CID domain-containing protein

Overview
NameCID domain-containing protein
Smed IDSMED30028573
Length (bp)3664
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CID domain-containing protein (SMED30028573) t-SNE clustered cells

Violin plots show distribution of expression levels for CID domain-containing protein (SMED30028573) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CID domain-containing protein (SMED30028573) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CID domain-containing protein (SMED30028573) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028573

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028573h1SMcG0021869 SmedASXL_067259SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30028573h1SMcG0021869 SmedASXL_009115SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CID domain-containing protein vs. Ensembl Human
Match: RPRD2 (regulation of nuclear pre-mRNA domain containing 2 [Source:HGNC Symbol;Acc:HGNC:29039])

HSP 1 Score: 88.9669 bits (219), Expect = 4.810e-17
Identity = 71/257 (27.63%), Postives = 133/257 (51.75%), Query Frame = 3
Query:   87 TISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSN---FKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            +++ T  SIQ  S +  +  K    +V  W + L  +    +++LFY+AN+++Q  N    N   F++S+   L  +   +K+ SV++ + R+F IW +R VY +  I  L   L S+ +P    ++K I+  F  +  I +L    + E+++   LK    S +  D  S  E +K LKDK    +FS + +   ++L +  + +++++K   S  + +ENA ++Y+ Q  E  VV +AYK + N +   K  L++
Sbjct:   33 SVTNTMESIQGLSSWCIENKKHHSTIVYHWMKWLRRSAYPHRLNLFYLANDVIQ--NCKRKNAIIFRESFADVLPEAAALVKDPSVSKSVERIFKIWEDRNVYPEEMIVALREALTST-NPKAALKSK-IVAEFRSQALIEELLLYKRSEDQIE--LKEKQLSTMRVDVCST-ETLKCLKDKTGGKKFSKEFEEASSKLEEFVNGLDKQVKNGPSLTEALENAGIFYEAQYKEVKVVANAYKTFANRVNNLKKKLDQ 282          
BLAST of CID domain-containing protein vs. Ensembl Human
Match: RPRD2 (regulation of nuclear pre-mRNA domain containing 2 [Source:HGNC Symbol;Acc:HGNC:29039])

HSP 1 Score: 82.0333 bits (201), Expect = 7.087e-15
Identity = 70/281 (24.91%), Postives = 135/281 (48.04%), Query Frame = 3
Query:   87 TISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSN---FKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASS-------RSPINEEETKN-----------------IILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            +++ T  SIQ  S +  +  K    +V  W + L  +    +++LFY+AN+++Q  N    N   F++S+   L  +   +K+ SV++ + R+F IW +R VY +  I  L   L+++       +  +N++  K                  I+  F  +  I +L    + E+++   LK    S +  D  S  E +K LKDK    +FS + +   ++L +  + +++++K   S  + +ENA ++Y+ Q  E  VV +AYK + N +   K  L++
Sbjct:   33 SVTNTMESIQGLSSWCIENKKHHSTIVYHWMKWLRRSAYPHRLNLFYLANDVIQ--NCKRKNAIIFRESFADVLPEAAALVKDPSVSKSVERIFKIWEDRNVYPEEMIVALREALSTTFKTQKQLKENLNKQPNKQWKKSQTSTNPKAALKSKIVAEFRSQALIEELLLYKRSEDQIE--LKEKQLSTMRVDVCST-ETLKCLKDKTGGKKFSKEFEEASSKLEEFVNGLDKQVKNGPSLTEALENAGIFYEAQYKEVKVVANAYKTFANRVNNLKKKLDQ 308          
BLAST of CID domain-containing protein vs. Ensembl Human
Match: ZNF528 (zinc finger protein 528 [Source:HGNC Symbol;Acc:HGNC:29384])

HSP 1 Score: 75.0998 bits (183), Expect = 5.346e-13
Identity = 73/243 (30.04%), Postives = 104/243 (42.80%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 3569
            PYSC+ C K F+R S L +H +VHT  +PY+C +C K F  R SL TH+     +  K  +C  C K+   +  L +H ++H RE    C  C K F  + DL R    H DEK    + C     E         S +T                 +    +K  +C  C  +F  K+   +H  +    +    NR C K F  +S  + H Q++H     Y C QC  +F Q S    HQ
Sbjct:  324 PYSCNKCGKVFSRHSYLAEHQTVHTGEKPYKCEECGKAFSVRSSLITHQLI--HTGRKPYKCKECDKVFGRKCFLTSHQRIHTRERPYGCSQCGKIFSQKSDLIRHRKTHTDEKPYKCNKCGTAFRE--------FSDLTA--------------HFLIHSGEKPYECKECGKVFRYKSSLTSHHRIHTGEKPYKCNR-CGKVFSRSSNLVCH-QKIHTGEKPYKCNQCGKVFNQASYLTRHQ 540          

HSP 2 Score: 61.2326 bits (147), Expect = 9.716e-9
Identity = 38/106 (35.85%), Postives = 54/106 (50.94%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 3170
            PY C+ C K FN+AS L +H  +HT  RPY+C KC K FR    L  H A      +   +    +   +S  +L NH ++H+ E    C +C K F    DL++H
Sbjct:  520 PYKCNQCGKVFNQASYLTRHQIIHTGERPYRCSKCGKAFRGCSGLTAHLAIHTEKKSHECKECGKIFTQKS--SLTNHHRIHIGEKPYKCTLCSKVFSHNSDLAQH 623          

HSP 3 Score: 60.077 bits (144), Expect = 2.247e-8
Identity = 61/242 (25.21%), Postives = 90/242 (37.19%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVA-LRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            PY C  C K F+  SNL QH  +HT  +PY+C +C K FR    L  H+        +          + +Q+A L  H K+H  E    C  C K F     L+ H            + +  G KP                                   KC  C   F+ ++    H  +     K +  + CDK F     FL   Q +H +   Y C+QC  +F+Q+S  + H+K+
Sbjct:  240 PYKCHECGKLFSSNSNLSQHQRIHTGEKPYKCHECDKVFRSSSKLAQHQRI---HTGEKPYKCHECDKVFNQIAHLVRHQKIHTGEKPYSCNKCGKVFSRHSYLAEH------------QTVHTGEKP----------------------------------YKCEECGKAFSVRSSLITHQLIHT-GRKPYKCKECDKVFGRKC-FLTSHQRIHTRERPYGCSQCGKIFSQKSDLIRHRKT 430          
BLAST of CID domain-containing protein vs. Ensembl Human
Match: ZNF605 (zinc finger protein 605 [Source:HGNC Symbol;Acc:HGNC:28068])

HSP 1 Score: 74.3294 bits (181), Expect = 9.201e-13
Identity = 71/245 (28.98%), Postives = 96/245 (39.18%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            PY CS C K F+R S L++H   HT  +PY C +C K F  +  L TH+                    +SQ  L  H + H  +    C  C K F     L R    H  EK    + C E     RKP                    + IK  I    +K  +C  C   F  K++   H  + L  EK +    C KTF   SQ L H    H     Y C++C   F Q+SS ++HQ++
Sbjct:  283 PYGCSECGKAFSRKSQLKRHQITHTIEKPYSCSECGKAFSQKLKLITHQRAHTGEKPYPCSHCGKAFFWKSQ--LITHQRTHTGKKPYGCGECQKAFSRNSLLIRHQRIHTGEKPYECNECGEAFI--RKP--------------------QLIKHQITHTGEKNYRCSDCEEAFFKKSELIRHQKIHL-GEKPYGCIQCGKTFFGKSQLLTH-HRTHTGEKPYECSECGKAFTQKSSLISHQRT 501          

HSP 2 Score: 53.5286 bits (127), Expect = 2.210e-6
Identity = 60/242 (24.79%), Postives = 87/242 (35.95%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY CS C K F + S+L  H   HT  +PY+C +C K F  + SL  H+ T                              H  E    C  C K F  +  L RH            + +  G KP    E   +          Q+ + IK       +K   C  C+  F  KA+   H  +    E+ +    C K+F   S  + H Q +H     Y C +C   F ++S  + HQ+
Sbjct:  479 PYECSECGKAFTQKSSLISHQRTHTGEKPYECSECRKTFSEKSSLIHHQRT------------------------------HTGEKPFECSECRKAFAWKPQLLRH------------QRIHTGEKPYECSECGKAFV--------QKVQLIKHQRNHTGEKTYGCSDCAKAFFEKAQLIIHQRIHT-GERPYKCGECGKSFTRKSHLMRH-QRIHTGDKYYGCNECGTTFNRKSQLMIHQR 668          

HSP 3 Score: 52.7582 bits (125), Expect = 4.720e-6
Identity = 57/239 (23.85%), Postives = 77/239 (32.22%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            Y C  C + FN+ S L  H   HT  +PYQC +C K F  +  L  H+ T                  +S + L  H ++H  E    C  C K F  +  L RH                                               I    +K   C  C   F+ K K   H       EK +    C K F   SQ + H Q  H     Y C +C   F++ S  + HQ+
Sbjct:  200 YLCMECGRFFNKKSQLVIHQRTHTGEKPYQCSECGKAFSQKSLLTVHQRTHSGEKPHGCSECQKAFSRKSLLIL--HQRIHTGEKPYGCSECGKAFSRKSQLKRH----------------------------------------------QITHTIEKPYSCSECGKAFSQKLKLITHQ-RAHTGEKPYPCSHCGKAFFWKSQLITH-QRTHTGKKPYGCGECQKAFSRNSLLIRHQR 388          
BLAST of CID domain-containing protein vs. Ensembl Human
Match: ZNF84 (zinc finger protein 84 [Source:HGNC Symbol;Acc:HGNC:13159])

HSP 1 Score: 74.3294 bits (181), Expect = 1.042e-12
Identity = 72/245 (29.39%), Postives = 100/245 (40.82%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            PY CS C K F + S+L  H   HT  +PY+C +C K F  + SL TH+ T         R        +SQ  L  H ++H  E    C +C K F  + +L RH+     EK    + C       RK   E SS I H                     +K  +C  C   F+ K+    H       EK +    C K F   SQ + H Q +H     Y C +C   F+Q+S  +NHQ++
Sbjct:  513 PYVCSECGKAFCQKSHLISHQRTHTGEKPYECSECGKAFGEKSSLATHQRTHTGEKPYECRDCEKAFSQKSQ--LNTHQRIHTGEKPYECSLCRKAFFEKSELIRHLRTHTGEKPYECNEC-------RKAFREKSSLINHQRI---------------HTGEKPFECSECGKAFSRKSHLIPHQRTHT-GEKPYGCSECRKAFSQKSQLVNH-QRIHTGEKPYRCIECGKAFSQKSQLINHQRT 731          

HSP 2 Score: 66.2402 bits (160), Expect = 3.399e-10
Identity = 69/253 (27.27%), Postives = 101/253 (39.92%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSI------TXXXXXXXXXXXKPIKEVIPEI-------PKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY+CS C K F++ S L  H   HT  +PY+C +C K F  +  L +H  T                  +S   L NH ++H  E    C+ C K F  +  L  H    H  +     G  + RK   E S  I      T    Y   + +K  +E    I        +K   C+ C   F+ K+   +H  +    EK  +   C K F   SQ + H Q  H     Y C++C   F+++ S  NHQ+
Sbjct:  261 PYNCSQCGKAFSQKSQLTSHQRTHTGEKPYECGECGKAFSRKSHLISHWRTHTGEKPYGCNECGRAFSEKSN--LINHQRIHTGEKPFECRECGKAFSRKSQLVTH-HRTHTGTKPF--GCSDCRKAFFEKSELIRHQTIHTGEKPYECSECRKAFRERSSLINHQRTHTGEKPHGCIQCGKAFSQKSHLISHQ-MTHTGEKPFICSKCGKAFSRKSQLVRH-QRTHTGEKPYECSECGKAFSEKLSLTNHQR 506          

HSP 3 Score: 65.0846 bits (157), Expect = 7.138e-10
Identity = 66/257 (25.68%), Postives = 99/257 (38.52%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDL----SRHVDEKHAASSSCIEGLPE------------GRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            PY C+ C + F+  SNL  H  +HT  +P++C +C K F  +  L TH  T   + TK   C  C K    +  L  H  +H  E    C  C K F  +  L      H  EK      C +   +            G KP       I         ++ + ++       +K  +C  C   F+ K    NH  +    EK ++   C K F   S  + H Q  H     Y C++C   F ++SS   HQ++
Sbjct:  317 PYGCNECGRAFSEKSNLINHQRIHTGEKPFECRECGKAFSRKSQLVTHHRT--HTGTKPFGCSDCRKAFFEKSELIRHQTIHTGEKPYECSECRKAFRERSSLINHQRTHTGEKPHGCIQCGKAFSQKSHLISHQMTHTGEKPF------ICSKCGKAFSRKSQLVRHQRTHTGEKPYECSECGKAFSEKLSLTNHQRIHT-GEKPYVCSECGKAFCQKSHLISH-QRTHTGEKPYECSECGKAFGEKSSLATHQRT 563          

HSP 4 Score: 63.929 bits (154), Expect = 1.499e-9
Identity = 66/256 (25.78%), Postives = 97/256 (37.89%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPE------------GRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            P+ CS C K F+R S L +H   HT  +PY+C +C K F  + SL  H+         +          +S   L +H + H  E    C  C K F  +  L+     H  EK      C +   +            G KP      S+     +   +  + ++    E P    +C  C   F  K+   NH  +    EK      C K F   S  + H Q  H     Y C++C   F+Q+S  VNHQ+
Sbjct:  457 PFICSKCGKAFSRKSQLVRHQRTHTGEKPYECSECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQKSH--LISHQRTHTGEKPYECSECGKAFGEKSSLATHQRTHTGEKPYECRDCEKAFSQKSQLNTHQRIHTGEKP---YECSLCRKAFFEKSELIRHLRTHTGEKP---YECNECRKAFREKSSLINHQRIHT-GEKPFECSECGKAFSRKSHLIPH-QRTHTGEKPYGCSECRKAFSQKSQLVNHQR 702          
BLAST of CID domain-containing protein vs. Ensembl Celegans
Match: cids-2 (Pol II C-terminal Interaction Domain Suppressor [Source:UniProtKB/TrEMBL;Acc:Q8I4J5])

HSP 1 Score: 60.077 bits (144), Expect = 9.455e-9
Identity = 59/229 (25.76%), Postives = 107/229 (46.72%), Query Frame = 3
Query:  135 YQFYKSSDIVVSLWYQALCSAP-DTCKISLFYVANEMLQSRNFGSSN-----FKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKS-CKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAY 800
            Y+   S D++V  W     +A  D  +I+LFYV N+++Q      ++     F+ +  + +    +  K  +V ++ I++F     R V+  +    + N LAS      E E +   L  D +D + K+ N +   N V + +K V+    NFD K  CK     ++D+       +++   I+ + QV   ME++ K   +  + +E A+  +  Q  E LVVE+AY
Sbjct:   34 YKDNASIDLIVDGWLNCFKTAGTDNKRIALFYVMNDVVQKAKMKHADTLIPAFQPAVLTAVGIGRKQDKVKAVMKRCIQIFK---SRNVFSPASTTAMENLLASDADEGYEAEDQ--ALEVDSDDLVKKITNFISARNVVADMMKCVNEG--NFDYKEMCKHG---MRDREEGGHILHEVHEAIDTMVQVRHSMEDQKKKMMALSETLELAKRVFLHQKREVLVVEEAY 252          
BLAST of CID domain-containing protein vs. Ensembl Celegans
Match: cids-2 (Pol II C-terminal Interaction Domain Suppressor [Source:UniProtKB/TrEMBL;Acc:Q8I4J5])

HSP 1 Score: 60.077 bits (144), Expect = 9.885e-9
Identity = 59/229 (25.76%), Postives = 107/229 (46.72%), Query Frame = 3
Query:  135 YQFYKSSDIVVSLWYQALCSAP-DTCKISLFYVANEMLQSRNFGSSN-----FKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKS-CKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAY 800
            Y+   S D++V  W     +A  D  +I+LFYV N+++Q      ++     F+ +  + +    +  K  +V ++ I++F     R V+  +    + N LAS      E E +   L  D +D + K+ N +   N V + +K V+    NFD K  CK     ++D+       +++   I+ + QV   ME++ K   +  + +E A+  +  Q  E LVVE+AY
Sbjct:   36 YKDNASIDLIVDGWLNCFKTAGTDNKRIALFYVMNDVVQKAKMKHADTLIPAFQPAVLTAVGIGRKQDKVKAVMKRCIQIFK---SRNVFSPASTTAMENLLASDADEGYEAEDQ--ALEVDSDDLVKKITNFISARNVVADMMKCVNEG--NFDYKEMCKHG---MRDREEGGHILHEVHEAIDTMVQVRHSMEDQKKKMMALSETLELAKRVFLHQKREVLVVEEAY 254          
BLAST of CID domain-containing protein vs. Ensembl Celegans
Match: lin-48 (Putative zinc finger transcription factor [Source:UniProtKB/TrEMBL;Acc:G5EDU6])

HSP 1 Score: 56.9954 bits (136), Expect = 2.422e-8
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHS 3014
            Y C+ C KGFN   +L++H   HT +RPY+C +C K F  RCSL++H    H 
Sbjct:  161 YLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCEQCEKSFTQRCSLESHLRKVHG 213          
BLAST of CID domain-containing protein vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 54.6842 bits (130), Expect = 7.288e-8
Identity = 32/107 (29.91%), Postives = 44/107 (41.12%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 3173
            P+ C  C K F++A+NL  H  +HT  +P+ CP C + F    SL TH  T                   S   L  HL+ H       C +C   F    +L RH+
Sbjct:  106 PFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSS--TLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHM 210          
BLAST of CID domain-containing protein vs. Ensembl Celegans
Match: cids-2 (Pol II C-terminal Interaction Domain Suppressor [Source:UniProtKB/TrEMBL;Acc:Q8I4J5])

HSP 1 Score: 56.6102 bits (135), Expect = 9.358e-8
Identity = 56/229 (24.45%), Postives = 105/229 (45.85%), Query Frame = 3
Query:  135 YQFYKSSDIVVSLWYQALCSAP-DTCKISLFYVANEMLQSRNFGSSN-----FKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKS-CKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAY 800
            Y+   S D++V  W     +A  D  +I+LFYV N+++Q      ++     F+ +  + +    +  K  +V ++ I++F     R V+  +    + N L          E ++  L  D +D + K+ N +   N V + +K V+    NFD K  CK     ++D+       +++   I+ + QV   ME++ K   +  + +E A+  +  Q  E LVVE+AY
Sbjct:   34 YKDNASIDLIVDGWLNCFKTAGTDNKRIALFYVMNDVVQKAKMKHADTLIPAFQPAVLTAVGIGRKQDKVKAVMKRCIQIFK---SRNVFSPASTTAMENLLGY--------EAEDQALEVDSDDLVKKITNFISARNVVADMMKCVNEG--NFDYKEMCKHG---MRDREEGGHILHEVHEAIDTMVQVRHSMEDQKKKMMALSETLELAKRVFLHQKREVLVVEEAY 246          
BLAST of CID domain-containing protein vs. Ensembl Fly
Match: CG15160 (gene:FBgn0032688 transcript:FBtr0343826)

