrome P450 family 2 subfamily A member 6 [Sou... [more]
CYP2A132.516e-6631.56cytochrome P450 family 2 subfamily A member 13 [So... [more]
CYP2J21.785e-6433.78cytochrome P450 family 2 subfamily J member 2 [Sou... [more]
CYP2C82.198e-6432.24cytochrome P450 family 2 subfamily C member 8 [Sou... [more]
CYP2B65.925e-6433.26cytochrome P450 family 2 subfamily B member 6 [Sou... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-33C11.114e-6030.82CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-14A11.472e-5832.70CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C43.213e-5830.21CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C22.808e-5730.79CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C53.698e-5728.25CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp18a11.490e-6131.07gene:FBgn0010383 transcript:FBtr0074610[more]
Cyp18a11.490e-6131.07gene:FBgn0010383 transcript:FBtr0074609[more]
Cyp305a19.058e-4228.67gene:FBgn0036910 transcript:FBtr0074925[more]
Cyp303a12.983e-4126.56gene:FBgn0001992 transcript:FBtr0343812[more]
Cyp303a12.983e-4126.56gene:FBgn0001992 transcript:FBtr0080828[more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2n134.578e-7034.36cytochrome P450, family 2, subfamily N, polypeptid... [more]
cyp2k161.849e-6935.01cytochrome P450, family 2, subfamily K, polypeptid... [more]
cyp2p82.394e-6935.52cytochrome P450, family 2, subfamily P, polypeptid... [more]
cyp2y32.754e-6935.63cytochrome P450, family 2, subfamily Y, polypeptid... [more]
cyp2y32.147e-6835.39cytochrome P450, family 2, subfamily Y, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2f16.904e-7135.73cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
slc35b21.515e-7035.31solute carrier family 35 member B2 [Source:Xenbase... [more]
slc35b21.515e-7035.31solute carrier family 35 member B2 [Source:Xenbase... [more]
cyp2f11.966e-7035.68cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
cyp2f14.677e-7032.90cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp2j61.605e-6934.44cytochrome P450, family 2, subfamily j, polypeptid... [more]
Cyp2b94.843e-6935.05cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b131.352e-6834.57cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b194.833e-6831.50cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2a45.182e-6831.06cytochrome P450, family 2, subfamily a, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00178|CP2B4_RABIT4.266e-7134.47Cytochrome P450 2B4 OS=Oryctolagus cuniculus OX=99... [more]
sp|P24460|CP2BB_CANLF2.922e-7034.96Cytochrome P450 2B11 OS=Canis lupus familiaris OX=... [more]
sp|O54750|CP2J6_MOUSE1.122e-6834.44Cytochrome P450 2J6 OS=Mus musculus OX=10090 GN=Cy... [more]
sp|P12790|CP2B9_MOUSE3.388e-6835.05Cytochrome P450 2B9 OS=Mus musculus OX=10090 GN=Cy... [more]
sp|P12789|CP2B5_RABIT5.806e-6834.69Cytochrome P450 2B5 OS=Oryctolagus cuniculus OX=99... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4P8NYX50.000e+064.21P450 2B-like protein OS=Dugesia japonica OX=6161 G... [more]
A0A2U8U4730.000e+060.36Cytochrome P450 2K1-like protein OS=Dugesia japoni... [more]
A0A267DEG05.995e-8133.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HZ603.604e-8033.61Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FBR21.044e-7933.93Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2n133.906e-7535.68cytochrome P450 2J6-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000048412.11.998e-6833.61cytochrome P450 2K1-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000019508.22.189e-6833.61cytochrome P450 2K1-like [Source:NCBI gene;Acc:111... [more]