HSP 1 Score: 83.5741 bits (205), Expect = 7.691e-16
Identity = 58/254 (22.83%), Postives = 122/254 (48.03%), Query Frame = 3
Query:   99 TALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIED---LINKLASSRSPIN-EEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            T   IQ+ S +  Q   +   ++  W           ++ LFY+AN+++Q        F + W + L  +   +++  V +KI+R+F IW +R +Y + ++ D   L+N     +S ++  +E +N  L       I +++  +++    +++++++      F+ +  K+   +LKDK H      +++  +  +      ++ E+K R++ L  +E A+ +Y+ Q  E  VV  AYK +G  I   K  L+E
Sbjct:   20 TQEGIQQMSNWCLQHRSNHKKIIQCWLNVFKRVRVDHRLVLFYLANDVIQYSKRKRYEFVECWATALQRATTMVRDERVKDKILRIFKIWEQREIYNEEYLSDLSGLLNIAPPKKSQVDVSDEFQNATL-------IAQVRECVELAEITDKSMQKL-PKPPTFEIEVIKQ---QLKDKSHSGNIEKEVERCVAFINAYNKNLQNEIKSRKAVLASIEAAKKFYEHQGKEVKVVASAYKSFGTRIKIVKRKLDE 262          
BLAST of CID domain-containing protein vs. Ensembl Fly
Match: CG15160 (gene:FBgn0032688 transcript:FBtr0343825)

HSP 1 Score: 83.5741 bits (205), Expect = 8.117e-16
Identity = 58/254 (22.83%), Postives = 122/254 (48.03%), Query Frame = 3
Query:   99 TALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIED---LINKLASSRSPIN-EEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            T   IQ+ S +  Q   +   ++  W           ++ LFY+AN+++Q        F + W + L  +   +++  V +KI+R+F IW +R +Y + ++ D   L+N     +S ++  +E +N  L       I +++  +++    +++++++      F+ +  K+   +LKDK H      +++  +  +      ++ E+K R++ L  +E A+ +Y+ Q  E  VV  AYK +G  I   K  L+E
Sbjct:   20 TQEGIQQMSNWCLQHRSNHKKIIQCWLNVFKRVRVDHRLVLFYLANDVIQYSKRKRYEFVECWATALQRATTMVRDERVKDKILRIFKIWEQREIYNEEYLSDLSGLLNIAPPKKSQVDVSDEFQNATL-------IAQVRECVELAEITDKSMQKL-PKPPTFEIEVIKQ---QLKDKSHSGNIEKEVERCVAFINAYNKNLQNEIKSRKAVLASIEAAKKFYEHQGKEVKVVASAYKSFGTRIKIVKRKLDE 262          
BLAST of CID domain-containing protein vs. Ensembl Fly
Match: CG15160 (gene:FBgn0032688 transcript:FBtr0081070)

HSP 1 Score: 83.5741 bits (205), Expect = 8.648e-16
Identity = 58/254 (22.83%), Postives = 122/254 (48.03%), Query Frame = 3
Query:   99 TALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIED---LINKLASSRSPIN-EEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            T   IQ+ S +  Q   +   ++  W           ++ LFY+AN+++Q        F + W + L  +   +++  V +KI+R+F IW +R +Y + ++ D   L+N     +S ++  +E +N  L       I +++  +++    +++++++      F+ +  K+   +LKDK H      +++  +  +      ++ E+K R++ L  +E A+ +Y+ Q  E  VV  AYK +G  I   K  L+E
Sbjct:   20 TQEGIQQMSNWCLQHRSNHKKIIQCWLNVFKRVRVDHRLVLFYLANDVIQYSKRKRYEFVECWATALQRATTMVRDERVKDKILRIFKIWEQREIYNEEYLSDLSGLLNIAPPKKSQVDVSDEFQNATL-------IAQVRECVELAEITDKSMQKL-PKPPTFEIEVIKQ---QLKDKSHSGNIEKEVERCVAFINAYNKNLQNEIKSRKAVLASIEAAKKFYEHQGKEVKVVASAYKSFGTRIKIVKRKLDE 262          
BLAST of CID domain-containing protein vs. Ensembl Fly
Match: gl (gene:FBgn0004618 transcript:FBtr0330042)

HSP 1 Score: 65.855 bits (159), Expect = 1.686e-10
Identity = 37/107 (34.58%), Postives = 53/107 (49.53%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 3173
            PY C  C+K F++A+NL  H+  HT  +P++CP C +RF    S+ TH  T HS                S   L  HL++H  E    CK+C   F    +L+RH+
Sbjct:  464 PYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRT-HSGERPYRCSSCKKSFSDSST-LTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHM 568          

HSP 2 Score: 53.9138 bits (128), Expect = 1.019e-6
Identity = 32/107 (29.91%), Postives = 43/107 (40.19%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 3173
            P  C +C K + R S L+ HL  H+  RPY+CP C K F    +L  H  T                   S V    H++ H  E    C  C K F     L++H+
Sbjct:  436 PNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVT--THMRTHSGERPYRCSSCKKSFSDSSTLTKHL 540          
BLAST of CID domain-containing protein vs. Ensembl Fly
Match: gl (gene:FBgn0004618 transcript:FBtr0083584)

HSP 1 Score: 65.855 bits (159), Expect = 1.791e-10
Identity = 37/107 (34.58%), Postives = 53/107 (49.53%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 3173
            PY C  C+K F++A+NL  H+  HT  +P++CP C +RF    S+ TH  T HS                S   L  HL++H  E    CK+C   F    +L+RH+
Sbjct:  464 PYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRT-HSGERPYRCSSCKKSFSDSST-LTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHM 568          

HSP 2 Score: 53.5286 bits (127), Expect = 1.103e-6
Identity = 32/107 (29.91%), Postives = 43/107 (40.19%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 3173
            P  C +C K + R S L+ HL  H+  RPY+CP C K F    +L  H  T                   S V    H++ H  E    C  C K F     L++H+
Sbjct:  436 PNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVT--THMRTHSGERPYRCSSCKKSFSDSSTLTKHL 540          
BLAST of CID domain-containing protein vs. Ensembl Zebrafish
Match: rprd2a (regulation of nuclear pre-mRNA domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-030131-6641])

HSP 1 Score: 102.834 bits (255), Expect = 1.327e-21
Identity = 73/266 (27.44%), Postives = 132/266 (49.62%), Query Frame = 3
Query:   87 TISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQS-RNFGSSNFKQSWKSQLNPSLEYI---KNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETK---------NIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALE 845
            T+S T  SIQ  S +  +  K   ++V  W + L  +  + +++LFY+AN+++Q+ +   +  ++ ++   L  ++  I   K++ V + + R+ +IW ER VY + FI  L N LA    P+  +             I+  F P   I  L    K  +E+   LK    +A+  D  S  EA+KKLKDK     FS   +    +L +  S ++ E+K   + ++ +ENA+++Y+ Q  E  +V  AY+ + N ++  K  L+
Sbjct:   29 TVSNTMESIQGLSTWCIENKKFHSVIVKYWIKWLRKSDASHRLNLFYLANDVIQNCKRKNAIVYRTTFTDLLPEAMHLIRATKDAKVKKSVERILSIWEERNVYSEEFISQLRNSLARKEEPVKVQPAPVNSKSALKSKIVAEFVPSTFIEHLSKYRKSMDEIE--LKEKQLAAMRVDVCST-EALKKLKDKAGGKRFSKDFEDGSMKLQEFVSFLDGEVKKGPALMEALENADIFYEMQYKEVKIVAKAYETFANRVSHLKRKLD 291          
BLAST of CID domain-containing protein vs. Ensembl Zebrafish
Match: rprd2b (regulation of nuclear pre-mRNA domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-110719-1])

HSP 1 Score: 85.1149 bits (209), Expect = 4.084e-16
Identity = 68/267 (25.47%), Postives = 121/267 (45.32%), Query Frame = 3
Query:  186 LCSAPDTCKISLFYVANEMLQSRNFGSSN---FKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKL---------------------------------ASSRSPINEEET--KNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTK---DALEEHLDFL 863
            LC+A    +++LFY+AN+++Q  N    N   ++ ++   L  +   +K++ V + + R+F+IW ER VY +  I +L   L                                     +P++ +      I+  F P D + +L +     +E    L+    SAL  D  S  EA+K+LKDK   N+FS   +    +L +  + +E ++K     L+ + NA+++Y+ Q  E  +V +AYK + N +   K   DAL+  L  L
Sbjct:    7 LCAADANHRLNLFYLANDVIQ--NCKRKNAIIYRTAFAEVLPDAALLVKDAKVCKSVERIFSIWQERNVYPEELISELKANLLKKEKVKEKVKEKEKVKEKEKEKEKAKEKVKEQPPPAAPVSSKTALKSKIVAEFVPHDFVERLTSYKHALDE--SELREKQLSALRLDVCS-NEALKRLKDKAGGNKFSKDFEEGSTKLQEFVTFLEGQMKAGPPLLEALGNADIFYEIQYKEVKIVANAYKAFANRVCSLKRKLDALKATLPRL 268          
BLAST of CID domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-235i11.3 (si:ch211-235i11.3 [Source:ZFIN;Acc:ZDB-GENE-131125-9])

HSP 1 Score: 75.0998 bits (183), Expect = 1.105e-13
Identity = 68/244 (27.87%), Postives = 107/244 (43.85%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDL----QEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            P++C+ C K F++  NL+ H+S+HT  +P+ C +C + FR   SLKTH  +                 L    + + H+++H  E    C  C K F L    +  +  H  E+    + C + L       G L+S  TH            ++    E P     C  C   F   A ++ H  +    +K H    C KTF S+SQ   H++ VH +   Y+C++C   FAQ+S+   HQK
Sbjct:  101 PFTCTQCGKSFSQLPNLKTHMSIHTGEKPFTCTQCGETFRLLKSLKTHLMSHTGEKPFPCTHCRKSFRLFG--SFKTHMRIHTGERPFTCTQCGKSFRLYGSFKTHMRIHTGERPFTCTQCGKSL-------GRLASLKTH------------MRIHTGERP---FNCTQCGKSFRQSATFNLHMRIHT-GKKPHKCDQCGKTFLSSSQLKMHLR-VHTKEKPYSCSECGKSFAQQSNLQRHQK 318          
BLAST of CID domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-235i11.3 (si:ch211-235i11.3 [Source:ZFIN;Acc:ZDB-GENE-131125-9])

HSP 1 Score: 75.0998 bits (183), Expect = 1.105e-13
Identity = 68/244 (27.87%), Postives = 107/244 (43.85%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDL----QEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            P++C+ C K F++  NL+ H+S+HT  +P+ C +C + FR   SLKTH  +                 L    + + H+++H  E    C  C K F L    +  +  H  E+    + C + L       G L+S  TH            ++    E P     C  C   F   A ++ H  +    +K H    C KTF S+SQ   H++ VH +   Y+C++C   FAQ+S+   HQK
Sbjct:  101 PFTCTQCGKSFSQLPNLKTHMSIHTGEKPFTCTQCGETFRLLKSLKTHLMSHTGEKPFPCTHCRKSFRLFG--SFKTHMRIHTGERPFTCTQCGKSFRLYGSFKTHMRIHTGERPFTCTQCGKSL-------GRLASLKTH------------MRIHTGERP---FNCTQCGKSFRQSATFNLHMRIHT-GKKPHKCDQCGKTFLSSSQLKMHLR-VHTKEKPYSCSECGKSFAQQSNLQRHQK 318          
BLAST of CID domain-containing protein vs. Ensembl Zebrafish
Match: znf980 (zinc finger protein 980 [Source:ZFIN;Acc:ZDB-GENE-110913-163])

HSP 1 Score: 74.7146 bits (182), Expect = 2.880e-13
Identity = 74/268 (27.61%), Postives = 109/268 (40.67%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSL----KTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPE------------GRKP--------AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            P++C+ C + FN++S+L+ H+ +HT  +P+ CP+C K FR + SL    + H   K  + T+  R             L NH+  H  E    C  C K F LQ  L+ H+     EK    + C  G  +            G KP        +  L  S+T             I   I    K  I C  C   FN  +  + H  +    +KS     C K+F  +SQ   H+  +H     Y C+QC   F++ SS  NH K
Sbjct:  179 PFTCTQCGRSFNQSSHLKNHMKIHTGEKPFTCPQCEKSFRLQYSLINHMRIHTGEKLFTCTQCGRGFNKSSN------LNNHMMTHTGEKPFTCPQCGKSFGLQGSLTIHMRIHTGEKLFTCTQCGRGFNKLSNLNNHMVIHTGEKPFTCPQCGKSFGLQGSLT-------------IHMRIHTGEKPFI-CPQCGKSFNQSSSLNTHMKI-HTGKKSFTCAQCGKSFNQSSQLNQHMM-MHTGKKPYTCSQCGKSFSRSSSLYNHMK 424          

HSP 2 Score: 67.0106 bits (162), Expect = 8.376e-11
Identity = 65/250 (26.00%), Postives = 94/250 (37.60%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPEGR-------KPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            ++C+ C + FN++SN   H+ +HT  +P+ CP+C K F  + +L  H                      S   L+NH+K+H  E    C  C K F LQ  L  H+     EK    + C  G  +            GE   +          Q    I   I    +KL  C  C   FN  +  +NH  +    EK      C K+F        H++ +H     + C QC   F Q SS   H K
Sbjct:  124 FTCTQCGRKFNQSSNFNNHMKIHTGEKPFTCPQCGKSFGLQYNLTNHMRIHTGEKPFTCTQCGRSFNQSSH--LKNHMKIHTGEKPFTCPQCEKSFRLQYSLINHMRIHTGEKLFTCTQCGRGFNKSSNLNNHMMTHTGEKPFTCPQCGKSFGLQGSLTIHMRI-HTGEKLFTCTQCGRGFNKLSNLNNHMVI-HTGEKPFTCPQCGKSFGLQGSLTIHMR-IHTGEKPFICPQCGKSFNQSSSLNTHMK 368          

HSP 3 Score: 55.8398 bits (133), Expect = 2.604e-7
Identity = 62/257 (24.12%), Postives = 95/257 (36.96%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSL----KTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPE------------GRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 3566
            ++C+ C K     + L+ H+ +HT  +P+ C +C K F  + SL    K H   K  + T+  R               NH+K+H  E    C  C K F LQ +L+ H+     EK    + C     +            G KP                + Q   I  +     +KL  C  C   FN  +  +NH  +    EK      C K+F        H++ +H     + C QC   F + S+  NH
Sbjct:   68 FTCTQCGKSLANKTKLKNHMRIHTGEKPFTCTQCGKSFELQNSLTNHIKIHTGKKLFTCTQCGRKFNQSSN------FNNHMKIHTGEKPFTCPQCGKSFGLQYNLTNHMRIHTGEKPFTCTQCGRSFNQSSHLKNHMKIHTGEKPF------TCPQCEKSFRLQYSLINHMRIHTGEKLFTCTQCGRGFNKSSNLNNHM-MTHTGEKPFTCPQCGKSFGLQGSLTIHMR-IHTGEKLFTCTQCGRGFNKLSNLNNH 310          

HSP 4 Score: 53.5286 bits (127), Expect = 1.201e-6
Identity = 33/107 (30.84%), Postives = 49/107 (45.79%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 3173
            P+ C  C K FN++S+L  H+ +HT  + + C +C K F     L  H    H+               RS  +L NH+K+H  + S  C  C K F     L+RH+
Sbjct:  347 PFICPQCGKSFNQSSSLNTHMKIHTGKKSFTCAQCGKSFNQSSQLNQH-MMMHTGKKPYTCSQCGKSFSRSS-SLYNHMKIHTGKKSFTCAQCSKSFTCSSSLNRHM 451          
BLAST of CID domain-containing protein vs. Ensembl Xenopus
Match: RPRD2 (regulation of nuclear pre-mRNA domain containing 2 [Source:NCBI gene;Acc:100496193])

HSP 1 Score: 82.8037 bits (203), Expect = 3.053e-15
Identity = 67/279 (24.01%), Postives = 129/279 (46.24%), Query Frame = 3
Query:   87 TISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQS-RNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASS----------------------RSPINEEET--KNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            +++ T  SIQ  S +  +  K    VV  W +    +    +++LFY+AN+++Q+ +   +  +++++   L  +   +K++SV + + R+F IW ER VY++  I +  + L  S                        P+  +      I+  F P+  I  L+   +  + V   LK    S +  D  S  E +K+LKDK    +FS   +    +L +   L+E++++      + +ENA ++Y+ Q  E  VV +AYK + N +   K  L++
Sbjct:   24 SVTNTMDSIQSLSSWCIENKKYHSTVVHHWLKWFRRSGFGHRLNLFYLANDVIQNCKRKNAIVYREAFAEVLPEAASLVKDASVAKSVERIFKIWEERNVYQEDVIANFRSSLNKSMKDGSSGKRSRSSRPKPEKVQEAPPVTPKAALKSKIVAEFRPQKLIDDLQVYKRSVDNVK--LKEQQLSNMRVDVCST-ETLKRLKDKAGGKKFSKDFEEASAKLEEFVGLLEKQVRNGPPLTEALENAGIFYEAQYREVKVVVNAYKTFANRVNNLKKKLDQ 299          
BLAST of CID domain-containing protein vs. Ensembl Xenopus
Match: znf420 (zinc finger protein 420 [Source:NCBI gene;Acc:549148])

HSP 1 Score: 75.8702 bits (185), Expect = 1.415e-13
Identity = 72/257 (28.02%), Postives = 104/257 (40.47%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSCIEGLPEG-------RKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNR----C--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PYSC++C K F ++S+L +HL VH++++P+ C  C K F     L TH+                     S   L  H K+H  E S HC  C K F     L+  L  H +EK  A   C +            R   GE   S T       Q     +   +  + +KL  C  C   F       +H  + +K +K+H       C  C K F  +S  + H Q VH +   Y C++C   F  +SS V H +
Sbjct:  138 PYSCTVCGKRFTQSSSLARHLRVHSEVKPFMCTDCGKSFSQNSHLVTHQRIHTGERPYSCNECGKSFSGSSN--LVKHKKVHAGEKSWHCPGCGKSFTCSSQLRTHLRVHTNEKPYACEICGKCFSSSSNLVTHQRVHTGERPYSCTECGKRFTQSSSLVVHWRVHTV-EKLFTCSDCGKSF-------SHNSLLIKHQKTHTEERPYVCMECGKGFTGSSALVRH-QRVHTEERPYTCSECGKRFKDKSSLVRHSR 383          
BLAST of CID domain-containing protein vs. Ensembl Xenopus
Match: sulf2 (sulfatase 2 [Source:Xenbase;Acc:XB-GENE-950465])

HSP 1 Score: 72.4034 bits (176), Expect = 3.078e-12
Identity = 63/241 (26.14%), Postives = 91/241 (37.76%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            P+ C +C KGF+   NL  H ++HT  +P+ CP+C +RF  + +L  H+                    +S   LR+H ++H  E    CKVC K F  +++L RH            E +  G KP                                    C  C   F+ K     HF V  K EK    R C K+F   S    H Q +H     + C +C   F+ + S   HQK+
Sbjct:  414 PFICPVCGKGFSEKCNLYNHQTIHTGEKPFMCPECGERFSRKSTLSIHKNVHTGEKPFTCPECGKNFSQKSN--LRSHQRIHTGEKPFSCKVCGKSFYEKKNLHRH------------EAIHTGEKP----------------------------------YICSHCGKGFSDKGALHTHFRVHTK-EKPFPCRECGKSFTQKSNLQIH-QRIHTGQKPFICTECGDCFSVKISLQKHQKT 604          
BLAST of CID domain-containing protein vs. Ensembl Xenopus
Match: znf180 (uncharacterized LOC100158477 [Source:Xenbase;Acc:XB-GENE-956056])

HSP 1 Score: 71.2478 bits (173), Expect = 5.414e-12
Identity = 75/258 (29.07%), Postives = 105/258 (40.70%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSCIEG------------LPEGRKPAG--ELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            Y+C+ C KGFNR+S+L +H  +H   RPY C KC K F     L  H+ T   +  K   C  C K    ++ L  H + H  E    C  C KGF    +L   L  H  EK  + + C +             +  G  P G  E   S T             +K       +K   C  C   F  K+   NH       E+ +  R C K+F  +S  + H Q +H     Y C +C   F+Q S+ VNHQ++
Sbjct:  191 YTCTECGKGFNRSSHLLRHKRIHIGERPYFCGKCGKSFIDSSQLVIHKRTH--TGEKPYACSDCEKSFICKLHLVRHQRSHTGERPYVCSKCGKGFAQSSNLLTHLRTHTGEKPYSCAQCGKSFIRRSHVIRHQRIHTGEGPYGCTECGKSFTESSAL--------LKHQRTHTGEKPYACTQCPKSFMDKSALANHQ-RTHTGERPYPCRDCGKSFSHSSALVKH-QRIHTGEKPYACGKCEKSFSQTSALVNHQRT 436          

HSP 2 Score: 58.9214 bits (141), Expect = 4.053e-8
Identity = 65/241 (26.97%), Postives = 85/241 (35.27%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            PY CS C KGF ++SNL  HL  HT  +PY C +C K F  R  +  H+                     S  AL  H + H  E    C  C K F  +  L+ H    H           E   P  +   S +H            +K       +K   C  C   F+  +   NH       EK      C K F  TS  + H Q  H     Y C++C   F   S  V HQ++
Sbjct:  274 PYVCSKCGKGFAQSSNLLTHLRTHTGEKPYSCAQCGKSFIRRSHVIRHQRIHTGEGPYGCTECGKSFTESS--ALLKHQRTHTGEKPYACTQCPKSFMDKSALANH-QRTHTG---------ERPYPCRDCGKSFSHSSAL--------VKHQRIHTGEKPYACGKCEKSFSQTSALVNHQ-RTHTGEKPFACTDCGKCFTQTSSLVKH-QRTHTGERPYTCSECGKSFTYSSVLVKHQRT 492          
BLAST of CID domain-containing protein vs. Ensembl Xenopus
Match: znf593 (zinc finger protein 593 [Source:Xenbase;Acc:XB-GENE-1217394])

HSP 1 Score: 70.0922 bits (170), Expect = 1.616e-11
Identity = 63/250 (25.20%), Postives = 99/250 (39.60%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEG-----RKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            P+SCS C K F  +S L  H   HT  +P+ C +C KRF HR +   HE T                   S++ +  H ++H  E    C  C K F+   +L+     H  EK  + S C +          R      + S +             +   I    +K   CL C   F+T +K   H       EK +    C K F ++S    H Q +H     ++C++C   F+  S++ +HQ++
Sbjct:  216 PFSCSECGKCFTTSSELTVHQRTHTGEKPFACCECGKRFLHRSNCTRHERTHTGEKPFSCSECGKCVATSSELTV--HRRIHTGEKPFSCSECGKSFNTSSELTNHRRTHTGEKPYSCSECGKCFARNFDKHLRTHKRTKTFSCSECGKCFTSSSDLTVHHRI-HTGEKAFSCLECGKCFSTSSKCIIHRRRTHTGEKPYSCSECGKCFATSSNLKAH-QRIHRSKYNFSCSECGKCFSDRSNFAHHQRT 461          

HSP 2 Score: 56.225 bits (134), Expect = 2.829e-7
Identity = 65/255 (25.49%), Postives = 94/255 (36.86%), Query Frame = 3
Query: 2841 LLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGL-------PEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
             LS  YSC+ CHK F+   +  +HL  H + +P+ CP+C K F HR +L  H+ T                L RS      H + H  E    C  C K F    +L+     H  EK  A   C +            R   GE   S +          +  +   I    +K   C  C   FNT ++  NH       EK +    C K F     F  H++  H +   ++C++C   F   S    H +
Sbjct:  128 TLSGKYSCNECHKHFSNKRDFDKHLRTHKREKPFSCPECGKCFSHRSNLARHQQTHTGEKPFACCECGKRFLHRSNCT--RHERTHTGEKPFSCSECGKCFTTSSELTVHQRTHTGEKPFACCECGKRFLHRSNCTRHERTHTGEKPFSCSECGKCVATSSELTVHRRI-HTGEKPFSCSECGKSFNTSSELTNHR-RTHTGEKPYSCSECGKCF--ARNFDKHLR-THKRTKTFSCSECGKCFTSSSDLTVHHR 375          
BLAST of CID domain-containing protein vs. Ensembl Mouse
Match: Rprd2 (regulation of nuclear pre-mRNA domain containing 2 [Source:MGI Symbol;Acc:MGI:1922387])

HSP 1 Score: 87.8113 bits (216), Expect = 7.169e-17
Identity = 70/249 (28.11%), Postives = 128/249 (51.41%), Query Frame = 3
Query:  111 IQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSN---FKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            IQ  S +  +  K    +V  W + L  +    +++LFY+AN+++Q  N    N   F++S+   L  +   +K+ SV++ I R+F IW +R VY +  I  L   L S+ +P    ++K I+  F  +  I +L    + E+++   LK    S +  D  S  E +K LKDK    +FS + +   ++L +  + +++++K   S  + +ENA ++Y+ Q  E  VV +AYK + N +   K  L++
Sbjct:    2 IQGLSSWCIENKKHHSTIVYHWMKWLRRSTYPHRLNLFYLANDVIQ--NCKRKNAIIFRESFADVLPEAAALVKDPSVSKSIERIFKIWEDRNVYPEDMIVALREALTST-NPKAALKSK-IVAEFRSQALIEELLMYKRSEDQIE--LKEKQLSTMRVDVCST-ETLKCLKDKTGGKKFSKEFEEASSKLEEFVNGLDKQVKNGPSLTEALENAGIFYEAQYKEVKVVANAYKTFANRVNNLKKKLDQ 243          
BLAST of CID domain-containing protein vs. Ensembl Mouse
Match: Rprd2 (regulation of nuclear pre-mRNA domain containing 2 [Source:MGI Symbol;Acc:MGI:1922387])

HSP 1 Score: 82.4185 bits (202), Expect = 1.150e-15
Identity = 69/279 (24.73%), Postives = 136/279 (48.75%), Query Frame = 3
Query:   87 TISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQS-RNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASS-------RSPINEEETKN-----------------IILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            +++ T  SIQ  S +  +  K    +V  W + L  +    +++LFY+AN+++Q+ +   +  F++S+   L  +   +K+ SV++ I R+F IW +R VY +  I  L   L+++       +  +N++  K                  I+  F  +  I +L    + E+++   LK    S +  D  S  E +K LKDK    +FS + +   ++L +  + +++++K   S  + +ENA ++Y+ Q  E  VV +AYK + N +   K  L++
Sbjct:   33 SVTNTMESIQGLSSWCIENKKHHSTIVYHWMKWLRRSTYPHRLNLFYLANDVIQNCKRKNAIIFRESFADVLPEAAALVKDPSVSKSIERIFKIWEDRNVYPEDMIVALREALSTTFKTQKQLKENLNKQPNKQWKKSQTSTNPKAALKSKIVAEFRSQALIEELLMYKRSEDQIE--LKEKQLSTMRVDVCST-ETLKCLKDKTGGKKFSKEFEEASSKLEEFVNGLDKQVKNGPSLTEALENAGIFYEAQYKEVKVVANAYKTFANRVNNLKKKLDQ 308          
BLAST of CID domain-containing protein vs. Ensembl Mouse
Match: Rprd2 (regulation of nuclear pre-mRNA domain containing 2 [Source:MGI Symbol;Acc:MGI:1922387])

HSP 1 Score: 78.5666 bits (192), Expect = 4.911e-14
Identity = 74/299 (24.75%), Postives = 138/299 (46.15%), Query Frame = 3
Query:   87 TISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSN---FKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFI----EDLINKLASSRS--------P-------------INEEETKN-----------------IILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            +++ T  SIQ  S +  +  K    +V  W + L  +    +++LFY+AN+++Q  N    N   F++S+   L  +   +K+ SV++ I R+F IW +R VY +  I    E L+++ AS  +        P             +N++  K                  I+  F  +  I +L    + E+++   LK    S +  D  S  E +K LKDK    +FS + +   ++L +  + +++++K   S  + +ENA ++Y+ Q  E  VV +AYK + N +   K  L++
Sbjct:   33 SVTNTMESIQGLSSWCIENKKHHSTIVYHWMKWLRRSTYPHRLNLFYLANDVIQ--NCKRKNAIIFRESFADVLPEAAALVKDPSVSKSIERIFKIWEDRNVYPEDMIVALREALMDRAASHNARLQKLQCFPGTTFKTQKQLKENLNKQPNKQWKKSQTSTNPKAALKSKIVAEFRSQALIEELLMYKRSEDQIE--LKEKQLSTMRVDVCST-ETLKCLKDKTGGKKFSKEFEEASSKLEEFVNGLDKQVKNGPSLTEALENAGIFYEAQYKEVKVVANAYKTFANRVNNLKKKLDQ 326          
BLAST of CID domain-containing protein vs. Ensembl Mouse
Match: Zfp112 (zinc finger protein 112 [Source:MGI Symbol;Acc:MGI:1929115])

HSP 1 Score: 74.3294 bits (181), Expect = 7.185e-13
Identity = 71/241 (29.46%), Postives = 99/241 (41.08%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            PY C  C KGF++AS L  H  VHT  +PYQC +C K F  +  L++H++    S  +   C +C K    +  L+ HL++H R     C+VC KGF     L  H            + +  GRKP    + +         Q  Q+  +E  P       KC  C   F+  +    H  V    EK +    C K F   S    H Q VH     Y C  C   F   S  + HQ++
Sbjct:  628 PYKCGECGKGFSKASTLLAHERVHTGEKPYQCHECGKNFSQKSYLQSHQSVH--SGERPHICEVCGKGFSQRAYLQGHLRVHTRVKPYKCEVCGKGFSQGSRLEAH------------QRVHTGRKPFKCETCTKGFSESSRLQAHQRIHEEGRP------YKCDQCGKGFSGYSSLQAHHRV-HTGEKPYKCEVCGKGFSQRSNLQAH-QRVHTGEKPYTCDACGKGFRWSSGLLIHQRA 846          

HSP 2 Score: 67.781 bits (164), Expect = 7.607e-11
Identity = 65/244 (26.64%), Postives = 93/244 (38.11%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKG----FDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY C  C KGF+R++ LQ H  VHT  +PY+C +C K F    S  +H                          L+ H ++H  E    C+ C KG    F+LQ     H  EK      C +G           S + T   H      +KP             +C  C   F+ K+   +H  V    E+ H+   C K F   +    H++ VH ++  Y C  C   F+Q S    HQ+
Sbjct:  544 PYKCEECGKGFSRSAYLQGHQRVHTGEKPYKCEECGKGF----SRSSH--------------------------LQGHQRVHTGEKPYKCEECGKGFSWSFNLQIHQRVHTGEKPYKCGECGKG----------FSKASTLLAHERVHTGEKP------------YQCHECGKNFSQKSYLQSHQSV-HSGERPHICEVCGKGFSQRAYLQGHLR-VHTRVKPYKCEVCGKGFSQGSRLEAHQR 733          

HSP 3 Score: 64.3142 bits (155), Expect = 8.508e-10
Identity = 64/250 (25.60%), Postives = 90/250 (36.00%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFD----LQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNR------CCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY C  C KGF+R+S+LQ H  VHT  +PY+C +C K F    +L+ H+                     S   L  H ++H  E    C  C K F     LQ   S H  E+      C +G  +     G L                            K  KC  C   F+  ++ + H       ++ H  R       C K F  +S+   H Q +H +   Y C QC   F+  SS   H +
Sbjct:  572 PYKCEECGKGFSRSSHLQGHQRVHTGEKPYKCEECGKGFSWSFNLQIHQRVHTGEKPYKCGECGKGFSKAS--TLLAHERVHTGEKPYQCHECGKNFSQKSYLQSHQSVHSGERPHICEVCGKGFSQRAYLQGHLRVHTRV----------------------KPYKCEVCGKGFSQGSRLEAH-------QRVHTGRKPFKCETCTKGFSESSRLQAH-QRIHEEGRPYKCDQCGKGFSGYSSLQAHHR 789          

HSP 4 Score: 54.6842 bits (130), Expect = 8.795e-7
Identity = 28/57 (49.12%), Postives = 33/57 (57.89%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVT 3023
            PY C +C KGF++ SNLQ H  VHT  +PY C  C K FR    L  H+   HSS T
Sbjct:  796 PYKCEVCGKGFSQRSNLQAHQRVHTGEKPYTCDACGKGFRWSSGLLIHQRA-HSSDT 851          
BLAST of CID domain-containing protein vs. Ensembl Mouse
Match: Zfp112 (zinc finger protein 112 [Source:MGI Symbol;Acc:MGI:1929115])

HSP 1 Score: 74.3294 bits (181), Expect = 7.317e-13
Identity = 71/241 (29.46%), Postives = 99/241 (41.08%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            PY C  C KGF++AS L  H  VHT  +PYQC +C K F  +  L++H++    S  +   C +C K    +  L+ HL++H R     C+VC KGF     L  H            + +  GRKP    + +         Q  Q+  +E  P       KC  C   F+  +    H  V    EK +    C K F   S    H Q VH     Y C  C   F   S  + HQ++
Sbjct:  630 PYKCGECGKGFSKASTLLAHERVHTGEKPYQCHECGKNFSQKSYLQSHQSVH--SGERPHICEVCGKGFSQRAYLQGHLRVHTRVKPYKCEVCGKGFSQGSRLEAH------------QRVHTGRKPFKCETCTKGFSESSRLQAHQRIHEEGRP------YKCDQCGKGFSGYSSLQAHHRV-HTGEKPYKCEVCGKGFSQRSNLQAH-QRVHTGEKPYTCDACGKGFRWSSGLLIHQRA 848          

HSP 2 Score: 67.781 bits (164), Expect = 7.615e-11
Identity = 65/244 (26.64%), Postives = 93/244 (38.11%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKG----FDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY C  C KGF+R++ LQ H  VHT  +PY+C +C K F    S  +H                          L+ H ++H  E    C+ C KG    F+LQ     H  EK      C +G           S + T   H      +KP             +C  C   F+ K+   +H  V    E+ H+   C K F   +    H++ VH ++  Y C  C   F+Q S    HQ+
Sbjct:  546 PYKCEECGKGFSRSAYLQGHQRVHTGEKPYKCEECGKGF----SRSSH--------------------------LQGHQRVHTGEKPYKCEECGKGFSWSFNLQIHQRVHTGEKPYKCGECGKG----------FSKASTLLAHERVHTGEKP------------YQCHECGKNFSQKSYLQSHQSV-HSGERPHICEVCGKGFSQRAYLQGHLR-VHTRVKPYKCEVCGKGFSQGSRLEAHQR 735          

HSP 3 Score: 64.3142 bits (155), Expect = 8.737e-10
Identity = 64/250 (25.60%), Postives = 90/250 (36.00%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFD----LQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNR------CCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY C  C KGF+R+S+LQ H  VHT  +PY+C +C K F    +L+ H+                     S   L  H ++H  E    C  C K F     LQ   S H  E+      C +G  +     G L                            K  KC  C   F+  ++ + H       ++ H  R       C K F  +S+   H Q +H +   Y C QC   F+  SS   H +
Sbjct:  574 PYKCEECGKGFSRSSHLQGHQRVHTGEKPYKCEECGKGFSWSFNLQIHQRVHTGEKPYKCGECGKGFSKAS--TLLAHERVHTGEKPYQCHECGKNFSQKSYLQSHQSVHSGERPHICEVCGKGFSQRAYLQGHLRVHTRV----------------------KPYKCEVCGKGFSQGSRLEAH-------QRVHTGRKPFKCETCTKGFSESSRLQAH-QRIHEEGRPYKCDQCGKGFSGYSSLQAHHR 791          