ENSAMXT00000019474.21.377e-6633.56cytochrome P450 2K1-like [Source:NCBI gene;Acc:103... [more]
cyp2v16.073e-6534.11cytochrome P450, family 2, subfamily V, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011205.11.331e-5630.33pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1... [more]
ENSPMAT00000001876.11.685e-5429.49pep scaffold:Pmarinus_7.0:GL477372:10316:22460:-1 ... [more]
ENSPMAT00000011254.12.168e-5330.27pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 ge... [more]
cyp1d12.181e-4927.73cytochrome P450, family 1, subfamily D, polypeptid... [more]
ENSPMAT00000011204.12.795e-4628.32pep scaffold:Pmarinus_7.0:GL477378:78074:79555:1 g... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
DIT21.045e-627.08N-formyltyrosine oxidase; sporulation-specific mic... [more]
ERG59.482e-621.76C-22 sterol desaturase; a cytochrome P450 enzyme t... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO482071.473e-5129.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481917.948e-5028.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO294036.536e-4528.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466058.509e-4529.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403004.163e-4428.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2n132.844e-7635.04cytochrome P450 2J6 [Source:NCBI gene;Acc:10115696... [more]
ENSORLT00000020799.25.229e-7336.83cytochrome P450 2J6 [Source:NCBI gene;Acc:10115541... [more]
cyp2n131.561e-7234.08cytochrome P450 2J6 [Source:NCBI gene;Acc:10115656... [more]
ENSORLT00000018818.27.067e-7134.54cytochrome P450 2J2 [Source:NCBI gene;Acc:10115776... [more]
ENSORLT00000019638.21.543e-7033.69cytochrome P450 2K1 [Source:NCBI gene;Acc:10115799... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078092.10.000e+097.43SMESG000078092.1[more]
SMESG000078091.10.000e+093.48SMESG000078091.1[more]
SMESG000078094.10.000e+088.54SMESG000078094.1[more]
SMESG000078100.10.000e+087.75SMESG000078100.1[more]
SMESG000078098.10.000e+084.39SMESG000078098.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028574 ID=SMED30028574|Name=Cytochrome P450 2K1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2509bp
TTTATAAATCCTTTTTGAAATAGCTCTTTTTAGATTTTATATTCTCTTTG
TTGGAGGTTTAAAAATCGGTTATTAGTATATGAGAGAATTTACGACCAGC
TACGTTTGTTTAAAGTTCAGAACCAATGCTTATCGTTCTTGTGGAGGATT
CAGCCCAGTTTTGATTATCAACATTGAAGAAGATTTACGTTGATTTTGTT
TACAAACGTCAAATATATTCTAGCAAAAGACAATTAAAGACACAAATAAT
ACATTTTCTGGGTACCTGACGAGGTGAGAAGAAAATAATTTGCACTCCCA
TGTTCAAGGTGATTTTCACCTGGTACGTGAATAAGAAAATTTAACCATTT
GGCACCCGCACAAATGGCATTGTAACTGTGCTCACTTCGGAAGGTGCGCT
TCGGAATATAATGGAGAAAACCGAAGTTTCTTCTTGCAGATACTGCTCCA
GAGAGTTGTGATGAACATGTTAATATTCACTATGCAGTTGGCAGCTATGT
ATTCTTTAAACCACCAAACCCCAAGTGCAACACTCAATAAACAGTTGGCA
CGGTCATAGTCACCGATTGTCCGGACAAAGTAGAAACTGTAAGCGGAGCC
AGTTCAGAACATATTCATGTAGAGGATTTGTCAAATTCGAGATCAAGAAG
AGAACGAAGATCTCAAGAACGGTTGAAAGACTATGAGATTAATACTAAGA
TCACGAGAGCGCGTAATGATATTGATATTATCTCAAAATAGCAACATATT
ACGTTGCGGTATTTTCAAGCACTTGAAAATTGAAAAAGCTCAATTTGGAA
TTGACATATATATGAAATTGTGTATCAAACGGTCAATGATTTGCACTGAA
TTGTACAATGCCATTGTCCAAATTGACAATATATTCACATAATATTTTCA
ATTATTGAGTGAGATGGAACTTTGTTATTGTGTCACTTTTATATTGATTT
TTCTATATTTCTTGTATTGGGTTTGCAGGAAACCTCCAATCCCAAAAGGG
TTAAAAGAGATTCCAATGGAGTCTGGACTGCCTATCATTGGAGCAATTCA
CAAAATTGAGCCTCCGATGCATCATTATCTATTGAAACTCGGTAGAAAAC
TTGGACCAATATTCAGAATAAAATTAGGAATGAGAAAGATTGTCGTTTTG
AACAATTATGAAATGATAAAGAAAGCACTGATAGATGATGCAAATAATTT