HSP 4 Score: 54.6842 bits (130), Expect = 8.952e-7
Identity = 28/57 (49.12%), Postives = 33/57 (57.89%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVT 3023
            PY C +C KGF++ SNLQ H  VHT  +PY C  C K FR    L  H+   HSS T
Sbjct:  798 PYKCEVCGKGFSQRSNLQAHQRVHTGEKPYTCDACGKGFRWSSGLLIHQRA-HSSDT 853          
BLAST of CID domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5VT52|RPRD2_HUMAN (Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.403e-14
Identity = 70/281 (24.91%), Postives = 135/281 (48.04%), Query Frame = 3
Query:   87 TISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSN---FKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASS-------RSPINEEETKN-----------------IILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            +++ T  SIQ  S +  +  K    +V  W + L  +    +++LFY+AN+++Q  N    N   F++S+   L  +   +K+ SV++ + R+F IW +R VY +  I  L   L+++       +  +N++  K                  I+  F  +  I +L    + E+++   LK    S +  D  S  E +K LKDK    +FS + +   ++L +  + +++++K   S  + +ENA ++Y+ Q  E  VV +AYK + N +   K  L++
Sbjct:   33 SVTNTMESIQGLSSWCIENKKHHSTIVYHWMKWLRRSAYPHRLNLFYLANDVIQ--NCKRKNAIIFRESFADVLPEAAALVKDPSVSKSVERIFKIWEDRNVYPEEMIVALREALSTTFKTQKQLKENLNKQPNKQWKKSQTSTNPKAALKSKIVAEFRSQALIEELLLYKRSEDQIE--LKEKQLSTMRVDVCST-ETLKCLKDKTGGKKFSKEFEEASSKLEEFVNGLDKQVKNGPSLTEALENAGIFYEAQYKEVKVVANAYKTFANRVNNLKKKLDQ 308          
BLAST of CID domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6NXI6|RPRD2_MOUSE (Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rprd2 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.435e-13
Identity = 74/299 (24.75%), Postives = 138/299 (46.15%), Query Frame = 3
Query:   87 TISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSN---FKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFI----EDLINKLASSRS--------P-------------INEEETKN-----------------IILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            +++ T  SIQ  S +  +  K    +V  W + L  +    +++LFY+AN+++Q  N    N   F++S+   L  +   +K+ SV++ I R+F IW +R VY +  I    E L+++ AS  +        P             +N++  K                  I+  F  +  I +L    + E+++   LK    S +  D  S  E +K LKDK    +FS + +   ++L +  + +++++K   S  + +ENA ++Y+ Q  E  VV +AYK + N +   K  L++
Sbjct:   33 SVTNTMESIQGLSSWCIENKKHHSTIVYHWMKWLRRSTYPHRLNLFYLANDVIQ--NCKRKNAIIFRESFADVLPEAAALVKDPSVSKSIERIFKIWEDRNVYPEDMIVALREALMDRAASHNARLQKLQCFPGTTFKTQKQLKENLNKQPNKQWKKSQTSTNPKAALKSKIVAEFRSQALIEELLMYKRSEDQIE--LKEKQLSTMRVDVCST-ETLKCLKDKTGGKKFSKEFEEASSKLEEFVNGLDKQVKNGPSLTEALENAGIFYEAQYKEVKVVANAYKTFANRVNNLKKKLDQ 326          
BLAST of CID domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3MIS6|ZN528_HUMAN (Zinc finger protein 528 OS=Homo sapiens OX=9606 GN=ZNF528 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.567e-12
Identity = 73/243 (30.04%), Postives = 104/243 (42.80%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 3569
            PYSC+ C K F+R S L +H +VHT  +PY+C +C K F  R SL TH+     +  K  +C  C K+   +  L +H ++H RE    C  C K F  + DL R    H DEK    + C     E         S +T                 +    +K  +C  C  +F  K+   +H  +    +    NR C K F  +S  + H Q++H     Y C QC  +F Q S    HQ
Sbjct:  324 PYSCNKCGKVFSRHSYLAEHQTVHTGEKPYKCEECGKAFSVRSSLITHQLI--HTGRKPYKCKECDKVFGRKCFLTSHQRIHTRERPYGCSQCGKIFSQKSDLIRHRKTHTDEKPYKCNKCGTAFRE--------FSDLTA--------------HFLIHSGEKPYECKECGKVFRYKSSLTSHHRIHTGEKPYKCNR-CGKVFSRSSNLVCH-QKIHTGEKPYKCNQCGKVFNQASYLTRHQ 540          

HSP 2 Score: 61.2326 bits (147), Expect = 4.666e-8
Identity = 38/106 (35.85%), Postives = 54/106 (50.94%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 3170
            PY C+ C K FN+AS L +H  +HT  RPY+C KC K FR    L  H A      +   +    +   +S  +L NH ++H+ E    C +C K F    DL++H
Sbjct:  520 PYKCNQCGKVFNQASYLTRHQIIHTGERPYRCSKCGKAFRGCSGLTAHLAIHTEKKSHECKECGKIFTQKS--SLTNHHRIHIGEKPYKCTLCSKVFSHNSDLAQH 623          

HSP 3 Score: 60.077 bits (144), Expect = 1.079e-7
Identity = 61/242 (25.21%), Postives = 90/242 (37.19%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVA-LRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            PY C  C K F+  SNL QH  +HT  +PY+C +C K FR    L  H+        +          + +Q+A L  H K+H  E    C  C K F     L+ H            + +  G KP                                   KC  C   F+ ++    H  +     K +  + CDK F     FL   Q +H +   Y C+QC  +F+Q+S  + H+K+
Sbjct:  240 PYKCHECGKLFSSNSNLSQHQRIHTGEKPYKCHECDKVFRSSSKLAQHQRI---HTGEKPYKCHECDKVFNQIAHLVRHQKIHTGEKPYSCNKCGKVFSRHSYLAEH------------QTVHTGEKP----------------------------------YKCEECGKAFSVRSSLITHQLIHT-GRKPYKCKECDKVFGRKC-FLTSHQRIHTRERPYGCSQCGKIFSQKSDLIRHRKT 430          
BLAST of CID domain-containing protein vs. UniProt/SwissProt
Match: sp|P51523|ZNF84_HUMAN (Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 5.050e-12
Identity = 72/245 (29.39%), Postives = 100/245 (40.82%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            PY CS C K F + S+L  H   HT  +PY+C +C K F  + SL TH+ T         R        +SQ  L  H ++H  E    C +C K F  + +L RH+     EK    + C       RK   E SS I H                     +K  +C  C   F+ K+    H       EK +    C K F   SQ + H Q +H     Y C +C   F+Q+S  +NHQ++
Sbjct:  514 PYVCSECGKAFCQKSHLISHQRTHTGEKPYECSECGKAFGEKSSLATHQRTHTGEKPYECRDCEKAFSQKSQ--LNTHQRIHTGEKPYECSLCRKAFFEKSELIRHLRTHTGEKPYECNEC-------RKAFREKSSLINHQRI---------------HTGEKPFECSECGKAFSRKSHLIPHQRTHT-GEKPYGCSECRKAFSQKSQLVNH-QRIHTGEKPYRCIECGKAFSQKSQLINHQRT 732          

HSP 2 Score: 66.2402 bits (160), Expect = 1.606e-9
Identity = 69/253 (27.27%), Postives = 101/253 (39.92%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSI------TXXXXXXXXXXXKPIKEVIPEI-------PKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY+CS C K F++ S L  H   HT  +PY+C +C K F  +  L +H  T                  +S   L NH ++H  E    C+ C K F  +  L  H    H  +     G  + RK   E S  I      T    Y   + +K  +E    I        +K   C+ C   F+ K+   +H  +    EK  +   C K F   SQ + H Q  H     Y C++C   F+++ S  NHQ+
Sbjct:  262 PYNCSQCGKAFSQKSQLTSHQRTHTGEKPYECGECGKAFSRKSHLISHWRTHTGEKPYGCNECGRAFSEKSN--LINHQRIHTGEKPFECRECGKAFSRKSQLVTH-HRTHTGTKPF--GCSDCRKAFFEKSELIRHQTIHTGEKPYECSECRKAFRERSSLINHQRTHTGEKPHGCIQCGKAFSQKSHLISHQ-MTHTGEKPFICSKCGKAFSRKSQLVRH-QRTHTGEKPYECSECGKAFSEKLSLTNHQR 507          

HSP 3 Score: 65.0846 bits (157), Expect = 3.642e-9
Identity = 66/257 (25.68%), Postives = 99/257 (38.52%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDL----SRHVDEKHAASSSCIEGLPE------------GRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            PY C+ C + F+  SNL  H  +HT  +P++C +C K F  +  L TH  T   + TK   C  C K    +  L  H  +H  E    C  C K F  +  L      H  EK      C +   +            G KP       I         ++ + ++       +K  +C  C   F+ K    NH  +    EK ++   C K F   S  + H Q  H     Y C++C   F ++SS   HQ++
Sbjct:  318 PYGCNECGRAFSEKSNLINHQRIHTGEKPFECRECGKAFSRKSQLVTHHRT--HTGTKPFGCSDCRKAFFEKSELIRHQTIHTGEKPYECSECRKAFRERSSLINHQRTHTGEKPHGCIQCGKAFSQKSHLISHQMTHTGEKPF------ICSKCGKAFSRKSQLVRHQRTHTGEKPYECSECGKAFSEKLSLTNHQRIHT-GEKPYVCSECGKAFCQKSHLISH-QRTHTGEKPYECSECGKAFGEKSSLATHQRT 564          

HSP 4 Score: 63.929 bits (154), Expect = 7.082e-9
Identity = 66/256 (25.78%), Postives = 97/256 (37.89%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPE------------GRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            P+ CS C K F+R S L +H   HT  +PY+C +C K F  + SL  H+         +          +S   L +H + H  E    C  C K F  +  L+     H  EK      C +   +            G KP      S+     +   +  + ++    E P    +C  C   F  K+   NH  +    EK      C K F   S  + H Q  H     Y C++C   F+Q+S  VNHQ+
Sbjct:  458 PFICSKCGKAFSRKSQLVRHQRTHTGEKPYECSECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQKSH--LISHQRTHTGEKPYECSECGKAFGEKSSLATHQRTHTGEKPYECRDCEKAFSQKSQLNTHQRIHTGEKP---YECSLCRKAFFEKSELIRHLRTHTGEKP---YECNECRKAFREKSSLINHQRIHT-GEKPFECSECGKAFSRKSHLIPH-QRTHTGEKPYGCSECRKAFSQKSQLVNHQR 703          
BLAST of CID domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0VAW7|ZN112_MOUSE (Zinc finger protein 112 OS=Mus musculus OX=10090 GN=Znf112 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 5.175e-12
Identity = 71/241 (29.46%), Postives = 99/241 (41.08%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            PY C  C KGF++AS L  H  VHT  +PYQC +C K F  +  L++H++    S  +   C +C K    +  L+ HL++H R     C+VC KGF     L  H            + +  GRKP    + +         Q  Q+  +E  P       KC  C   F+  +    H  V    EK +    C K F   S    H Q VH     Y C  C   F   S  + HQ++
Sbjct:  634 PYKCGECGKGFSKASTLLAHERVHTGEKPYQCHECGKNFSQKSYLQSHQSVH--SGERPHICEVCGKGFSQRAYLQGHLRVHTRVKPYKCEVCGKGFSQGSRLEAH------------QRVHTGRKPFKCETCTKGFSESSRLQAHQRIHEEGRP------YKCDQCGKGFSGYSSLQAHHRV-HTGEKPYKCEVCGKGFSQRSNLQAH-QRVHTGEKPYTCDACGKGFRWSSGLLIHQRA 852          

HSP 2 Score: 67.781 bits (164), Expect = 5.522e-10
Identity = 65/244 (26.64%), Postives = 93/244 (38.11%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKG----FDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY C  C KGF+R++ LQ H  VHT  +PY+C +C K F    S  +H                          L+ H ++H  E    C+ C KG    F+LQ     H  EK      C +G           S + T   H      +KP             +C  C   F+ K+   +H  V    E+ H+   C K F   +    H++ VH ++  Y C  C   F+Q S    HQ+
Sbjct:  550 PYKCEECGKGFSRSAYLQGHQRVHTGEKPYKCEECGKGF----SRSSH--------------------------LQGHQRVHTGEKPYKCEECGKGFSWSFNLQIHQRVHTGEKPYKCGECGKG----------FSKASTLLAHERVHTGEKP------------YQCHECGKNFSQKSYLQSHQSV-HSGERPHICEVCGKGFSQRAYLQGHLR-VHTRVKPYKCEVCGKGFSQGSRLEAHQR 739          

HSP 3 Score: 64.3142 bits (155), Expect = 6.554e-9
Identity = 64/250 (25.60%), Postives = 90/250 (36.00%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFD----LQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNR------CCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY C  C KGF+R+S+LQ H  VHT  +PY+C +C K F    +L+ H+                     S   L  H ++H  E    C  C K F     LQ   S H  E+      C +G  +     G L                            K  KC  C   F+  ++ + H       ++ H  R       C K F  +S+   H Q +H +   Y C QC   F+  SS   H +
Sbjct:  578 PYKCEECGKGFSRSSHLQGHQRVHTGEKPYKCEECGKGFSWSFNLQIHQRVHTGEKPYKCGECGKGFSKAS--TLLAHERVHTGEKPYQCHECGKNFSQKSYLQSHQSVHSGERPHICEVCGKGFSQRAYLQGHLRVHTRV----------------------KPYKCEVCGKGFSQGSRLEAH-------QRVHTGRKPFKCETCTKGFSESSRLQAH-QRIHEEGRPYKCDQCGKGFSGYSSLQAHHR 795          

HSP 4 Score: 54.6842 bits (130), Expect = 6.271e-6
Identity = 28/57 (49.12%), Postives = 33/57 (57.89%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVT 3023
            PY C +C KGF++ SNLQ H  VHT  +PY C  C K FR    L  H+   HSS T
Sbjct:  802 PYKCEVCGKGFSQRSNLQAHQRVHTGEKPYTCDACGKGFRWSSGLLIHQRA-HSSDT 857          
BLAST of CID domain-containing protein vs. TrEMBL
Match: A0A2L2Y4Q2 (Regulation of nuclear pre-mRNA domain-containing protein 2 (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.173e-28
Identity = 77/255 (30.20%), Postives = 141/255 (55.29%), Query Frame = 3
Query:   87 TISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQ-SRNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            T + T  SIQ  S ++         +V  W + L  A  + +++LFY+AN+++Q S+  G   F  S+   L  +   +++ S+   I R+FNIW +R VY   FI DL   LA+S+ P +      ++  F P+  I K++N+ K++ E+++ +K ++ S L   + +  E +++ KD++H  +F    D ++ +L ++  L+E+E+  R   + ++E +E+YY TQ  E  +V +AYK +G  I K +  LEE
Sbjct:   10 TATNTQDSIQTLSLWVLHHKAHHQKIVGSWMKVLQKAKISHRLTLFYLANDVVQNSKRKGFLQFVNSFAEVLREATLLVRDDSIRPSIQRVFNIWEQRNVYTPEFIADLRAILANSKVPASA--PAKLLAQFKPDSVINKIRNVSKLDVEIDKKMKSINLSKL---KATDAEIVQQFKDRIHGQKFKRDFDDSVTRLEELIKLLEKEMTERAELILLLEQSEIYYDTQKGEAKIVANAYKNFGARIDKLQKKLEE 259          
BLAST of CID domain-containing protein vs. TrEMBL
Match: C3YQX8 (CID domain-containing protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_281321 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.392e-25
Identity = 75/249 (30.12%), Postives = 137/249 (55.02%), Query Frame = 3
Query:  108 SIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQ-SRNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEEH 851
            SIQ  S ++     S   +V LW + L  +    K++L Y+ N++LQ  R  G++ + +S+K+ L  +    ++SS+ + + R+FNIW ER VY+  FI  L   L SS+    +  TK ++  F P+  I  + +  ++E++V    ++   S L  D  S  E +K+LKD+    +FS + D    +L +    M+++L  R+  ++++E AE++Y TQ SE  +V +AYK +G  I+  K  ++++
Sbjct:   22 SIQTLSLWIVHHKSSHQQIVQLWMKQLRKSKPPEKLNLMYLCNDVLQNGRRKGATAYNESFKTVLVEAASLTRDSSIRKSVDRIFNIWEERSVYDSDFITQLKGALVSSKVRPKKVNTK-VLAEFKPQKLIDSISSFKRLEDDV--IFRQQQFSQLRVDVTSS-ETLKQLKDRQGGKKFSEEFDEATEKLEEFVKSMDKQLAERKKMVELVEQAEIFYSTQHSEAKIVANAYKNFGTRISNFKKRIDQY 266          
BLAST of CID domain-containing protein vs. TrEMBL
Match: A0A2P8XML5 (Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Blattella germanica OX=6973 GN=RPRD2 PE=4 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.453e-25
Identity = 65/247 (26.32%), Postives = 133/247 (53.85%), Query Frame = 3
Query:  108 SIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            SI   S +  Q  +    +V+ W + L       +++LFY+AN+++Q     +  F +SW + +  +   ++   V  +++R+F IW ER +Y+++FI DL   L+++    N E   +   +F P   I K+++  K+E++ +  LKR++ S L+F +     +   LKD+   ++   ++D  + ++    + +E E+K R + ++++E AE +Y+ Q  E  VV +AY+ +G+ +   K  L+E
Sbjct:   22 SIMSLSSWCLQHRQHHKKIVASWLRILKKVKIEHRLTLFYLANDVIQYSKRKNYEFVESWGTAIQRATTMVREDKVKHRVLRIFKIWDERGIYDEAFISDLSGLLSTNTKKTNNEAVHDTS-DFQPPTLINKIRSCKKLEDDTDLKLKRLNESHLSFTDTDALRS--HLKDRRQGDDLVAEVDEGVTKMTGFVAALELEIKERNALIELLEQAENFYEIQKGEAKVVANAYRNFGSRVKNLKRRLDE 265          
BLAST of CID domain-containing protein vs. TrEMBL
Match: A0A1B6E4C6 (CID domain-containing protein OS=Clastoptera arizonana OX=38151 GN=g.28308 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 4.301e-25
Identity = 67/250 (26.80%), Postives = 140/250 (56.00%), Query Frame = 3
Query:   99 TALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            T  SI   S +  Q +     +V+LW Q L       +++LFY+AN+++Q       +F +SW + L  +   +++  V  KI+R+F IW ER +Y+++F+ DL + L SSR+P + ++ +    +F P   I+K+++   +E+E + +LK V    ++    + +  +  LK++ H  +   ++D  + ++ +  S ++ E++ R+  +++++ +E +Y+TQ  E  VV +AY+ +GN +   K  L++
Sbjct:   19 TQESISSLSSWCLQHHHHHKKIVTLWLQNLKKVKIEQRLTLFYLANDVIQYSKRKGYDFVESWGTALQKATTLVRDDKVKNKILRLFKIWDERSIYDEAFLVDL-SGLLSSRAPNSSQDAQ----DFQPSTLISKIRSCKVLEDETDLSLKLVVDCPISL--SNTESLMTSLKERRHSTDVEQEVDDGLEKMNKYISALKTEIEERRQLIELLDMSEAFYETQRGEAKVVCNAYRNFGNRVKTLKKKLDD 261          
BLAST of CID domain-containing protein vs. TrEMBL
Match: A0A087UKP1 (Regulation of nuclear pre-mRNA domain-containing protein 2 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_20094 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 5.370e-25
Identity = 75/255 (29.41%), Postives = 133/255 (52.16%), Query Frame = 3
Query:   87 TISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQ-SRNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            +++ T  SIQ  S ++         +VS W + L  A  + +++LFY+AN+++Q  +  G   F  S+   L  +   +++  +   I R+FNIW +R VY   FI DL   LA+++ P        ++  F PE  I KL++  K+E E    L  ++ S LN    +  E +++LKD++H  +F  + D +   L ++   M  E+K + + + ++E +E+YY TQ  E  +V +AYK +G  +   +  LEE
Sbjct:   16 SVTNTQDSIQTLSLWLLHHKAHHQKIVSSWMKVLQKAKISHRLTLFYLANDVVQNGKRKGFLQFGNSFAEVLREATLLVRDEQIRPSIQRVFNIWEQRNVYSPEFIADLRAILANAKVPATAP--SKLLAQFKPELVIEKLRSTAKLEMETATKLSTINLSKLN---ATNAEIVQQLKDRLHGQQFKREFDESTRCLEELIKSMNSEIKEKTALILLLEQSEIYYDTQRGEAKIVANAYKNFGARVKTLQKKLEE 265          
BLAST of CID domain-containing protein vs. Ensembl Cavefish
Match: rprd2b (regulation of nuclear pre-mRNA domain-containing protein 2-like [Source:NCBI gene;Acc:103023207])

HSP 1 Score: 99.7525 bits (247), Expect = 1.320e-20
Identity = 76/271 (28.04%), Postives = 135/271 (49.82%), Query Frame = 3
Query:   90 ISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSN---FKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSP----INEEET--KNIILNFDPEDTITKLKNLMKIENEVNET-LKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTK---DALEEHLDFL 863
            +S T  SIQ  S +  +  K   +VV  W + L  +  + +++LFY+AN+++Q  N    N   ++ ++   L  +   ++++ V + + R+F IW ER VY +  I +L   L     P    +N +      I+  F P   I   ++L   ++ + E+ L+    +AL  D  S  EA+K+LKDK   N+FS   +    +L +    +E +++     L+ + NAEV+Y+ Q  E  +V +AYK + N ++  K   DAL+  L  L
Sbjct:   34 VSNTMESIQSLSSFCIENKKQHGLVVRCWMKWLKKSDPSHRLNLFYLANDVIQ--NCKRKNAIVYRSAFADVLPGAALLVRDAKVRKSVERIFTIWQERTVYPEELITELKAALHKKEQPPPPTVNPKTALKSKIVAEFAPHALI---ESLAAYKHSMEESELREKQLAALRVDVCST-EALKRLKDKAGGNKFSKDFEEGGMKLQEFVKFLEGQMQAGPPLLEALGNAEVFYEMQYKEVKIVANAYKTFANRVSSLKRKLDALKSTLPDL 298          
BLAST of CID domain-containing protein vs. Ensembl Cavefish
Match: rprd2a (regulation of nuclear pre-mRNA domain-containing protein 2-like [Source:NCBI gene;Acc:103027509])

HSP 1 Score: 89.7373 bits (221), Expect = 1.440e-17
Identity = 70/265 (26.42%), Postives = 128/265 (48.30%), Query Frame = 3
Query:   90 ISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQS-RNFGSSNFKQSWKSQLNPSLEYI---KNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKN--------IILNFDPEDTITKLKNLMKIENEVNET-LKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALE 845
            ++ T  SIQ  S +  +  K   I+V  W + L  +  + +++LFY+AN+++Q+ +   +  ++ ++   L  +++ I   K+S V + + R+ +IW ER VY +  I  L   L     P    +T N        I+  F P   I   + L K    ++ET LK    +A+  D  S   A+KKLKDK     FS   +    +L    + ++ E+K     ++ +ENA+++Y+ Q  E  ++  AY+ + N +   K  L+
Sbjct:   30 VTNTMESIQGLSTWCIENKKHHSIIVRHWIKRLRKSDSSHRLNLFYLANDVIQNCKRKNAIVYRTTFTDVLPEAVKLINSSKDSQVCKSVDRILSIWEERNVYSEELISQLRGSLIQKDEPPAPVQTVNPKAALRSKIVAEFVPSAFI---EQLTKYRKSIDETELKEKQLAAMRVDVCSTT-ALKKLKDKAGGKRFSKDFEDGSKKLQDFVAYLDGEVKKGPPLMEALENADIFYEMQYKEVKIITKAYQTFANRVLHLKRKLD 290          
BLAST of CID domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000018704.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001240.1:31030:34827:-1 gene:ENSAMXG00000018161.2 transcript:ENSAMXT00000018704.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 3.837e-13
Identity = 69/242 (28.51%), Postives = 99/242 (40.91%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY CS C K F   SNL+ H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q +L  H            + +  G KP    +   S T   +          K       +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S+  NHQ+
Sbjct:  414 PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPYHCSDCGKSFTTQSNLK--------KHQRIHTGEKPYYCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 631          

HSP 2 Score: 74.3294 bits (181), Expect = 4.673e-13
Identity = 69/242 (28.51%), Postives = 102/242 (42.15%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY CS C K F   SNL++H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q +L  H            + +  G KP    +   S T   +  + Q+            +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S+  NHQ+
Sbjct:   78 PYHCSDCGKSFTTQSNLKKHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPYHCSDCGKSFTTQSNLKNHQRI--------HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 295          

HSP 3 Score: 74.3294 bits (181), Expect = 5.223e-13
Identity = 69/242 (28.51%), Postives = 102/242 (42.15%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY CS C K FN+ S L+ H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q +L  H            + +  G KP    +   S T   +  + Q+            +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S+  NHQ+
Sbjct:   50 PYHCSDCGKSFNQQSTLKTHQRIHTGEKPYHCSDCGKSFTTQSNLKKHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPYHCSDCGKSFTTQSNLKNHQRI--------HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 267          

HSP 4 Score: 73.9442 bits (180), Expect = 7.049e-13
Identity = 69/242 (28.51%), Postives = 101/242 (41.74%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY CS C K F   SNL+ H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q +L  H            + +  G KP    +   S T   +  + Q+            +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S+  NHQ+
Sbjct:  246 PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPYHCSDCGKSFTTQSNLKNHQRI--------HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 463          

HSP 5 Score: 66.6254 bits (161), Expect = 1.280e-10
Identity = 65/236 (27.54%), Postives = 97/236 (41.10%), Query Frame = 3
Query: 2871 CHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            C K F   SNL+ H  +HT  +PY C  C K F  + +LKTH+     +  K   C  C K   +Q  L+ H ++H  E   HC  C K F  Q +L  H            + +  G KP    +   S T   +  + Q+            +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S+  NHQ+
Sbjct:   28 CGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFNQQSTLKTHQRIH--TGEKPYHCSDCGKSFTTQSNLKKHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPYHCSDCGKSFTTQSNLKNHQRI--------HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 239          

HSP 6 Score: 60.8474 bits (146), Expect = 8.067e-9
Identity = 40/106 (37.74%), Postives = 51/106 (48.11%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 3170
            PY CS C K F   SNL+ H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q  L  H
Sbjct:  554 PYYCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTEEKPYHCSDCGKSFATQSQLKNH 657          
BLAST of CID domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000011094.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000150.1:841156:842598:-1 gene:ENSAMXG00000010805.2 transcript:ENSAMXT00000011094.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 4.406e-13
Identity = 71/247 (28.74%), Postives = 99/247 (40.08%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQE---VHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY CS+C K FNR SNLQQH  +HT  +P+QC +C K F H+C L+ H+                    +S   L +H ++H  E    C VC K F LQ  L      H  EK    S C +G     + AG L                  + + +    +K   C  C   FN       H  +    EK      C K+F    ++L H++E   VH     + C +C   F  + S   HQ+
Sbjct:  169 PYQCSVCGKSFNRQSNLQQHQRIHTGDKPHQCLECGKSFTHKCKLQEHQRIHTGENLYQCSDCGKTCFKKSH--LEDHQRIHTGEKPYQCSVCGKSFALQTTLQIHQRVHTGEKPYHCSECGKGF----RYAGHLK-----------------VHQRV-HTGEKPYHCPECGKSFNYVGNLKEHQRI-HSGEKPFPCTVCGKSF----RYLGHLKEHRRVHTGEKPFQCPECEKSFIAKHSLQIHQR 386          

HSP 2 Score: 63.929 bits (154), Expect = 5.569e-10
Identity = 70/242 (28.93%), Postives = 101/242 (41.74%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAG--ELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            P+ C  C K FNR SNLQ HL VHT  +PYQCP C K F ++ + + H+     +  K  +C  C K  RS   L+ H  +H  E    C VC K F+ Q +L +H            + +  G KP    E   S T         + K  +       + L +C  C      K+  ++H  +    EK +    C K+F   +    H Q VH     Y+C++C   F        HQ+
Sbjct:   85 PFQCPDCGKTFNRQSNLQLHLRVHTGEKPYQCPDCGKSFTYQSNFQQHQRV--HTGEKPHQCSECGKSFRSLGNLKGHQLVHRGETPYQCSVCGKSFNRQSNLQQH------------QRIHTGDKPHQCLECGKSFT--------HKCKLQEHQRIHTGENLYQCSDCGKTCFKKSHLEDHQRIHT-GEKPYQCSVCGKSFALQTTLQIH-QRVHTGEKPYHCSECGKGFRYAGHLKVHQR 302          

HSP 3 Score: 52.373 bits (124), Expect = 2.384e-6
Identity = 67/252 (26.59%), Postives = 93/252 (36.90%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIE-----GLPEGRKPA--GELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            + CS C K FNR SNLQ H  +HT  +P+QCP C K F                                Q  L+ HL++H  E    C  C K F  Q +  +    H  EK    S C +     G  +G +    GE     +      ++Q      + I     K  +CL C   F  K K   H  +       +L +C  C KT    S    H Q +H     Y C+ C   FA +++   HQ+
Sbjct:   58 FQCSECGKSFNRQSNLQAHQRIHTGEKPFQCPDCGKTF------------------------------NRQSNLQLHLRVHTGEKPYQCPDCGKSFTYQSNFQQHQRVHTGEKPHQCSECGKSFRSLGNLKGHQLVHRGETPYQCSVCGKSFNRQSNLQQHQRI-HTGDKPHQCLECGKSFTHKCKLQEHQRI---HTGENLYQCSDCGKTCFKKSHLEDH-QRIHTGEKPYQCSVCGKSFALQTTLQIHQR 274          
BLAST of CID domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000042131.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001240.1:32472:51936:1 gene:ENSAMXG00000032457.1 transcript:ENSAMXT00000042131.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 4.998e-13
Identity = 72/242 (29.75%), Postives = 102/242 (42.15%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY CS C K FN+ S+LQ H  +HT  + Y C  C KRF  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   +C  C K F+ Q     H            + +  G KP    +   S T         Q K  K       +K   C  C   F T++K  NH  +    EK +    C K+F + S+   H Q +H     Y+C+ C   F  +S   NHQ+
Sbjct:   50 PYHCSDCGKSFNQGSHLQIHQRIHTGEKTYHCSDCGKRFIEQSTLKRHQRI--HTGEKPYYCSDCGKSFTTQSQLKNHQRIHTGEKPYYCSDCGKSFNQQSTFQIH------------QRIHTGEKPYYCSDCGKSFT--------TQSKLKKHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRIHT-GEKPYYCSDCGKSFTTQSKLKNH-QRIHTGEKPYHCSDCGKSFTTQSKLKNHQR 267          

HSP 2 Score: 71.2478 bits (173), Expect = 5.947e-12
Identity = 71/242 (29.34%), Postives = 96/242 (39.67%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY CS C K F   S L+ H  +HT  +PY C  C K F  +  LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q  L  H            + +  G KP    +   S T         Q K          +K   C  C   F T++K  NH  +    EK +    C K+F + S+   H Q +H     Y C+ C   F  +S   NHQ+
Sbjct:  582 PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRI--HTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNH------------QRIHTGEKPYYCSDCGKSFT--------TQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHT-GEKPYYCSDCGKSFTTQSKLKNH-QRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 799          

HSP 3 Score: 70.4774 bits (171), Expect = 9.725e-12
Identity = 71/242 (29.34%), Postives = 96/242 (39.67%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY CS C K F   S L+ H  +HT  +PY C  C K F  +  LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q  L  H            + +  G KP    +   S T         Q K          +K   C  C   F T++K  NH  +    EK +    C K+F + S+   H Q +H     Y C+ C   F  +S   NHQ+
Sbjct:  358 PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI--HTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNH------------QRIHTGEKPYHCSDCGKSFT--------TQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHT-GEKPYYCSDCGKSFTTQSKLKNH-QRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 575          

HSP 4 Score: 70.0922 bits (170), Expect = 1.342e-11
Identity = 70/242 (28.93%), Postives = 96/242 (39.67%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY CS C K F   S L+ H  +HT  +PY C  C K F  +  LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q  L  H            + +  G KP    +   S T         Q K          +K   C  C   F T++K  NH  +    +  H +  C K+F + S+   H Q +H     Y C+ C   F  +S   NHQ+
Sbjct:  750 PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI--HTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNH------------QRIHTGEKPYYCSDCGKSFT--------TQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSD-CGKSFTTQSKLKNH-QRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 967          

HSP 5 Score: 69.707 bits (169), Expect = 1.900e-11
Identity = 70/242 (28.93%), Postives = 97/242 (40.08%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY CS C K F   S L+ H  +HT  +PY C  C K F  +  LK H+     +  K   C  C K   +Q  L+NH ++H  E   +C  C K F  Q  L  H            + +  G KP    +   S T         Q K          +K   C  C   F T++K  NH  +    EK +    C K+F + S+   H Q +H     Y+C+ C   F  +S   NHQ+
Sbjct:  246 PYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI--HTGEKPYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNH------------QRIHTGEKPYYCSDCGKSFT--------TQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHT-GEKPYYCSDCGKSFTTQSKLKNH-QRIHTGEKPYHCSDCGKSFTTQSKLKNHQR 463          

HSP 6 Score: 67.781 bits (164), Expect = 6.893e-11
Identity = 69/242 (28.51%), Postives = 96/242 (39.67%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PY CS C K F   S L+ H  +HT  +PY C  C K F  +  LK H+     +  K   C  C K   +Q  L+NH ++H  E   +C  C K F  Q  L  H            + +  G KP    +   S T         Q K          +K   C  C   F T++K  NH  +    +  H +  C K+F + S+   H Q +H     Y C+ C   F  +S   NHQ+
Sbjct:  498 PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI--HTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNH------------QRIHTGEKPYHCSDCGKSFT--------TQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSD-CGKSFTTQSKLKNH-QRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 715          

HSP 7 Score: 55.4546 bits (132), Expect = 4.252e-7
Identity = 38/106 (35.85%), Postives = 49/106 (46.23%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 3170
            PY CS C K F   S L+ H  +HT  +PY C  C K F  +  LK H+     +  K   C  C K   +Q  L+NH ++H  E   +C  C K F  Q  L  H
Sbjct:  890 PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRI--HTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNH 993          
BLAST of CID domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005438.1 (pep scaffold:Pmarinus_7.0:GL476532:182919:190229:1 gene:ENSPMAG00000004952.1 transcript:ENSPMAT00000005438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 1.712e-21
Identity = 71/258 (27.52%), Postives = 133/258 (51.55%), Query Frame = 3
Query:   90 ISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQS-RNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFI----EDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEE 848
            +S T  SIQ  S ++      S  +V  W ++L  +P   +++LFY+AN+++Q+ +   +  F+ ++   L  +   +++ +V + I R+F IW +R ++++ F     E L+N+ A  R+P    E  N++  F P   I +L      E+E     K   A+ L  +  S  E  K +KD+     FSN+L+ T  +L    + +E+++K     +  +E AE++Y++Q  +  +V +AY  +GN +   K  LEE
Sbjct:   33 LSNTMESIQGLSHWIIDHKSRSAKIVERWLKSLKKSPCEQRLNLFYLANDVVQNCKRKDAIVFRDAFAEVLPDATSLVRDIAVRKPIERIFGIWEQREIFKKDFTVKLREILVNEKA--RAP----ENANVLAEFRPHSIIQQLAAFKTFEDE--SMTKETQAANLQVEFLSV-EDFKLIKDQEGGMLFSNELEETSAKLEDFVNHLEKDIKRLPMIMDALEKAELFYESQFKDVKIVVNAYTNFGNRVVHLKRQLEE 281          
BLAST of CID domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001428.1 (pep scaffold:Pmarinus_7.0:GL481113:143068:144258:1 gene:ENSPMAG00000001294.1 transcript:ENSPMAT00000001428.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 3.106e-13
Identity = 69/245 (28.16%), Postives = 101/245 (41.22%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFD----LQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            PY CS+C KGFNR+S L  H ++H   +P+ CP C K F    +LK H      S     +C LC K  R ++ L++H++ H  E+S  C VC KGF     L+  +  H  E+      C +G        G LS+                         +K+ KCL C   F+   +   H       E  H    C K F   S+   H+   H     + C+ C   F Q ++  +H K+
Sbjct:   59 PYRCSVCGKGFNRSSTLATHATIHATEKPHICPVCGKGFSRPFALKCHVVI--HSGDCPHKCALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSRSFVLKTHMMTHTGERPHKCPVCGKGF-------GRLSTLQN---------------HATMHTGEKVHKCLVCGKGFSRSVQLKRHM-RNHTGEWRHRCSVCQKGFIRPSELKNHMM-THTGERPHKCSVCGKAFKQYTALKSHMKT 277          

HSP 2 Score: 55.8398 bits (133), Expect = 3.460e-8
Identity = 41/122 (33.61%), Postives = 62/122 (50.82%), Query Frame = 3
Query: 2850 FPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSC 3203
            + + CS+C KGF R S L+ H+  HT  RP++C  C K F+   +LK+H  T   +  +  +C LC K  +    L++H+  H  E +  C VC K F     L+  +  H  EK    S+C
Sbjct:  226 WRHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSHMKT--HTGERPHKCSLCEKDFKQCTGLKSHMLTHTGERAYKCSVCEKDFIHSTSLKSHMKTHSGEKPYKCSAC 345          

HSP 3 Score: 51.6026 bits (122), Expect = 6.130e-7
Identity = 35/114 (30.70%), Postives = 53/114 (46.49%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEK 3182
            P+ CS+C K F + + L+ H+  HT  RP++C  C K F+    LK+H  T H+              + S  +L++H+K H  E    C  C K F     L+  +  H  EK
Sbjct:  255 PHKCSVCGKAFKQYTALKSHMKTHTGERPHKCSLCEKDFKQCTGLKSHMLT-HTGERAYKCSVCEKDFIHS-TSLKSHMKTHSGEKPYKCSACKKDFRHSTTLKNHMKTHTGEK 366          