CTCAGGTCGATGGTCACCAAAGGTGGATGCTGAAGTCACTCATGATTCAG
GAATTATTTACAAAGACGGAAAAATATGGGCTACCCAAAGATCTTTTATT
CTCAAAGTACTTCGAGATTTTGGATTGGGAAAATCAAAATCTATTGAAAT
TGTTCAAAATGAATGTTTTAACTTTTTAGATGAACTTGATACTCTTTCGG
GTCAAATTGTAGATTTTTCCGAATTAATCCCAATATATACAACAAACATT
ATTTCTAGATTCATCATGAATAAAAGATTCACTAGAGATGATCCAAATGT
TCATTTCATGGAAAAGGCCATAACTAAGTTTACTAAAAATAAAGACATAA
TTCAGTTAATATTATTAATGTTTCCATGCTTCGATAATTCAAGTTTAATC
TGCCAGCTTATTTATTTACTAACTTCAGAATGGAAAAGCTTTATCAGAAT
TCAAGATTTTTTCGCAGAAGAAATTAAAGAACATCGGAATGCTCTGGATT
TTACTTCTGAAGGAGAAGATCTCATGGACCGATTCCTAATCAAGCAGTAC
CAATTAAAACAATCAACTGGGAATGTTGAAAGCTTTGTTGACTGGCAGTT
GATCCGTACTTCTGTTGAATTATTTATCGCTGGCTATGAAACAACATCAA
CAACCCTCAATTGGTGTTGCCTTTTCATGTCGAAGTATCCTGATATCCAA
GAGAAAGTTCATAAAGAAATAAGCGAAATCATAGGAAAAGAACGCTTACC
GACGATGAATGATAAGAAAGCACTGAATTATACACAAGCAGTCATGGATG
AAGTATTACGACTGAGCTCGGTTTCTCCATTGTCTTTAATTCACAGAACG
TTTCACGATGCAAATATAAATGGATTTTACATTCCGAAGGATTCTCTAAT
TTTTCCTAATTTATATGCTTGTCACATGGATCCGGAAATATGGGAATCTC
CTACAACGTTTTATCCGGAACATTTCTTAAGTTTAGATAGCAATGGAATT
TCAAAATACCAACCGAGAGAGGAACTGATACCATTTAGTGTTGGGAAACG
ACAATGCCTTGGCGAGTCTCTTGCTAGATCAGAATACTTTATTTTCTTTG
TAAGCATGGTCCAACGATTCCAGATAAGCTTTGCAGAAGAAATTAGTGAA
GATAAATATTCCCAAACAATAATTGGCAATGAAGGTCTCATTAGAACCTC
CGATATTAAGAATTTCCTCTTCAAAAGACGATAATTATTCGGGTTGACTC
TTCTTTCTGAGAGATTTAACACTATCATTTTATTAATTGATTCTTATAAT
CACAAATGA
back to top

protein sequence of SMED30028574-orf-1

>SMED30028574-orf-1 ID=SMED30028574-orf-1|Name=SMED30028574-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MELCYCVTFILIFLYFLYWVCRKPPIPKGLKEIPMESGLPIIGAIHKIEP
PMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRW
SPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNE
CFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFME
KAITKFTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRIQDFF
AEEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTS
VELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMND
KKALNYTQAVMDEVLRLSSVSPLSLIHRTFHDANINGFYIPKDSLIFPNL
YACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLG
ESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGLIRTSDIKN
FLFKRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036396Cyt_P450_sf
IPR002401Cyt_P450_E_grp-I
IPR001128Cyt_P450
IPR017972Cyt_P450_CS
Vocabulary: molecular function
TermDefinition
GO:0005506iron ion binding
GO:0020037heme binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497monooxygenase activity
GO:0046872metal ion binding
GO:0016491oxidoreductase activity
GO:0016712oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002401Cytochrome P450, E-class, group IPRINTSPR00463EP450Icoord: 438..448
score: 56.16
coord: 358..376
score: 36.34
coord: 399..423
score: 39.6
coord: 295..312
score: 39.83
coord: 315..341
score: 36.59
coord: 175..193
score: 28.27
coord: 60..79
score: 37.05
coord: 84..105
score: 27.27
coord: 448..471
score: 42.46
IPR001128Cytochrome P450PRINTSPR00385P450coord: 306..323
score: 39.94
coord: 448..459
score: 49.34
coord: 359..370
score: 40.78
coord: 439..448
score: 58.42
IPR001128Cytochrome P450PFAMPF00067p450coord: 35..479
e-value: 2.5E-102
score: 343.0
IPR036396Cytochrome P450 superfamilyGENE3DG3DSA:1.10.630.10coord: 28..497
e-value: 2.4E-123
score: 414.5
IPR036396Cytochrome P450 superfamilySUPERFAMILYSSF48264Cytochrome P450coord: 33..478
NoneNo IPR availablePANTHERPTHR24300FAMILY NOT NAMEDcoord: 11..479
NoneNo IPR availableTMHMMTMhelixcoord: 3..20
IPR017972Cytochrome P450, conserved sitePROSITEPS00086CYTOCHROME_P450coord: 441..450