HSP 4 Score: 48.9062 bits (115), Expect = 5.072e-6
Identity = 66/251 (26.29%), Postives = 91/251 (36.25%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV-----DEKHAASSSCIEGLPE------GRKPAGELS--SSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 3566
            P+ CS+C K F R S+L+ H+  HT  +PY+C  C   F    +LK H +  +                 S +A   H  +H  E    C VC KGF     L  HV     D  H  +    E   E       R   GE S   S+           +  +     E P    KC  C   F   +   NH  +    EK H    C K F  + Q   H++  H    ++ C+ C   F + S   NH
Sbjct:    3 PHKCSVCSKSFVRPSDLKNHVMSHTGEKPYKCYMCENAFVTASNLKNHMSIHNGEKPYRCSVCGKGFNRSSTLA--THATIHATEKPHICPVCGKGFSRPFALKCHVVIHSGDCPHKCALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSRSFVLKTHMMTHTGERPH---KCPVCGKGFGRLSTLQNHATMHT-GEKVHKCLVCGKGFSRSVQLKRHMRN-HTGEWRHRCSVCQKGFIRPSELKNH 246          
BLAST of CID domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008822.1 (pep scaffold:Pmarinus_7.0:GL477256:50027:56378:-1 gene:ENSPMAG00000007983.1 transcript:ENSPMAT00000008822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 1.666e-10
Identity = 69/266 (25.94%), Postives = 113/266 (42.48%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNH-----------------FCVGLKA----EKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVH 3581
            P+ C  C + F   S L  H   HT+ RPY C  C  RFR   S KTH   +  +  K   C++C K   ++  L +H++LH  E    C+ C K F L+  + +HV+  H   +          KP+   SSS+          Q++        +     +C +C+  F+ + ++  H                  CVG +A     K+H + C  C K F S++    H+  +H  +  Y C  C++ F + +S  +H K+ H
Sbjct:   60 PFVCESCGQCFRNRSTLTVHRRRHTQERPYACTVCGARFRQSDSCKTH--MRIHTGEKPFECNVCGKTFANRGNLPSHMRLHTGERLFQCEYCGKKFTLKGTMQKHVNSIHNPQNVV--------KPS---SSSLGRRLVKVETVQEEYCGVTTSTLAGGCFECSACALQFSRQTEFVVHMAGHNGLEVLSCTVCKKLCVGQEALERHTKAHKHVCEICGKNFTSSNNLTQHMN-LHLDVRPYKCQYCDVAFHRNNSLWSHIKARH 311          

HSP 2 Score: 50.8322 bits (120), Expect = 1.282e-6
Identity = 34/104 (32.69%), Postives = 52/104 (50.00%), Query Frame = 3
Query: 2862 CSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 3173
            C IC K F  ++NL QH+++H  +RPY+C  C   F    SL +H   +H+      +C  C K   +   L +HL+ H  E    C++C + F  +  L RH 
Sbjct:  262 CEICGKNFTSSNNLTQHMNLHLDVRPYKCQYCDVAFHRNNSLWSHIKARHNYGLPAYQCTHCNKRFATPSQLTHHLRYHTGERFHACELCGRMFVNRSGLQRHT 365          
BLAST of CID domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002487.1 (pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1 gene:ENSPMAG00000002270.1 transcript:ENSPMAT00000002487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 1.807e-10
Identity = 67/239 (28.03%), Postives = 91/239 (38.08%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 3569
            PY+C+IC K F+   NL+ H   H K RPY C  C KRF  + +L  H  T H+ V   +  H   K  + Q  L+ H ++H  E    CK+C KGF L+  L  H                                             E    + K  I C  C   ++ K+   NH  V    EK  L + C K F   S    H +  H+    + C +C   F+Q SS   HQ
Sbjct:  213 PYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRT-HTGVKPYICTHCGNKFSQGQ-HLKAHKRIHTGERPFICKICGKGFALKSTLKTH---------------------------------------------EFTHSVEKPFI-CKHCGKGYSLKSTLKNHEIV-HSGEKPFLCKECGKGFSQGSSLKNH-KLTHDGEQPFICQECGRRFSQTSSLKTHQ 401          

HSP 2 Score: 59.6918 bits (143), Expect = 2.901e-9
Identity = 68/256 (26.56%), Postives = 96/256 (37.50%), Query Frame = 3
Query: 2820 KTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKC-LSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            KT ++   L  P+ C+ C KGF++AS ++ H   HT  RPY C  C +RF    SLKTH+ T       +        L  S   L+ H K+H  E    CK C K F     ++     H  EK      C  G  +  KP  +    I                    E P     C  S S  +N KA    H       E+ ++   C K F      + H++  H  +  Y C  C   F+Q      H++
Sbjct:   62 KTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQAS--TLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQ--KPHLKTHQRIH-----------------TGEKPYACNICGKSFSLNYNLKAHQKTHL-----KERPYMCELCGKRFSDKRTLVVHMR-THTGVKPYICTHCGNKFSQGQHLKAHKR 290          

HSP 3 Score: 49.6766 bits (117), Expect = 4.208e-6
Identity = 34/106 (32.08%), Postives = 49/106 (46.23%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 3170
            P+ C  C KGF++ S+L+ H   H   +P+ C +C +RF    SLKTH+       T L           S  +L+ H ++H  E    CK C K F    +L  H
Sbjct:  353 PFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPS--SLKQHQQMHSSERPFICKECGKSFSYYSNLKVH 456          

HSP 4 Score: 48.9062 bits (115), Expect = 6.921e-6
Identity = 20/51 (39.22%), Postives = 33/51 (64.71%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEAT 3005
            P++C++C +GF++  +L+ H   HT  +PY+C  C K F   C+LK H+ T
Sbjct:  465 PFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVHKKT 515          
BLAST of CID domain-containing protein vs. Ensembl Sea Lamprey
Match: zbtb14 (zinc finger and BTB domain containing 14 [Source:ZFIN;Acc:ZDB-GENE-040426-2946])

HSP 1 Score: 62.003 bits (149), Expect = 4.161e-10
Identity = 35/112 (31.25%), Postives = 48/112 (42.86%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHA 3188
            P++C+ C K F R  +L++H  VHT  RP+ CP C K F+H+  LK HE                              + H  E    C+VC K F    DL RH++  H 
Sbjct:  338 PFACTRCGKAFARGPDLKKHERVHTNERPFMCPLCLKAFKHKSHLKDHE------------------------------RRHRGERPFVCRVCLKAFGKTSDLKRHLNTMHG 419          
BLAST of CID domain-containing protein vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 52.373 bits (124), Expect = 4.852e-7
Identity = 33/101 (32.67%), Postives = 51/101 (50.50%), Query Frame = 3
Query: 2871 CHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 3173
            CH+ F +   L +HL VH+K +PY+C  C + F    +L  H  T HS            K   S  +L+ H++ H  E  + CK+C K F+   +LS+H+
Sbjct:  745 CHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRT-HSGEKPYKCHICNKKFAISS-SLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHI 843          
BLAST of CID domain-containing protein vs. Ensembl Yeast
Match: FZF1 (Transcription factor involved in sulfite metabolism; sole identified regulatory target is SSU1; overexpression suppresses sulfite-sensitivity of many unrelated mutants due to hyperactivation of SSU1, contains five zinc fingers; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003223])

HSP 1 Score: 49.2914 bits (116), Expect = 1.733e-6
Identity = 41/133 (30.83%), Postives = 60/133 (45.11%), Query Frame = 3
Query: 2856 YSCSI--CHKGFNRASNLQQHLSVHTKLRPYQC--PKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGE 3242
            Y CS   C K +NR S LQQH + HT  +PY C  P C K+F   C L+ H+ T HS +          + + +Q  LR HL  H R+  +  ++  K   +  ++   ++ K          LP G    GE
Sbjct:   12 YKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWT-HSQIKPKACTLCQKRFVTNQ-QLRRHLNSHERKSKLASRIDRKHEGVNANVKAELNGKEGGFDP---KLPSGSPMCGE 139          
BLAST of CID domain-containing protein vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 49.6766 bits (117), Expect = 3.065e-6
Identity = 23/51 (45.10%), Postives = 29/51 (56.86%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQC--PKCPKRFRHRCSLKTHE 2999
            PYSC IC K F+R  NL  HL  H KL+P+ C    C K F    ++K H+
Sbjct:  648 PYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQ 698          

HSP 2 Score: 48.1358 bits (113), Expect = 8.924e-6
Identity = 27/106 (25.47%), Postives = 45/106 (42.45%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 3173
            + C  CH+ F++A++L+ H+  H   +P+ C  C KRF    +L+THE                              +LH  E    C +C K F  + +L+ H+
Sbjct:  593 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHE------------------------------RLHTGEKPYSCDICDKKFSRKGNLAAHL 668          
BLAST of CID domain-containing protein vs. Ensembl Nematostella
Match: EDO31191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYN2])

HSP 1 Score: 106.301 bits (264), Expect = 5.080e-23
Identity = 73/289 (25.26%), Postives = 134/289 (46.37%), Query Frame = 3
Query:   90 ISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNI------------------------------ILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEEHLDFLM 866
            +S    S+Q  S ++    +S++ +V +W   L       ++ LFY+AN++LQ+       F  ++   L  ++  + + S+ + + R+  IW +R+V+E  FI+DL  KL  S S  + + +K++                                +F P   I  L  + K E+EV  TL+    ++L  D  S  EAIK+LKD+     F+ + +    +L + C  +E+E + R   + V+E+  ++Y     E  V+  AYK +GN +   K  L+  +D L+
Sbjct:   16 MSSAQDSVQTLSLWIIHHKRSANDIVKVWIDQLKKCNTDRRLILFYLANDVLQNSRKKGKEFSSAFARVLREAVPLLSDKSIKDAVKRVLQIWQDRKVFEVEFIDDLRGKLDKSNSSNHSQPSKSVRKKEKEKEKPNLKEVEKPASKPSKPEKRLPPADFKPSKLIDALDAMRKFESEV--TLQESQLNSLRID-ASDMEAIKQLKDRSTGARFTEEYEMASQKLEKFCKTIEQEKEERSQLISVVEDGGLFYDAAYGEVKVIVHAYKTFGNRLNSLKKKLDHKVDKLI 301          
BLAST of CID domain-containing protein vs. Ensembl Nematostella
Match: EDO48839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIQ4])

HSP 1 Score: 73.1738 bits (178), Expect = 3.395e-13
Identity = 64/248 (25.81%), Postives = 105/248 (42.34%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLI------KCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 3566
            PYSCS C   F  +S+L++HL  HT  +PY+C +C K F   C L TH+    +                 QV   +H++ H  E    C  C K F ++ +L+    RH +E+    ++C +      +      S      +      +K  ++    I KK+       +C  C   F TKAK D HF      EK +    C+K+F        H++ +HN   +++C+ C  +F  ++    H
Sbjct:  216 PYSCSQCEWSFTTSSDLKRHLKTHTGEKPYRCEECDKAFSSSCGLSTHKKIHFNIKPHSCTVCHKRFATTGQVT--SHMRTHTGEQPFKCTYCDKAFSIKGNLTVHIRRHTNERPYVCTTCGKSFTVISQLVMHNRSHTDERPYKCDICGKKFRQQGGLSIHKKIHTEEKPHECTQCEKAFITKAKLDRHF-RTHSGEKPYRCEICEKSFRDKDSLNIHMR-IHNNDKRHSCSYCPKLFYTKTELRQH 459          

HSP 2 Score: 53.1434 bits (126), Expect = 6.026e-7
Identity = 73/257 (28.40%), Postives = 102/257 (39.69%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLH--VREYSVHCKVCYKGFDLQEDLSRHV----DEK--------HAASSSCIEGLPEGRKPAGEL---SSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 3572
            PYSC  C + F  +S+L  H  +HT  +PY+C  CPK F    SL  H   +H S  K  +C +C +          H++ H  ++ YS  C  C   F    DL RH+     EK         A SSSC  GL   +K    +   S ++ H       Q    ++    E P    KC  C   F+ K     H       E+ ++   C K+F   SQ + H    H     Y C  C   F Q+     H+K
Sbjct:  132 PYSCKYCGRMFGESSSLIMHQRIHTNEKPYKCKLCPKAFTSHSSLVMHN--RHHSGDKPYKCEICGRAFSVSSNRARHMRSHKNIKPYS--CSQCEWSFTTSSDLKRHLKTHTGEKPYRCEECDKAFSSSC--GLSTHKKIHFNIKPHSCTVCHKRFATTGQVTSHMRTHTGEQP---FKCTYCDKAFSIKGNLTVHI-RRHTNERPYVCTTCGKSFTVISQLVMH-NRSHTDERPYKCDICGKKFRQQGGLSIHKK 377          
BLAST of CID domain-containing protein vs. Ensembl Nematostella
Match: EDO49432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGI1])

HSP 1 Score: 62.3882 bits (150), Expect = 2.886e-11
Identity = 45/106 (42.45%), Postives = 60/106 (56.60%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 3170
            P+ C+IC KGF  +S L +H  +HT  +P+QC  C K F    +LKTH+ T HS+V K   CH+C K    +  LRNHL +H  E    C VC K F+   +L  H
Sbjct:    9 PFVCAICGKGFRLSSTLCRHKIIHTSHKPHQCTTCGKAFNRSSTLKTHQRT-HSTV-KEFVCHICEKGFHQKGNLRNHLLIHTGEKPYKCTVCKKAFNKLSNLKFH 112          

HSP 2 Score: 53.1434 bits (126), Expect = 4.112e-8
Identity = 26/51 (50.98%), Postives = 31/51 (60.78%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEAT 3005
            PY C++C K FN+ SNL+ H  VHT  RPY+C  C   F  RC LK H  T
Sbjct:   93 PYKCTVCKKAFNKLSNLKFHSHVHTDNRPYRCRYCKVAFSRRCDLKLHLNT 143          
BLAST of CID domain-containing protein vs. Ensembl Nematostella
Match: EDO47753 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKW3])

HSP 1 Score: 66.2402 bits (160), Expect = 4.870e-11
Identity = 71/246 (28.86%), Postives = 103/246 (41.87%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            + C +C + FN+ SNL+ H   H+  RPY C KC K F+    L  H    H+S T    C  C K  R +  LR HL +H  E    C++C K F  ++ L+R    HVD        C+E +      +G                  KP+     E P    +C SCS  F   +  + H    +   + +   C  CDKTF S S    H++ +H     Y C QC   F  +S   +H ++
Sbjct:  184 HKCEVCSRVFNKCSNLKAHALSHSHERPYACDKCDKTFQRTSQLVIHNRI-HNSET-PYSCDKCEKSFRGRTNLRLHLLVHSLEKPYQCEICSKSFTRKDCLNRHLITHVDPSMRKKHVCLECVKVLPSKSG----------------FDKPLVVYFTEKP---YQCESCSMSFPRSSCLNKHRLTHMDTSERNAYVCQTCDKTFSSKSNLDQHLK-LHTGERPYQCTQCEKGFNAKSHLADHLRT 407          

HSP 2 Score: 52.373 bits (124), Expect = 8.563e-7
Identity = 25/54 (46.30%), Postives = 33/54 (61.11%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHS 3014
            PY C+ C KGFN  S+L  HL  H++ RP+ C +C K+F+H  SL  H    HS
Sbjct:  385 PYQCTQCEKGFNAKSHLADHLRTHSQDRPFACNECEKKFKHPVSLNKHVRGVHS 438          
BLAST of CID domain-containing protein vs. Ensembl Nematostella
Match: EDO38419 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX8])

HSP 1 Score: 65.855 bits (159), Expect = 7.010e-11
Identity = 63/245 (25.71%), Postives = 95/245 (38.78%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            P+ C+ C K F RAS L +H+  H+  +P++C +C K F H  +L TH  T HS               ++ + L  H++ H  E    C  C K F    +L+ H+     EK    + C +        AG L++ +  H                    +K  KC  C  +F        H       EK H    C K F   S    H++ +H+    Y C QC  +FA  S    H ++
Sbjct:  316 PHKCTQCGKAFARASVLTRHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRT-HSGEKPHKCTQCGKVFAQAGI-LTTHMRTHSGEKPHKCTQCGKAFAQASNLTTHMRTHSGEKPHKCTQCGKVFAH----AGNLTTHMRTHSG------------------EKPHKCTQCGKVFAQAGNLTTHM-RTHSGEKPHKCTQCGKAFAHASNLTKHMR-IHSGEKPYKCTQCGKVFAHTSHLTKHMRT 534          

HSP 2 Score: 54.299 bits (129), Expect = 2.516e-7
Identity = 62/242 (25.62%), Postives = 88/242 (36.36%), Query Frame = 3
Query: 2862 CSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            C IC K F     +  H+  HTK +PY+C +C K F H  SL  H  T HS               R+ V  R H++ H  E    C  C K F    +L   +  H  EK    + C +   +    AG L++ +  H                    +K  KC  C   F   +    H       EK H    C K F        H++  H+    + C QC  +FAQ  +   H ++
Sbjct:  263 CPICEKDFCDYRYMIMHILTHTKYKPYKCTQCGKAFAHASSLTEHMRT-HSGEKPHKCTQCGKAFARASVLTR-HMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVFAQ----AGILTTHMRTHSG------------------EKPHKCTQCGKAFAQASNLTTHM-RTHSGEKPHKCTQCGKVFAHAGNLTTHMR-THSGEKPHKCTQCGKVFAQAGNLTTHMRT 478          
BLAST of CID domain-containing protein vs. Ensembl Medaka
Match: rprd2a (regulation of nuclear pre-mRNA domain containing 2 [Source:NCBI gene;Acc:101172176])

HSP 1 Score: 102.064 bits (253), Expect = 2.195e-21
Identity = 73/272 (26.84%), Postives = 134/272 (49.26%), Query Frame = 3
Query:   87 TISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSNFKQSWKSQLNPS----LEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETK---------NIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTK---DALEEHL 854
            T+S T  SIQ  S +     K   ++V  W + L  +    +++L YVAN+++Q+    ++   ++  ++L P     + +  +S V + + R+ +IW ER VY  + I +L N L    SP  E++T           ++  F P+  + +L    +   EV+  L+    +A+  D  S  +A+KKLKDK    +FS   +    QL +     E+++K     L+ + NA+++Y+ Q  E  +V +AY+ + N ++  K   DAL+  L
Sbjct:   23 TVSNTMDSIQGLSTWCIDNKKYHSLIVRHWMKCLKKSDSAHRLNLLYVANDVIQNCKRKNAIVYRTAFAELLPDAFLLVSHEGDSKVHKSVERILSIWEERDVYSGALIAELKNILTKEDSPPAEQQTPVESKADLRSKVLAEFVPQALLDQLSKYKRSLEEVD--LREKQLAAMRVDIFST-DALKKLKDKTGGKKFSKDFEEGSAQLHEFVKFFEKQMKTGPQLLEALTNADIFYEMQYKEVKIVANAYQTFANRVSHLKRKLDALKASL 291          
BLAST of CID domain-containing protein vs. Ensembl Medaka
Match: rprd2a (regulation of nuclear pre-mRNA domain containing 2 [Source:NCBI gene;Acc:101172176])

HSP 1 Score: 90.1225 bits (222), Expect = 8.672e-18
Identity = 70/268 (26.12%), Postives = 130/268 (48.51%), Query Frame = 3
Query:   87 TISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSNFKQSWKSQLNPS----LEYIKNSSVTEKIIRMFNIWIERRVYE----QSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNET-LKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTK---DALEEHL 854
            T+S T  SIQ  S +     K   ++V  W + L  +    +++L YVAN+++Q+    ++   ++  ++L P     + +  +S V + + R+ +IW ER VY     +S + D +N +   R     E   ++      E  ++   NL K +  + E  L+    +A+  D  S  +A+KKLKDK    +FS   +    QL +     E+++K     L+ + NA+++Y+ Q  E  +V +AY+ + N ++  K   DAL+  L
Sbjct:   23 TVSNTMDSIQGLSTWCIDNKKYHSLIVRHWMKCLKKSDSAHRLNLLYVANDVIQNCKRKNAIVYRTAFAELLPDAFLLVSHEGDSKVHKSVERILSIWEERDVYSGKRLKSVLSDGLNFVVFVRPEAPVESKADLRSKVLAEFVVSTALNLSKYKRSLEEVDLREKQLAAMRVDIFST-DALKKLKDKTGGKKFSKDFEEGSAQLHEFVKFFEKQMKTGPQLLEALTNADIFYEMQYKEVKIVANAYQTFANRVSHLKRKLDALKASL 289          
BLAST of CID domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000038984.1 (pep primary_assembly:ASM223467v1:19:1011628:1015115:-1 gene:ENSORLG00000022350.1 transcript:ENSORLT00000038984.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 6.727e-13
Identity = 68/243 (27.98%), Postives = 102/243 (41.98%), Query Frame = 3
Query: 2859 SCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            SCS+C K F   SNL+ H  +HT  +P+ C  C + FR R S+++H  T   S  +  +C  C K    +  L+ H   H  E    C VC + F+L ++L RH      EK    S C +G           + ++T   H      QKP            +KC  C   F       NH  +    E+      C K+F    Q   H + VH     ++C +C   F Q+SS ++H ++
Sbjct:  175 SCSVCGKSFATQSNLKSHFLIHTGEKPFACSVCGRAFRQRHSMQSHMCTH--SGERPFQCSDCGKSFYKKWRLKMHAISHTGEKPHSCDVCGRRFNLLQNLHRHALMHTGEKLFICSECGKG----------FTRAVTLRTHQFIHTGQKP------------LKCEQCPKTFRHAVNLRNHLRIH-SGERPFACELCGKSFRQAGQLKIH-RRVHTGERPFSCRECGKSFTQQSSLISHGRT 391          

HSP 2 Score: 67.3958 bits (163), Expect = 4.846e-11
Identity = 63/240 (26.25%), Postives = 87/240 (36.25%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAG--ELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 3569
            + CS C KGF RA  L+ H  +HT  +P +C +CPK FRH                               V LRNHL++H  E    C++C K F     L  H              +  G +P    E   S T             I        ++   C SC+  FN       H  V    EK +    CDK+F   S    H + VH+   QY C +C   +A + +   H+
Sbjct:  286 FICSECGKGFTRAVTLRTHQFIHTGQKPLKCEQCPKTFRH------------------------------AVNLRNHLRIHSGERPFACELCGKSFRQAGQLKIH------------RRVHTGERPFSCRECGKSFTQQSSL--------ISHGRTHSTERPFACSSCNKTFNNANSLKLHVRVHT-GEKPYACDLCDKSFSQGSHLRTHQRHVHSGGKQYICDRCGKRYADQRNLKLHK 474          

HSP 3 Score: 53.5286 bits (127), Expect = 1.196e-6
Identity = 36/114 (31.58%), Postives = 54/114 (47.37%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAAS 3194
            P++C +C K F +A  L+ H  VHT  RP+ C +C K F  + SL +H  T   S  +   C  C K   +  +L+ H+++H  E    C +C K F     L  H    H+  
Sbjct:  341 PFACELCGKSFRQAGQLKIHRRVHTGERPFSCRECGKSFTQQSSLISHGRTH--STERPFACSSCNKTFNNANSLKLHVRVHTGEKPYACDLCDKSFSQGSHLRTHQRHVHSGG 452          
BLAST of CID domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000029076.1 (pep primary_assembly:ASM223467v1:19:1011628:1029001:-1 gene:ENSORLG00000022350.1 transcript:ENSORLT00000029076.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 6.727e-13
Identity = 68/243 (27.98%), Postives = 102/243 (41.98%), Query Frame = 3
Query: 2859 SCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 3575
            SCS+C K F   SNL+ H  +HT  +P+ C  C + FR R S+++H  T   S  +  +C  C K    +  L+ H   H  E    C VC + F+L ++L RH      EK    S C +G           + ++T   H      QKP            +KC  C   F       NH  +    E+      C K+F    Q   H + VH     ++C +C   F Q+SS ++H ++
Sbjct:  175 SCSVCGKSFATQSNLKSHFLIHTGEKPFACSVCGRAFRQRHSMQSHMCTH--SGERPFQCSDCGKSFYKKWRLKMHAISHTGEKPHSCDVCGRRFNLLQNLHRHALMHTGEKLFICSECGKG----------FTRAVTLRTHQFIHTGQKP------------LKCEQCPKTFRHAVNLRNHLRIH-SGERPFACELCGKSFRQAGQLKIH-RRVHTGERPFSCRECGKSFTQQSSLISHGRT 391          

HSP 2 Score: 67.3958 bits (163), Expect = 4.846e-11
Identity = 63/240 (26.25%), Postives = 87/240 (36.25%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAG--ELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 3569
            + CS C KGF RA  L+ H  +HT  +P +C +CPK FRH                               V LRNHL++H  E    C++C K F     L  H              +  G +P    E   S T             I        ++   C SC+  FN       H  V    EK +    CDK+F   S    H + VH+   QY C +C   +A + +   H+
Sbjct:  286 FICSECGKGFTRAVTLRTHQFIHTGQKPLKCEQCPKTFRH------------------------------AVNLRNHLRIHSGERPFACELCGKSFRQAGQLKIH------------RRVHTGERPFSCRECGKSFTQQSSL--------ISHGRTHSTERPFACSSCNKTFNNANSLKLHVRVHT-GEKPYACDLCDKSFSQGSHLRTHQRHVHSGGKQYICDRCGKRYADQRNLKLHK 474          

HSP 3 Score: 53.5286 bits (127), Expect = 1.196e-6
Identity = 36/114 (31.58%), Postives = 54/114 (47.37%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAAS 3194
            P++C +C K F +A  L+ H  VHT  RP+ C +C K F  + SL +H  T   S  +   C  C K   +  +L+ H+++H  E    C +C K F     L  H    H+  
Sbjct:  341 PFACELCGKSFRQAGQLKIHRRVHTGERPFSCRECGKSFTQQSSLISHGRTH--STERPFACSSCNKTFNNANSLKLHVRVHTGEKPYACDLCDKSFSQGSHLRTHQRHVHSGG 452          
BLAST of CID domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000012685.2 (zinc finger protein 709 [Source:NCBI gene;Acc:101157919])

HSP 1 Score: 72.4034 bits (176), Expect = 2.076e-12
Identity = 71/263 (27.00%), Postives = 102/263 (38.78%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXX----XXXXXXXKPIKEVIPE----IPKKLIK------------CLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHH 3584
            +SC +C K F  AS LQ+HL  H+  RP+ C  C KRF  +  L  HE     +  K   C  C K   SQ  LR H + H  E   HC +C K F     L  H++  H   S  +EG    + P  E   S                ++P +    +    +   L++            C  C   F  +     H       EK +    CDK+F +  +   HV+ +H     Y CA C   F+   +  NH++S  H
Sbjct:   67 HSCLVCGKDFPYASKLQRHLRTHSGERPFPCSMCEKRFPEKGLLMIHERVH--TGEKPFPCTFCEKRFASQGELRLHRRTHTGERPYHCSICLKSFSRHWHLKTHLEAMH---SEIVEGFTRKKFPCSECEKSCNSAAELRDHQRTHTGERPFQCSFCDKRFALSGTLVRHERLHTGITPYHCSDCGKTFAQQWTLTTHMRTHT-GEKPYSCTQCDKSFVAPGELRRHVR-IHTGEKPYTCADCGRHFSLAGTLRNHKRSCTH 322          

HSP 2 Score: 62.003 bits (149), Expect = 2.925e-9
Identity = 36/131 (27.48%), Postives = 53/131 (40.46%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATK------HSSVTXXXXXXXXXXXXXSQV-------------------ALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 3170
            PY C++C K F +   L+ H  VHT  +P+ CP+C K F H  ++  H  T       H SV               ++                   +L+NH +LH  E   HC +C +GF   + L  H
Sbjct:  508 PYQCTVCGKQFTQKGQLKGHFKVHTGEKPFSCPECGKSFAHSGAMNRHRLTHTGERPFHCSVCDRRFNQSGRLREHEKIHFGEKFDCPECEKSFTRSSSLKNHFRLHTGERPYHCDLCGRGFSRSQSLRLH 638          

HSP 3 Score: 50.8322 bits (120), Expect = 9.760e-6
Identity = 31/106 (29.25%), Postives = 44/106 (41.51%), Query Frame = 3
Query: 2853 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 3170
            P+ CS C K F  +  L +H  +HT + PY C  C K F  + +L TH  T                +   +  LR H+++H  E    C  C + F L   L  H
Sbjct:  213 PFQCSFCDKRFALSGTLVRHERLHTGITPYHCSDCGKTFAQQWTLTTHMRTHTGEKPYSCTQCDKSFVAPGE--LRRHVRIHTGEKPYTCADCGRHFSLAGTLRNH 316          
BLAST of CID domain-containing protein vs. Planmine SMEST
Match: SMESG000081186.1 (SMESG000081186.1)

HSP 1 Score: 1408.28 bits (3644), Expect = 0.000e+0
Identity = 831/846 (98.23%), Postives = 831/846 (98.23%), Query Frame = 3
Query:   39 MSRXXXXXXXXXXXXXTISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEEHLDFLMXXXXXXXXXXXXXXXKTPPYLYDDTVKNVNELKNSPMSFQDVISPTQSMDMSEDDTPMDSSVYSNKPYSPSNEVEAKSDVNSSNTASIEEPKPSLSCSDALKILTSVFTQSLSKKVTPEPETRVHLQPDIFRNTLXXXXXXXXXXXXXXXXXXXXXXXXXXVVADAFRLISNLTGIKNISERNYKSDSTTSSGTTIPILTSKSSYRNVTNEPEKLKSNIFPFNNQSSFPTLNISTKCDTMQHSIFPDVQNSFPPMFNQHSINTNPMFPLLTYHSGITTQPPPPIFNPLSNNALAFNMGVMXXXXXXXXXXXXPGSCTEDEDEGGATPTQDEPATNMFNPNVIPVIHPSAEDINKQIQNVMXXXXXXXXXXXXXITGTNDSQHNNSLQQSQWNQFPFNLKSPNIQPPMNIPFNLMNQSTPIQPSFSPVNISKNPLNFGPPRAIRTKRPNPESGTNQSNSCEVYNIPGSADYALSXXXXXXXLQSKSXXXXXXXXXXXXXXXXXXXXKNNGKESELLNLYDDVEEELDRNYNFNQQNINVRNSRPPPPSDRYHLYNQSVPQNMNSYRFGDAH 2576
            MSRLKLDKDKILKKFKTISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEEHLDFLMDDAGPIDIDDAPSPGKTPPYLYDDT               DVISPTQSMDMSEDDTPMDSSVYSNKPYSPSNEVEAKSDVNSSNTASIEEPKPSLSCSDALKILTSVFTQSLSKKVTPEPETRVHLQPDIFRNTLSTSTVNSDMNNDSNNSSNNKSENQDSVVADAFRLISNLTGIKNISERNYKSDSTTSSGTTIPILTSKSSYRNVTNEPEKLKSNIFPFNNQSSFPTLNISTKCDTMQHSIFPDVQNSFPPMFNQHSINTNPMFPLLTYHSGITTQPPPPIFNPLSNNALAFNMGVMNKDNNNQSNKKSPGSCTEDEDEGGATPTQDEPATNMFNPNVIPVIHPSAEDINKQIQNVMNTNNTNPFNLPNLITGTNDSQHNNSLQQSQWNQFPFNLKSPNIQPPMNIPFNLMNQSTPIQPSFSPVNISKNPLNFGPPRAIRTKRPNPESGTNQSNSCEVYNIPGSADYALSPPPPPPPLQSKSDENNQNIIQNEEINQAENDNKNNGKESELLNLYDDVEEELDRNYNFNQQNINVRNSRPPPPSDRYHLYNQSVPQNMNSYRFGDAH
Sbjct:    1 MSRLKLDKDKILKKFKTISVTALSIQKTSKYMYQFYKSSDIVVSLWYQALCSAPDTCKISLFYVANEMLQSRNFGSSNFKQSWKSQLNPSLEYIKNSSVTEKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPEDTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNEFSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVVEDAYKRYGNLIAKTKDALEEHLDFLMDDAGPIDIDDAPSPGKTPPYLYDDT---------------DVISPTQSMDMSEDDTPMDSSVYSNKPYSPSNEVEAKSDVNSSNTASIEEPKPSLSCSDALKILTSVFTQSLSKKVTPEPETRVHLQPDIFRNTLSTSTVNSDMNNDSNNSSNNKSENQDSVVADAFRLISNLTGIKNISERNYKSDSTTSSGTTIPILTSKSSYRNVTNEPEKLKSNIFPFNNQSSFPTLNISTKCDTMQHSIFPDVQNSFPPMFNQHSINTNPMFPLLTYHSGITTQPPPPIFNPLSNNALAFNMGVMNKDNNNQSNKKSPGSCTEDEDEGGATPTQDEPATNMFNPNVIPVIHPSAEDINKQIQNVMNTNNTNPFNLPNLITGTNDSQHNNSLQQSQWNQFPFNLKSPNIQPPMNIPFNLMNQSTPIQPSFSPVNISKNPLNFGPPRAIRTKRPNPESGTNQSNSCEVYNIPGSADYALSPPPPPPPLQSKSDENNQNIIQNEEINQAENDNKNNGKESELLNLYDDVEEELDRNYNFNQQNINVRNSRPPPPSDRYHLYNQSVPQNMNSYRFGDAH 831          
BLAST of CID domain-containing protein vs. Planmine SMEST
Match: SMESG000054710.1 (SMESG000054710.1)

HSP 1 Score: 514.227 bits (1323), Expect = 2.330e-159
Identity = 311/311 (100.00%), Postives = 311/311 (100.00%), Query Frame = 3
Query: 2655 RVYFPNLHNSQIVTELETVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPDFNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL 3587
            RVYFPNLHNSQIVTELETVTNSNTSGNTSKLSLKELLSTKESILSTKSTKTPDFNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTKLLRCHLCLKLLRSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITHHHHYHHQQQQKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL
Sbjct: 1143 RVYFPNLHNSQIVTELETVTNSNTSGNTSKLSLKELLSTKESILSTKSTKTPDFNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTKLLRCHLCLKLLRSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITHHHHYHHQQQQKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL 1453          

HSP 2 Score: 55.0694 bits (131), Expect = 4.230e-7
Identity = 59/260 (22.69%), Postives = 106/260 (40.77%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHV-REYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPE----------------GRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPK------KLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 3566
            + C  C+K + ++ +L +H+ +HT+ +P+QC  C K FR +  LK H  + H  + +             Q  L+ H +LH   +    CK+C + F+    L  H    H  S +  +  P                   KP    ++         ++   +PI   I EI K      +L KC  C   +  K   + H    L A  +++ + C+K+F +      H++  H    +++C QC   F  ++S + H
Sbjct:  412 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKS-HWKLKEFSCEICNKIFNLKQ-TLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPSPHQSLHLEHQSLQQHESLKNKPTANSNNPPDVKPLIWNELLNQPIP--IAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRH 667          
BLAST of CID domain-containing protein vs. Planmine SMEST
Match: SMESG000038394.1 (SMESG000038394.1)

HSP 1 Score: 507.679 bits (1306), Expect = 1.205e-155
Identity = 309/311 (99.36%), Postives = 310/311 (99.68%), Query Frame = 3
Query: 2655 RVYFPNLHNSQIVTELETVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPDFNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL 3587
            RVYFPNLHNSQIVTELETVTNSNTSGNTSKLSLKELLSTKESILSTKSTKTPDFNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTKLLRCHLCLKLLRSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSS+ THHHHYHHQQQQKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL
Sbjct: 1317 RVYFPNLHNSQIVTELETVTNSNTSGNTSKLSLKELLSTKESILSTKSTKTPDFNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTKLLRCHLCLKLLRSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTTTHHHHYHHQQQQKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL 1627          

HSP 2 Score: 57.3806 bits (137), Expect = 8.027e-8
Identity = 57/239 (23.85%), Postives = 100/239 (41.84%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHV-REYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITXXXXXXXXXXXKPIKEV-IPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 3566
            + C  C+K + ++ +L +H+ +HT+ +P+QC  C K FR +  LK H  + H  + +             Q  L+ H +LH   +    CK+C + F+    L  H    H  S +  +  P         S         H   + KP      P I  +L KC  C   +  K   + H    L A  +++ + C+K+F +      H++  H    +++C QC   F  ++S + H
Sbjct:  611 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKS-HWKLKEFSCEICNKIFNLKQ-TLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPSPHQSLHLEHQS------LQQHESLKNKPTANSNNPPINNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRH 841          
BLAST of CID domain-containing protein vs. Planmine SMEST
Match: SMESG000006550.1 (SMESG000006550.1)

HSP 1 Score: 59.3066 bits (142), Expect = 3.361e-9
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHS 3014
            Y C+ C KGFN   +L++H   HT +RPY+C +CPK F  RCSL++H    H+
Sbjct:  143 YLCNYCFKGFNDTFDLKRHTRTHTGIRPYKCKQCPKAFTQRCSLESHLKKVHN 195          
BLAST of CID domain-containing protein vs. Planmine SMEST
Match: SMESG000042630.1 (SMESG000042630.1)

HSP 1 Score: 60.077 bits (144), Expect = 5.558e-9
Identity = 36/114 (31.58%), Postives = 46/114 (40.35%), Query Frame = 3
Query: 2856 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASS 3197
            + C  C K F R+S L  HL +HT  RP+ CP C K F  +  +K H  T                   S   L  H + H  E    C  C +GF    DL RH+  +H   S
Sbjct:  191 FQCPQCGKRFKRSSTLSTHLLIHTGNRPFPCPYCSKSFHQKSDMKKHTYTHTGEKPYKCVVCGKAFSQSSN--LITHSRKHSGEKPFWCHKCSRGFQRNVDLRRHIQSQHGDDS 302          
The following BLAST results are available for this feature:
BLAST of CID domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPRD24.810e-1727.63regulation of nuclear pre-mRNA domain containing 2... [more]
RPRD27.087e-1524.91regulation of nuclear pre-mRNA domain containing 2... [more]
ZNF5285.346e-1330.04zinc finger protein 528 [Source:HGNC Symbol;Acc:HG... [more]
ZNF6059.201e-1328.98zinc finger protein 605 [Source:HGNC Symbol;Acc:HG... [more]
ZNF841.042e-1229.39zinc finger protein 84 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of CID domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cids-29.455e-925.76Pol II C-terminal Interaction Domain Suppressor [... [more]
cids-29.885e-925.76Pol II C-terminal Interaction Domain Suppressor [... [more]
lin-482.422e-845.28Putative zinc finger transcription factor [Source... [more]
che-17.288e-829.91Transcription factor che-1 [Source:UniProtKB/Swis... [more]
cids-29.358e-824.45Pol II C-terminal Interaction Domain Suppressor [... [more]
back to top
BLAST of CID domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG151607.691e-1622.83gene:FBgn0032688 transcript:FBtr0343826[more]
CG151608.117e-1622.83gene:FBgn0032688 transcript:FBtr0343825[more]
CG151608.648e-1622.83gene:FBgn0032688 transcript:FBtr0081070[more]
gl1.686e-1034.58gene:FBgn0004618 transcript:FBtr0330042[more]
gl1.791e-1034.58gene:FBgn0004618 transcript:FBtr0083584[more]
back to top
BLAST of CID domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rprd2a1.327e-2127.44regulation of nuclear pre-mRNA domain containing 2... [more]
rprd2b4.084e-1625.47regulation of nuclear pre-mRNA domain containing 2... [more]
si:ch211-235i11.31.105e-1327.87si:ch211-235i11.3 [Source:ZFIN;Acc:ZDB-GENE-131125... [more]
si:ch211-235i11.31.105e-1327.87si:ch211-235i11.3 [Source:ZFIN;Acc:ZDB-GENE-131125... [more]
znf9802.880e-1327.61zinc finger protein 980 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of CID domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPRD23.053e-1524.01regulation of nuclear pre-mRNA domain containing 2... [more]
znf4201.415e-1328.02zinc finger protein 420 [Source:NCBI gene;Acc:5491... [more]
sulf23.078e-1226.14sulfatase 2 [Source:Xenbase;Acc:XB-GENE-950465][more]
znf1805.414e-1229.07uncharacterized LOC100158477 [Source:Xenbase;Acc:X... [more]
znf5931.616e-1125.20zinc finger protein 593 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of CID domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rprd27.169e-1728.11regulation of nuclear pre-mRNA domain containing 2... [more]
Rprd21.150e-1524.73regulation of nuclear pre-mRNA domain containing 2... [more]
Rprd24.911e-1424.75regulation of nuclear pre-mRNA domain containing 2... [more]
Zfp1127.185e-1329.46zinc finger protein 112 [Source:MGI Symbol;Acc:MGI... [more]
Zfp1127.317e-1329.46zinc finger protein 112 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of CID domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5VT52|RPRD2_HUMAN3.403e-1424.91Regulation of nuclear pre-mRNA domain-containing p... [more]
sp|Q6NXI6|RPRD2_MOUSE3.435e-1324.75Regulation of nuclear pre-mRNA domain-containing p... [more]
sp|Q3MIS6|ZN528_HUMAN2.567e-1230.04Zinc finger protein 528 OS=Homo sapiens OX=9606 GN... [more]
sp|P51523|ZNF84_HUMAN5.050e-1229.39Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q0VAW7|ZN112_MOUSE5.175e-1229.46Zinc finger protein 112 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of CID domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2L2Y4Q22.173e-2830.20Regulation of nuclear pre-mRNA domain-containing p... [more]
C3YQX81.392e-2530.12CID domain-containing protein (Fragment) OS=Branch... [more]
A0A2P8XML52.453e-2526.32Regulation of nuclear pre-mRNA domain-containing p... [more]
A0A1B6E4C64.301e-2526.80CID domain-containing protein OS=Clastoptera arizo... [more]
A0A087UKP15.370e-2529.41Regulation of nuclear pre-mRNA domain-containing p... [more]
back to top
BLAST of CID domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rprd2b1.320e-2028.04regulation of nuclear pre-mRNA domain-containing p... [more]
rprd2a1.440e-1726.42regulation of nuclear pre-mRNA domain-containing p... [more]
ENSAMXT00000018704.23.837e-1328.51pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000011094.24.406e-1328.74pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000042131.14.998e-1329.75pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of CID domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005438.11.712e-2127.52pep scaffold:Pmarinus_7.0:GL476532:182919:190229:1... [more]
ENSPMAT00000001428.13.106e-1328.16pep scaffold:Pmarinus_7.0:GL481113:143068:144258:1... [more]
ENSPMAT00000008822.11.666e-1025.94pep scaffold:Pmarinus_7.0:GL477256:50027:56378:-1 ... [more]
ENSPMAT00000002487.11.807e-1028.03pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1... [more]
zbtb144.161e-1031.25zinc finger and BTB domain containing 14 [Source:Z... [more]
back to top
BLAST of CID domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ZAP14.852e-732.67Zinc-regulated transcription factor; binds to zinc... [more]
FZF11.733e-630.83Transcription factor involved in sulfite metabolis... [more]
AZF13.065e-645.10Zinc-finger transcription factor; involved in diau... [more]
back to top
BLAST of CID domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO311915.080e-2325.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488393.395e-1325.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494322.886e-1142.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477534.870e-1128.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384197.010e-1125.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CID domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rprd2a2.195e-2126.84regulation of nuclear pre-mRNA domain containing 2... [more]
rprd2a8.672e-1826.12regulation of nuclear pre-mRNA domain containing 2... [more]
ENSORLT00000038984.16.727e-1327.98pep primary_assembly:ASM223467v1:19:1011628:101511... [more]
ENSORLT00000029076.16.727e-1327.98pep primary_assembly:ASM223467v1:19:1011628:102900... [more]
ENSORLT00000012685.22.076e-1227.00zinc finger protein 709 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of CID domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081186.10.000e+098.23SMESG000081186.1[more]
SMESG000054710.12.330e-159100.00SMESG000054710.1[more]
SMESG000038394.11.205e-15599.36SMESG000038394.1[more]
SMESG000006550.13.361e-947.17SMESG000006550.1[more]
SMESG000042630.15.558e-931.58SMESG000042630.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028573 ID=SMED30028573|Name=CID domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3664bp
ATTGTTTGTATATGTCTTCTTGAATTGAAATTATCAAAATGAGCAGATTA
AAATTAGATAAAGATAAAATATTGAAAAAGTTTAAAACTATTTCTGTAAC
AGCTCTATCTATTCAAAAAACTTCTAAATATATGTACCAATTTTATAAAT
CATCTGATATAGTCGTATCTTTATGGTATCAAGCATTATGTTCTGCACCA
GACACATGTAAAATATCACTATTTTACGTTGCTAATGAAATGCTACAATC
CCGGAATTTTGGATCTAGTAATTTCAAACAAAGCTGGAAATCTCAACTTA
ATCCATCTTTAGAATATATTAAAAATTCATCTGTCACTGAAAAAATTATT
CGCATGTTTAATATATGGATTGAAAGACGAGTTTATGAACAGTCATTTAT
TGAAGATTTAATTAATAAATTAGCTAGTTCCAGGAGTCCCATTAATGAAG
AAGAGACAAAAAATATTATTTTAAATTTCGATCCTGAAGATACAATTACT
AAATTGAAGAATTTAATGAAAATAGAAAACGAAGTCAATGAAACACTAAA
ACGTGTCGATGCATCAGCCTTAAATTTCGATGAAAAATCTTGCAAAGAAG
CAATTAAGAAATTGAAAGATAAAGTTCATTGTAATGAATTTAGTAATCAG
TTAGATGGAACGATCAATCAACTTTTTCAAGTTTGTTCATTAATGGAAGA
AGAACTCAAAATACGACAAAGTACTCTGAAAGTAATGGAAAATGCCGAAG
TCTATTACCAAACCCAATTAAGTGAAACATTAGTAGTTGAAGATGCATAC
AAAAGATATGGAAATTTAATTGCCAAAACCAAAGATGCATTAGAAGAACA
CTTAGATTTCTTGATGGACGATGCCGGTCCAATTGATATTGATGATGCTC
CGTCGCCTGGTAAAACACCACCGTATTTATACGACGATACCGTAAAAAAT
GTTAACGAATTAAAGAACTCTCCAATGTCATTTCAGGATGTAATTAGCCC
TACGCAATCTATGGATATGTCTGAAGATGATACTCCAATGGATTCTTCGG
TTTATTCAAATAAGCCATATTCTCCTTCTAATGAAGTTGAAGCAAAATCC
GATGTGAACTCAAGCAATACAGCTTCCATCGAGGAACCTAAACCATCTCT
CTCATGCAGTGATGCTCTAAAAATTCTAACGTCTGTCTTCACCCAATCAT
TATCAAAGAAAGTAACTCCTGAGCCTGAAACTCGCGTTCATTTGCAGCCT
GATATATTTCGAAATACTCTTTCCACTTCTACTGTCAATAGTGATATGAA
CAATGATAGTAACAATAGCAGTAACAATAAATCAGAAAATCAAGATTCTG
TAGTCGCTGATGCATTTCGATTGATTTCAAATCTTACTGGAATTAAAAAT
ATTAGCGAAAGGAATTACAAATCTGACTCAACAACCTCCTCTGGTACAAC
TATTCCAATTTTGACTAGTAAAAGTTCTTACCGAAATGTTACAAATGAAC
CAGAAAAATTAAAATCAAACATTTTTCCTTTCAATAATCAATCCTCTTTT
CCTACTCTTAATATTTCAACTAAATGCGACACAATGCAGCACTCTATTTT
TCCTGATGTTCAAAATTCTTTTCCTCCAATGTTCAACCAGCATTCAATTA
ATACCAATCCTATGTTTCCTCTTCTCACTTACCATTCAGGAATAACGACA
CAACCGCCGCCTCCAATTTTTAATCCTTTATCAAATAATGCGCTTGCATT
TAATATGGGAGTGATGAATAAAGATAATAATAATCAGTCGAATAAAAAAA
GTCCTGGAAGTTGCACTGAAGATGAAGATGAAGGAGGAGCTACTCCTACT
CAGGATGAGCCAGCAACTAATATGTTCAATCCAAATGTTATACCTGTTAT
ACATCCAAGTGCTGAAGATATAAATAAACAAATTCAAAATGTGATGAATA
CAAATAATACCAATCCATTCAATTTGCCTAATCTAATTACTGGCACAAAT
GACTCACAACATAATAATTCTTTACAACAATCTCAATGGAATCAGTTTCC
ATTCAATTTGAAGAGCCCAAATATACAACCACCAATGAATATTCCATTTA
ATTTAATGAATCAAAGTACACCTATTCAACCAAGCTTCAGTCCTGTAAAT
ATTTCTAAAAATCCTTTGAATTTTGGTCCTCCAAGAGCAATTAGAACAAA
GCGACCAAATCCCGAATCAGGCACGAATCAAAGTAATAGTTGTGAAGTTT
ATAATATACCCGGTTCCGCTGACTATGCTTTATCACCACCGCCACCGCCA
CCACCACTACAATCAAAATCCGATGAAAATAATCAAAATATCATTCAAAA
TGAAGAAATTAATCAAGCTGAAAATGATAATAAAAACAACGGAAAAGAAT
CAGAATTATTGAATTTATATGATGATGTTGAGGAGGAATTGGACCGAAAT
TATAATTTCAATCAACAGAATATAAATGTAAGAAATTCTCGACCTCCTCC
GCCGTCAGATCGATATCATTTATATAATCAATCTGTCCCTCAAAATATGA
ATAGTTATCGATTCGGTGATGCTCACAACATCAGCAACAACAACAACAAT
AATAATAATATCAATTTCACTAAAATCAAATCCGATATCGACATCGATAT
TGATCGGGTGTATTTCCCGAATTTACACAACTCCCAAATCGTCACCGAAC
TGGAAACCGTAACCAATAGCAACACCAGCGGCAACACCTCGAAATTGTCC
CTGAAAGAATTACTTTCGACAAAAGAATCGATTTTATCCACCAAATCCAC
GAAAACTCCTGATTTCAACAAAACACCCGCTATCGATTGTCTTTTAAGCT
TTCCCTACAGCTGCTCGATTTGTCACAAGGGCTTCAATAGGGCTTCCAAT
TTGCAGCAGCATCTGTCGGTGCACACGAAACTCCGACCGTATCAGTGCCC
GAAGTGCCCTAAACGGTTCCGGCACCGGTGCAGCCTGAAAACCCACGAAG
CAACGAAACACAGCTCCGTAACGAAACTGTTGCGATGTCATTTGTGTTTG
AAATTGCTTAGGTCGCAGGTCGCCCTTAGAAACCACCTGAAACTCCACGT
GAGGGAATACTCAGTCCATTGTAAGGTCTGCTATAAAGGATTTGACTTGC
AGGAGGATCTGTCGAGGCATGTCGATGAGAAACACGCTGCCAGTTCCTCC
TGTATTGAAGGGCTTCCCGAGGGCAGGAAACCCGCCGGGGAACTGAGCTC
TAGCATCACCCATCATCATCATTATCATCATCAGCAGCAGCAAAAGCCTA
TTAAAGAAGTCATACCGGAAATCCCGAAAAAGCTAATAAAATGTCTTTCT
TGTTCATTCATTTTCAATACCAAAGCTAAATATGATAATCACTTCTGTGT
CGGGTTGAAGGCGGAGAAATCCCATTTGAATCGATGTTGTGATAAGACAT
TTGAATCGACATCTCAGTTTCTCTATCACGTGCAAGAAGTTCACAATCAA
TTGATCCAATATAACTGTGCTCAATGTAATATTATGTTTGCCCAAGAGTC
ATCTTATGTAAATCATCAAAAATCTGTTCATCATTTATGAATTTCCAACG
AGAGAAGAATTGCTGGTGTGGTTTTAAAATTCAAATGTATTTAATATATA
TATATATATTCTCG
back to top

protein sequence of SMED30028573-orf-1

>SMED30028573-orf-1 ID=SMED30028573-orf-1|Name=SMED30028573-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1184bp
MSRLKLDKDKILKKFKTISVTALSIQKTSKYMYQFYKSSDIVVSLWYQAL
CSAPDTCKISLFYVANEMLQSRNFGSSNFKQSWKSQLNPSLEYIKNSSVT
EKIIRMFNIWIERRVYEQSFIEDLINKLASSRSPINEEETKNIILNFDPE
DTITKLKNLMKIENEVNETLKRVDASALNFDEKSCKEAIKKLKDKVHCNE
FSNQLDGTINQLFQVCSLMEEELKIRQSTLKVMENAEVYYQTQLSETLVV
EDAYKRYGNLIAKTKDALEEHLDFLMDDAGPIDIDDAPSPGKTPPYLYDD
TVKNVNELKNSPMSFQDVISPTQSMDMSEDDTPMDSSVYSNKPYSPSNEV
EAKSDVNSSNTASIEEPKPSLSCSDALKILTSVFTQSLSKKVTPEPETRV
HLQPDIFRNTLSTSTVNSDMNNDSNNSSNNKSENQDSVVADAFRLISNLT
GIKNISERNYKSDSTTSSGTTIPILTSKSSYRNVTNEPEKLKSNIFPFNN
QSSFPTLNISTKCDTMQHSIFPDVQNSFPPMFNQHSINTNPMFPLLTYHS
GITTQPPPPIFNPLSNNALAFNMGVMNKDNNNQSNKKSPGSCTEDEDEGG
ATPTQDEPATNMFNPNVIPVIHPSAEDINKQIQNVMNTNNTNPFNLPNLI
TGTNDSQHNNSLQQSQWNQFPFNLKSPNIQPPMNIPFNLMNQSTPIQPSF
SPVNISKNPLNFGPPRAIRTKRPNPESGTNQSNSCEVYNIPGSADYALSP
PPPPPPLQSKSDENNQNIIQNEEINQAENDNKNNGKESELLNLYDDVEEE
LDRNYNFNQQNINVRNSRPPPPSDRYHLYNQSVPQNMNSYRFGDAHNISN
NNNNNNNINFTKIKSDIDIDIDRVYFPNLHNSQIVTELETVTNSNTSGNT
SKLSLKELLSTKESILSTKSTKTPDFNKTPAIDCLLSFPYSCSICHKGFN
RASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTKLLRC
HLCLKLLRSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHA
ASSSCIEGLPEGRKPAGELSSSITHHHHYHHQQQQKPIKEVIPEIPKKLI
KCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQE
VHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR015880Znf_C2H2-like
IPR006569CID_dom
IPR013087Znf_C2H2_type
IPR006903RNA_pol_II-bd
IPR007087Znf_C2H2
IPR008942ENTH_VHS
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 760..780
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 581..612
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 414..435
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 323..368
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 323..370
NoneNo IPR availablePANTHERPTHR12460:SF0REGULATION OF NUCLEAR PRE-MRNA DOMAIN-CONTAINING PROTEIN 2coord: 5..711
NoneNo IPR availablePANTHERPTHR12460CYCLIN-DEPENDENT KINASE INHIBITOR-RELATED PROTEINcoord: 5..711
NoneNo IPR availableCDDcd16981CID_RPRD_likecoord: 16..128
e-value: 4.03234E-21
score: 87.6363
IPR006569CID domainSMARTSM00582558neu5coord: 10..129
e-value: 1.8E-6
score: 37.5
IPR006569CID domainPROSITEPS51391CIDcoord: 1..132
score: 23.811
IPR006903RNA polymerase II-binding domainPFAMPF04818CTD_bindcoord: 58..116
e-value: 1.8E-8
score: 35.0
IPR008942ENTH/VHSGENE3DG3DSA:1.25.40.90coord: 5..141
e-value: 6.8E-21
score: 76.4
IPR008942ENTH/VHSSUPERFAMILYSSF48464ENTH/VHS domaincoord: 23..130